F418053

General Info

Members Datasets Scaffolds Average Seq Length
349 223 345 284

Family's Representative Sequence

Representative Sequence 3300053131|Ga0500652_001136|Ga0500652_001136_7154_8083
Length 309
Sequence VSSRNDRYENENRPHLTKGTSLSEHLRDIRELNADSDAYRDELFQRWTGLLSYRYIGRNHSAMNVGATDDTVTIRRDMRNEAGGIMVAPLAIASPEGCQTDMVAVPNPVIASVQIVDPGFDVSRIAIVGSGIMHQGRTMGYGRCAIVDADNPERTIAFNEGQGAIIGTPPEGLDKMDVSGTELVIEDSPDLPPLWHAFGAFRRPDRHWALPTLSRDLASPDAALHIGPQHVVLETAAIDLAAELAGTRKLQVVSWHVMFMSRGKVGPFRVEGTAVQGGARRIGVRMLLHDEGNEDKAITSAAAILDVME

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
3 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 0.86
Rhizoplane 12.03
Rhizosphere 71.63
Stem 0
Stem Tuber 0
Unclassified 7.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10004208 3300002077 Bacteria 2968
2 JGI24034J26672_10005621 3300002239 Bacteria 1799
3 JGI24742J22300_10000324 3300002244 Bacteria 7088
4 Ga0070676_10002153 3300005328 Bacteria 10030
5 Ga0070690_100224353 3300005330 Bacteria 1318
6 Ga0070666_10006827 3300005335 Bacteria 7032
7 Ga0070680_100160470 3300005336 Bacteria 1889
8 Ga0070682_100008293 3300005337 Bacteria 5857
9 Ga0070691_10029436 3300005341 Bacteria 2568
10 Ga0070692_10077610 3300005345 Bacteria 1782
11 Ga0070668_100000221 3300005347 Bacteria 36652
12 Ga0070668_100000350 3300005347 Bacteria 30426
13 Ga0070669_100000405 3300005353 Bacteria 33007
14 Ga0070669_100001553 3300005353 Bacteria 16616
15 Ga0070674_100000230 3300005356 Bacteria 27567
16 Ga0070673_100435549 3300005364 Bacteria 1177
17 Ga0070688_100011446 3300005365 Bacteria 4929
18 Ga0070667_100000077 3300005367 Bacteria 120245
19 Ga0070667_100000632 3300005367 Bacteria 34198
20 Ga0070667_100013100 3300005367 Bacteria 6854
21 Ga0070714_100170923 3300005435 Bacteria 1972
22 Ga0070710_10037853 3300005437 Bacteria 2647
23 Ga0070711_100000378 3300005439 Bacteria 22952
24 Ga0070711_100050788 3300005439 Bacteria 2845
25 Ga0070705_100007968 3300005440 Bacteria 5236
26 Ga0070700_100019320 3300005441 Bacteria 3930
27 Ga0070694_100042388 3300005444 Bacteria 3040
28 Ga0070678_100000472 3300005456 Bacteria 19253
29 Ga0068867_100003511 3300005459 Bacteria 11023
30 Ga0070685_10036261 3300005466 Bacteria 2787
31 Ga0070706_100147692 3300005467 Bacteria 2195
32 Ga0070698_100059854 3300005471 Bacteria 3845
33 Ga0070679_100224427 3300005530 Bacteria 1839
34 Ga0068853_100002903 3300005539 Bacteria 13021
35 Ga0070695_100011231 3300005545 Bacteria 5356
36 Ga0070696_100017833 3300005546 Bacteria 4793
37 Ga0070665_100024342 3300005548 Bacteria 6097
38 Ga0070704_100000434 3300005549 Bacteria 19572
39 Ga0068855_100051281 3300005563 Bacteria 4860
40 Ga0068855_100267575 3300005563 Bacteria 1902
41 Ga0068854_100004397 3300005578 Bacteria 8892
42 Ga0070702_100004119 3300005615 Bacteria 6602
43 Ga0068859_100000755 3300005617 Bacteria 32628
44 Ga0068859_100001515 3300005617 Bacteria 23713
45 Ga0068859_100009421 3300005617 Bacteria 9866
46 Ga0068864_100211057 3300005618 Bacteria 1788
47 Ga0068864_100258423 3300005618 Unclassified 1619
48 Ga0068866_10000175 3300005718 Bacteria 29959
49 Ga0068861_100000292 3300005719 Bacteria 28126
50 Ga0068863_100000389 3300005841 Bacteria 44673
51 Ga0068863_100012412 3300005841 Bacteria 8226
52 Ga0068858_100000340 3300005842 Bacteria 49532
53 Ga0068858_100006197 3300005842 Bacteria 11661
54 Ga0068858_100011922 3300005842 Bacteria 8192
55 Ga0068858_100215589 3300005842 Bacteria 1817
56 Ga0068860_100000010 3300005843 Bacteria 359114
57 Ga0068860_100000162 3300005843 Bacteria 109869
58 Ga0068860_100062109 3300005843 Bacteria 3550
59 Ga0068862_100000052 3300005844 Bacteria 144622
60 Ga0068862_100000234 3300005844 Bacteria 61937
61 Ga0068862_100057697 3300005844 Bacteria 3330
62 Ga0068862_100304381 3300005844 Bacteria 1467
63 Ga0081455_10110322 3300005937 Bacteria 2187
64 Ga0081455_10210099 3300005937 Bacteria 1451
65 Ga0081455_10237896 3300005937 Bacteria 1340
66 Ga0081539_10017178 3300005985 Bacteria 5097
67 Ga0070717_10235456 3300006028 Bacteria 1613
68 Ga0075363_100015986 3300006048 Bacteria 3700
69 Ga0075363_100021378 3300006048 Bacteria 3258
70 Ga0075364_10000418 3300006051 Bacteria 21287
71 Ga0075364_10025561 3300006051 Bacteria 3759
72 Ga0075364_10051791 3300006051 Bacteria 2682
73 Ga0075364_10123165 3300006051 Bacteria 1737
74 Ga0070716_100001581 3300006173 Bacteria 10234
75 Ga0070716_100125823 3300006173 Bacteria 1612
76 Ga0070712_100003597 3300006175 Bacteria 9553
77 Ga0070712_100018018 3300006175 Bacteria 4581
78 Ga0075367_10099087 3300006178 Bacteria 1780
79 Ga0075369_10004546 3300006186 Bacteria 5136
80 Ga0075369_10011242 3300006186 Bacteria 3519
81 Ga0068871_100105875 3300006358 Bacteria 2361
82 Ga0075428_100131587 3300006844 Bacteria 2721
83 Ga0075431_100036307 3300006847 Bacteria 5076
84 Ga0075429_100005843 3300006880 Bacteria 10616
85 Ga0068865_100000274 3300006881 Bacteria 28350
86 Ga0097620_100000755 3300006931 Bacteria 32628
87 Ga0097620_100001515 3300006931 Bacteria 23713
88 Ga0097620_100009421 3300006931 Bacteria 9866
89 Ga0105245_10000714 3300009098 Bacteria 29897
90 Ga0105247_10000079 3300009101 Bacteria 110309
91 Ga0105247_10000220 3300009101 Bacteria 54751
92 Ga0105247_10001259 3300009101 Bacteria 18787
93 Ga0114129_10240109 3300009147 Bacteria 2436
94 Ga0105243_10003910 3300009148 Bacteria 11890
95 Ga0105241_10209130 3300009174 Bacteria 1634
96 Ga0105242_10000182 3300009176 Bacteria 47986
97 Ga0105248_10000172 3300009177 Bacteria 75084
98 Ga0105248_10000745 3300009177 Bacteria 36573
99 Ga0105248_10004631 3300009177 Bacteria 15213
100 Ga0105248_10213837 3300009177 Bacteria 2172
101 Ga0105237_10093740 3300009545 Bacteria 2992
102 Ga0105238_10159673 3300009551 Bacteria 2230
103 Ga0105249_10000098 3300009553 Bacteria 120091
104 Ga0105249_10000534 3300009553 Bacteria 35070
105 Ga0105249_10001369 3300009553 Bacteria 21319
106 Ga0099796_10021843 3300010159 Bacteria 1977
107 Ga0105239_10108850 3300010375 Bacteria 3070
108 Ga0157370_10289624 3300013104 Bacteria 1512
109 Ga0157369_10080564 3300013105 Bacteria 3486
110 Ga0157369_10158041 3300013105 Bacteria 2394
111 Ga0157369_10177238 3300013105 Bacteria 2244
112 Ga0157378_10000481 3300013297 Bacteria 37930
113 Ga0163162_10128985 3300013306 Bacteria 2637
114 Ga0157372_10009714 3300013307 Bacteria 10231
115 Ga0157372_10861837 3300013307 Bacteria 1051
116 Ga0157375_10000354 3300013308 Bacteria 41651
117 Ga0163163_10027047 3300014325 Bacteria 5489
118 Ga0163163_10075737 3300014325 Bacteria 3358
119 Ga0157380_10000407 3300014326 Bacteria 26081
120 Ga0157377_10189776 3300014745 Bacteria 1298
121 Ga0157379_10009900 3300014968 Bacteria 8304
122 Ga0157379_10056945 3300014968 Bacteria 3493
123 Ga0163161_10004903 3300017792 Bacteria 9318
124 Ga0163161_10133753 3300017792 Bacteria 1872
125 Ga0213876_10099827 3300021384 Bacteria 1538
126 Ga0213875_10006514 3300021388 Bacteria 6116
127 Ga0207692_10026591 3300025898 Bacteria 2716
128 Ga0207642_10001101 3300025899 Bacteria 8388
129 Ga0207710_10000022 3300025900 Bacteria 335632
130 Ga0207710_10000204 3300025900 Bacteria 54757
131 Ga0207710_10042027 3300025900 Bacteria 2029
132 Ga0207688_10000081 3300025901 Bacteria 36211
133 Ga0207680_10069035 3300025903 Bacteria 2182
134 Ga0207647_10038660 3300025904 Bacteria 3016
135 Ga0207647_10086703 3300025904 Bacteria 1871
136 Ga0207699_10027918 3300025906 Bacteria 3131
137 Ga0207645_10114799 3300025907 Bacteria 1745
138 Ga0207693_10000292 3300025915 Bacteria 46487
139 Ga0207693_10089880 3300025915 Unclassified 2407
140 Ga0207693_10162954 3300025915 Bacteria 1755
141 Ga0207663_10015800 3300025916 Bacteria 4173
142 Ga0207660_10109898 3300025917 Bacteria 2073
143 Ga0207657_10371314 3300025919 Bacteria 1127
144 Ga0207652_10090170 3300025921 Bacteria 2693
145 Ga0207646_10111368 3300025922 Bacteria 2456
146 Ga0207681_10000319 3300025923 Bacteria 34721
147 Ga0207681_10001041 3300025923 Bacteria 17989
148 Ga0207681_10005648 3300025923 Bacteria 7678
149 Ga0207694_10287466 3300025924 Bacteria 1352
150 Ga0207694_10515140 3300025924 Bacteria 1002
151 Ga0207687_10003173 3300025927 Bacteria 11160
152 Ga0207700_10421014 3300025928 Bacteria 1173
153 Ga0207644_10021707 3300025931 Bacteria 4378
154 Ga0207706_10002110 3300025933 Bacteria 19455
155 Ga0207709_10007961 3300025935 Bacteria 5872
156 Ga0207669_10000810 3300025937 Bacteria 13415
157 Ga0207704_10091080 3300025938 Bacteria 2003
158 Ga0207665_10003679 3300025939 Bacteria 10237
159 Ga0207665_10089928 3300025939 Bacteria 2127
160 Ga0207665_10247329 3300025939 Bacteria 1316
161 Ga0207711_10000600 3300025941 Bacteria 36342
162 Ga0207711_10000667 3300025941 Bacteria 34138
163 Ga0207711_10047077 3300025941 Bacteria 3686
164 Ga0207711_10054892 3300025941 Bacteria 3420
165 Ga0207661_10069104 3300025944 Bacteria 2879
166 Ga0207661_10327559 3300025944 Bacteria 1378
167 Ga0207667_10071878 3300025949 Bacteria 3596
168 Ga0207667_10100481 3300025949 Bacteria 2984
169 Ga0207712_10000076 3300025961 Bacteria 120445
170 Ga0207712_10000905 3300025961 Bacteria 21476
171 Ga0207712_10029805 3300025961 Bacteria 3664
172 Ga0207668_10000212 3300025972 Bacteria 39395
173 Ga0207668_10027923 3300025972 Bacteria 3683
174 Ga0207640_10000732 3300025981 Bacteria 18897
175 Ga0207658_10000963 3300025986 Bacteria 23730
176 Ga0207658_10001055 3300025986 Bacteria 22349
177 Ga0207658_10043973 3300025986 Bacteria 3250
178 Ga0207677_10000558 3300026023 Bacteria 23566
179 Ga0207703_10006435 3300026035 Bacteria 9383
180 Ga0207703_10084218 3300026035 Bacteria 2658
181 Ga0207703_10127856 3300026035 Bacteria 2190
182 Ga0207639_10225169 3300026041 Bacteria 1622
183 Ga0207678_10519689 3300026067 Bacteria 1039
184 Ga0207708_10002119 3300026075 Bacteria 14635
185 Ga0207702_10133463 3300026078 Bacteria 2237
186 Ga0207641_10001390 3300026088 Bacteria 23826
187 Ga0207641_10002383 3300026088 Bacteria 17335
188 Ga0207648_10001214 3300026089 Bacteria 28857
189 Ga0207676_10232383 3300026095 Unclassified 1649
190 Ga0207675_100000390 3300026118 Bacteria 42092
191 Ga0207683_10000502 3300026121 Bacteria 36110
192 Ga0268266_10016948 3300028379 Bacteria 6224
193 Ga0268265_10000063 3300028380 Bacteria 144643
194 Ga0268265_10000245 3300028380 Bacteria 61952
195 Ga0268265_10010695 3300028380 Bacteria 6194
196 Ga0268264_10000007 3300028381 Bacteria 815790
197 Ga0268264_10000017 3300028381 Bacteria 498037
198 Ga0268264_10007313 3300028381 Bacteria 9234
199 Ga0373939_0097191 3300035114 Bacteria 1005
200 Ga0373931_0146713 3300035691 Bacteria 1372
201 Ga0436364_0840345 3300037853 Bacteria 4296
202 Ga0436364_0917836 3300037853 Bacteria 18655
203 Ga0436365_0441695 3300039437 Bacteria 31811
204 Ga0436365_1286763 3300039437 Bacteria 25555
205 Ga0436363_0961792 3300039450 Bacteria 2275
206 Ga0451833_0690587 3300041491 Bacteria 1064
207 Ga0466963_0050446 3300044694 Bacteria 2754
208 Ga0466964_0188197 3300044706 Bacteria 983
209 Ga0466971_0015521 3300044719 Bacteria 3354
210 Ga0466968_0150181 3300044735 Bacteria 1071
211 Ga0466957_0117148 3300044842 Bacteria 1695
212 Ga0466960_0000274 3300044901 Bacteria 17867
213 Ga0466958_0241956 3300045836 Bacteria 1153
214 Ga0466967_0014501 3300045976 Bacteria 6142
215 Ga0466967_0165585 3300045976 Bacteria 2077
216 Ga0466967_0225475 3300045976 Bacteria 1782
217 Ga0495603_0027919 3300046455 Bacteria 3404
218 Ga0495629_0013440 3300046459 Bacteria 5905
219 Ga0495638_0002049 3300046460 Bacteria 17130
220 Ga0495641_0014320 3300046461 Bacteria 4298
221 Ga0495653_0096306 3300046463 Bacteria 2152
222 Ga0495639_0184005 3300046475 Bacteria 1018
223 Ga0495608_0194818 3300046511 Bacteria 1278
224 Ga0495630_0515522 3300046517 Bacteria 917
225 Ga0495652_0340758 3300046529 Bacteria 1077
226 Ga0495640_0017233 3300046533 Bacteria 5387
227 Ga0495640_0132957 3300046533 Bacteria 1609
228 Ga0495667_0096635 3300046559 Bacteria 1912
229 Ga0495668_0264374 3300046616 Bacteria 942
230 Ga0495634_0260463 3300046642 Bacteria 1058
231 Ga0495625_0024976 3300046660 Bacteria 4539
232 Ga0495624_0081843 3300046690 Bacteria 1999
233 Ga0495649_0284262 3300046694 Bacteria 845
234 Ga0495674_0053067 3300047319 Bacteria 3566
235 Ga0495676_0102947 3300047321 Bacteria 2109
236 Ga0495680_0162614 3300047322 Bacteria 1620
237 Ga0495684_0084682 3300047471 Bacteria 2405
238 Ga0495593_0010815 3300047673 Bacteria 5261
239 Ga0496100_0003313 3300048903 Bacteria 8380
240 Ga0496100_0006303 3300048903 Bacteria 6462
241 Ga0496100_0007285 3300048903 Bacteria 6088
242 Ga0496101_0002167 3300048904 Bacteria 12000
243 Ga0496101_0005034 3300048904 Bacteria 8402
244 Ga0496101_0063032 3300048904 Unclassified 2697
245 Ga0496101_0077654 3300048904 Bacteria 2447
246 Ga0496102_0000112 3300048905 Bacteria 116902
247 Ga0496102_0000169 3300048905 Bacteria 88452
248 Ga0496102_0000810 3300048905 Bacteria 30460
249 Ga0496102_0399215 3300048905 Bacteria 1293
250 Ga0496102_0476133 3300048905 Bacteria 1170
251 Ga0496103_0000260 3300048906 Bacteria 50741
252 Ga0496103_0000778 3300048906 Bacteria 23469
253 Ga0496103_0004085 3300048906 Bacteria 8867
254 Ga0496104_0012551 3300048907 Bacteria 7623
255 Ga0496104_0032754 3300048907 Bacteria 4838
256 Ga0496105_0003220 3300048908 Bacteria 12026
257 Ga0496105_0024877 3300048908 Bacteria 4867
258 Ga0496106_0001545 3300048909 Bacteria 17337
259 Ga0496106_0005130 3300048909 Bacteria 9707
260 Ga0496106_0343327 3300048909 Bacteria 1199
261 Ga0496107_0000176 3300048910 Bacteria 33077
262 Ga0496107_0021377 3300048910 Bacteria 4573
263 Ga0496107_0062637 3300048910 Unclassified 2695
264 Ga0496107_0232191 3300048910 Bacteria 1373
265 Ga0496108_0058591 3300048911 Bacteria 3238
266 Ga0496108_0531103 3300048911 Bacteria 1027
267 Ga0496109_0070256 3300048912 Bacteria 3213
268 Ga0496109_0499145 3300048912 Bacteria 1149
269 Ga0496109_0660934 3300048912 Bacteria 982
270 Ga0496111_0230488 3300048914 Bacteria 1376
271 Ga0496112_0437420 3300048915 Bacteria 1246
272 Ga0496112_0683074 3300048915 Bacteria 955
273 Ga0496113_0103813 3300048916 Bacteria 2205
274 Ga0496113_0474779 3300048916 Bacteria 1005
275 Ga0496114_0000908 3300048917 Bacteria 22178
276 Ga0496114_0003299 3300048917 Bacteria 12390
277 Ga0496114_0093753 3300048917 Unclassified 2553
278 Ga0496115_0003611 3300048918 Bacteria 11126
279 Ga0496115_0005382 3300048918 Bacteria 9308
280 Ga0496115_0018477 3300048918 Bacteria 5353
281 Ga0496116_0010483 3300048919 Bacteria 7757
282 Ga0496117_0000197 3300048920 Bacteria 118822
283 Ga0496117_0002058 3300048920 Bacteria 26606
284 Ga0496118_0000171 3300048921 Bacteria 117495
285 Ga0496118_0000816 3300048921 Bacteria 49631
286 Ga0496118_0001434 3300048921 Bacteria 35889
287 Ga0496119_0002003 3300048922 Bacteria 23077
288 Ga0496119_0012763 3300048922 Bacteria 6781
289 Ga0496120_0011054 3300048923 Bacteria 6230
290 Ga0496121_0005250 3300048924 Bacteria 16747
291 Ga0496121_0052082 3300048924 Bacteria 3441
292 Ga0496124_0078500 3300048927 Bacteria 2720
293 Ga0496125_0013347 3300048928 Bacteria 8082
294 Ga0496125_0055846 3300048928 Bacteria 3212
295 Ga0496126_0002986 3300048929 Bacteria 21972
296 Ga0496126_0003494 3300048929 Bacteria 19830
297 Ga0496126_0024721 3300048929 Bacteria 5795
298 Ga0501033_0002939 3300049570 Bacteria 14246
299 Ga0501033_0008901 3300049570 Bacteria 7754
300 Ga0501033_0083670 3300049570 Bacteria 2339
301 Ga0501034_0000819 3300049571 Bacteria 46254
302 Ga0501037_0011475 3300049573 Bacteria 6524
303 Ga0501043_0028749 3300049579 Bacteria 4364
304 Ga0501046_0001146 3300049580 Bacteria 25795
305 Ga0501047_0001633 3300049581 Bacteria 21884
306 Ga0501048_0003582 3300049582 Bacteria 11821
307 Ga0501069_0000044 3300049585 Bacteria 75705
308 Ga0501069_0032990 3300049585 Bacteria 2850
309 Ga0501069_0105223 3300049585 Bacteria 1603
310 Ga0501070_0000001 3300049586 Bacteria 519187
311 Ga0501070_0000188 3300049586 Bacteria 58075
312 Ga0501080_0001455 3300049742 Bacteria 19928
313 Ga0501080_0035905 3300049742 Bacteria 4627
314 Ga0501035_0000466 3300049822 Bacteria 45324
315 Ga0501035_0129322 3300049822 Bacteria 2202
316 Ga0501035_0196108 3300049822 Bacteria 1734
317 Ga0501044_0000865 3300049823 Bacteria 36445
318 Ga0501044_0007545 3300049823 Bacteria 11959
319 nmdc:mga03n38_20273_c1 3300050490 Bacteria 2657
320 nmdc:mga03n38_211862_c1 3300050490 Bacteria 1007
321 nmdc:mga03n38_3799_c1 3300050490 Bacteria 4904
322 nmdc:mga00v17_13330_c1 3300050491 Bacteria 4561
323 nmdc:mga00v17_133478_c1 3300050491 Bacteria 1588
324 nmdc:mga00v17_915_c1 3300050491 Bacteria 15862
325 nmdc:mga06z11_208815_c1 3300050494 Bacteria 1137
326 nmdc:mga04h51_96512_c1 3300050495 Bacteria 1071
327 nmdc:mga07m45_11724_c1 3300050496 Bacteria 4612
328 nmdc:mga07m45_78349_c1 3300050496 Bacteria 1885
329 nmdc:mga09592_29698_c1 3300050508 Bacteria 4546
330 nmdc:mga0qj67_193749_c1 3300050509 Bacteria 1651
331 nmdc:mga06r32_127579_c1 3300050510 Bacteria 2514
332 nmdc:mga0sz30_400_c1 3300050516 Bacteria 16502
333 nmdc:mga0sz30_64641_c1 3300050516 Bacteria 1567
334 nmdc:mga0sz30_8967_c1 3300050516 Bacteria 3792
335 Ga0495601_0178832 3300053077 Bacteria 1387
336 Ga0500610_0001046 3300053079 Bacteria 9068
337 Ga0495595_0082686 3300053084 Bacteria 1532
338 Ga0495619_0023699 3300053085 Bacteria 3936
339 Ga0500556_0001025 3300053104 Bacteria 14612
340 Ga0500642_0119746 3300053130 Bacteria 1231
341 Ga0500652_001064 3300053131 Bacteria 8914
342 Ga0500652_001136 3300053131 Bacteria 8567
343 Ga0500616_0072754 3300053153 Bacteria 1747
344 Ga0500645_045510 3300053730 Unclassified 1289
345 Ga0466962_0081426 3300061719 Bacteria 1548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0284262 Ga0495649_0284262_59_790 242
2 3300046455 Ga0495603_0027919 Ga0495603_0027919_1741_2475 243
3 3300046459 Ga0495629_0013440 Ga0495629_0013440_4254_4988 243
4 3300046461 Ga0495641_0014320 Ga0495641_0014320_364_1098 243
5 3300046475 Ga0495639_0184005 Ga0495639_0184005_15_749 243
6 3300046533 Ga0495640_0017233 Ga0495640_0017233_443_1177 243
7 3300046642 Ga0495634_0260463 Ga0495634_0260463_299_1033 243
8 3300047321 Ga0495676_0102947 Ga0495676_0102947_1242_1976 243
9 3300047673 Ga0495593_0010815 Ga0495593_0010815_3434_4168 243
10 3300048909 Ga0496106_0343327 Ga0496106_0343327_44_778 243
11 3300050495 nmdc:mga04h51_96512_c1 nmdc:mga04h51_96512_c1_47_781 243
12 3300053085 Ga0495619_0023699 Ga0495619_0023699_1686_2420 243
13 3300025915 Ga0207693_10162954 Ga0207693_101629541 244
14 3300041491 Ga0451833_0690587 Ga0451833_0690587_16_753 244
15 3300050490 nmdc:mga03n38_211862_c1 nmdc:mga03n38_211862_c1_246_992 244
16 3300005471 Ga0070698_100059854 Ga0070698_1000598543 245
17 3300046463 Ga0495653_0096306 Ga0495653_0096306_1347_2087 245
18 3300046511 Ga0495608_0194818 Ga0495608_0194818_486_1226 245
19 3300046517 Ga0495630_0515522 Ga0495630_0515522_106_846 245
20 3300047319 Ga0495674_0053067 Ga0495674_0053067_749_1489 245
21 3300047322 Ga0495680_0162614 Ga0495680_0162614_656_1396 245
22 3300047471 Ga0495684_0084682 Ga0495684_0084682_1416_2156 245
23 3300048916 Ga0496113_0474779 Ga0496113_0474779_12_752 245
24 3300048905 Ga0496102_0476133 Ga0496102_0476133_104_931 274
25 3300048912 Ga0496109_0660934 Ga0496109_0660934_62_889 274
26 3300048915 Ga0496112_0683074 Ga0496112_0683074_13_840 274
27 3300049570 Ga0501033_0002939 Ga0501033_0002939_798_1631 274
28 3300049585 Ga0501069_0105223 Ga0501069_0105223_88_921 274
29 3300049823 Ga0501044_0007545 Ga0501044_0007545_5060_5893 274
30 3300025928 Ga0207700_10421014 Ga0207700_104210142 276
31 3300005844 Ga0068862_100304381 Ga0068862_1003043813 277
32 3300013105 Ga0157369_10080564 Ga0157369_100805643 277
33 3300044694 Ga0466963_0050446 Ga0466963_0050446_1182_2015 277
34 3300044706 Ga0466964_0188197 Ga0466964_0188197_62_895 277
35 3300044842 Ga0466957_0117148 Ga0466957_0117148_327_1160 277
36 3300044901 Ga0466960_0000274 Ga0466960_0000274_9317_10150 277
37 3300045836 Ga0466958_0241956 Ga0466958_0241956_44_877 277
38 3300045976 Ga0466967_0014501 Ga0466967_0014501_5035_5868 277
39 3300045976 Ga0466967_0225475 Ga0466967_0225475_298_1131 277
40 3300049570 Ga0501033_0008901 Ga0501033_0008901_6509_7342 277
41 3300049571 Ga0501034_0000819 Ga0501034_0000819_23011_23844 277
42 3300049573 Ga0501037_0011475 Ga0501037_0011475_878_1711 277
43 3300049579 Ga0501043_0028749 Ga0501043_0028749_3399_4232 277
44 3300049580 Ga0501046_0001146 Ga0501046_0001146_16965_17798 277
45 3300049581 Ga0501047_0001633 Ga0501047_0001633_15099_15932 277
46 3300049582 Ga0501048_0003582 Ga0501048_0003582_6594_7427 277
47 3300049585 Ga0501069_0032990 Ga0501069_0032990_680_1513 277
48 3300049586 Ga0501070_0000188 Ga0501070_0000188_5953_6786 277
49 3300049742 Ga0501080_0035905 Ga0501080_0035905_2480_3313 277
50 3300049822 Ga0501035_0000466 Ga0501035_0000466_11513_12346 277
51 3300049822 Ga0501035_0129322 Ga0501035_0129322_1122_1955 277
52 3300049823 Ga0501044_0000865 Ga0501044_0000865_5953_6786 277
53 3300050491 nmdc:mga00v17_13330_c1 nmdc:mga00v17_13330_c1_636_1469 277
54 3300050496 nmdc:mga07m45_11724_c1 nmdc:mga07m45_11724_c1_1934_2767 277
55 3300050496 nmdc:mga07m45_78349_c1 nmdc:mga07m45_78349_c1_805_1638 277
56 3300013105 Ga0157369_10177238 Ga0157369_101772382 278
57 3300039437 Ga0436365_0441695 Ga0436365_0441695_3099_3938 278
58 iso_pu_bacteria 2842134933 2842137935 278
59 iso_pu_bacteria 2939582691 2939588251 278
60 3300006844 Ga0075428_100131587 Ga0075428_1001315872 279
61 iso_pu_bacteria 2517572101 2517763152 279
62 iso_pu_bacteria 8002775197 8002775768 279
63 3300005563 Ga0068855_100267575 Ga0068855_1002675752 281
64 3300025949 Ga0207667_10071878 Ga0207667_100718783 281
65 3300005937 Ga0081455_10237896 Ga0081455_102378961 282
66 3300006186 Ga0075369_10011242 Ga0075369_100112424 282
67 3300006847 Ga0075431_100036307 Ga0075431_1000363072 282
68 3300006880 Ga0075429_100005843 Ga0075429_1000058438 282
69 3300009147 Ga0114129_10240109 Ga0114129_102401092 282
70 3300039450 Ga0436363_0961792 Ga0436363_0961792_55_909 282
71 3300049585 Ga0501069_0000044 Ga0501069_0000044_22655_23506 282
72 3300049586 Ga0501070_0000001 Ga0501070_0000001_264243_265094 282
73 3300049742 Ga0501080_0001455 Ga0501080_0001455_9822_10673 282
74 3300050508 nmdc:mga09592_29698_c1 nmdc:mga09592_29698_c1_3355_4209 282
75 3300050509 nmdc:mga0qj67_193749_c1 nmdc:mga0qj67_193749_c1_89_940 282
76 3300050510 nmdc:mga06r32_127579_c1 nmdc:mga06r32_127579_c1_1023_1877 282
77 3300050516 nmdc:mga0sz30_8967_c1 nmdc:mga0sz30_8967_c1_2583_3440 282
78 3300053131 Ga0500652_001064 Ga0500652_001064_323_1180 282
79 3300005467 Ga0070706_100147692 Ga0070706_1001476921 283
80 3300005530 Ga0070679_100224427 Ga0070679_1002244272 283
81 3300006048 Ga0075363_100021378 Ga0075363_1000213784 283
82 3300006051 Ga0075364_10123165 Ga0075364_101231652 283
83 3300006186 Ga0075369_10004546 Ga0075369_100045463 283
84 3300013307 Ga0157372_10861837 Ga0157372_108618371 283
85 3300025921 Ga0207652_10090170 Ga0207652_100901702 283
86 3300025922 Ga0207646_10111368 Ga0207646_101113684 283
87 3300046533 Ga0495640_0132957 Ga0495640_0132957_325_1182 283
88 3300046559 Ga0495667_0096635 Ga0495667_0096635_556_1413 283
89 3300050490 nmdc:mga03n38_3799_c1 nmdc:mga03n38_3799_c1_1474_2340 283
90 3300050491 nmdc:mga00v17_133478_c1 nmdc:mga00v17_133478_c1_329_1195 283
91 3300050494 nmdc:mga06z11_208815_c1 nmdc:mga06z11_208815_c1_206_1060 283
92 3300050516 nmdc:mga0sz30_64641_c1 nmdc:mga0sz30_64641_c1_492_1358 283
93 3300053730 Ga0500645_045510 Ga0500645_045510_290_1144 283
94 3300005618 Ga0068864_100211057 Ga0068864_1002110572 284
95 3300005937 Ga0081455_10210099 Ga0081455_102100992 284
96 3300005985 Ga0081539_10017178 Ga0081539_100171782 284
97 3300006028 Ga0070717_10235456 Ga0070717_102354562 284
98 3300006175 Ga0070712_100018018 Ga0070712_1000180185 284
99 3300025915 Ga0207693_10089880 Ga0207693_100898803 284
100 3300025919 Ga0207657_10371314 Ga0207657_103713142 284
101 3300025924 Ga0207694_10515140 Ga0207694_105151401 284
102 3300025944 Ga0207661_10327559 Ga0207661_103275592 284
103 3300026067 Ga0207678_10519689 Ga0207678_105196891 284
104 3300046529 Ga0495652_0340758 Ga0495652_0340758_104_961 284
105 3300046690 Ga0495624_0081843 Ga0495624_0081843_13_909 284
106 3300048903 Ga0496100_0007285 Ga0496100_0007285_4342_5199 284
107 3300048904 Ga0496101_0077654 Ga0496101_0077654_1253_2110 284
108 3300048907 Ga0496104_0032754 Ga0496104_0032754_3306_4163 284
109 3300048908 Ga0496105_0024877 Ga0496105_0024877_3186_4043 284
110 3300048910 Ga0496107_0062637 Ga0496107_0062637_1784_2641 284
111 3300048911 Ga0496108_0058591 Ga0496108_0058591_1815_2702 284
112 3300048911 Ga0496108_0531103 Ga0496108_0531103_147_1004 284
113 3300048915 Ga0496112_0437420 Ga0496112_0437420_228_1115 284
114 3300048917 Ga0496114_0093753 Ga0496114_0093753_412_1269 284
115 3300048918 Ga0496115_0018477 Ga0496115_0018477_2681_3538 284
116 3300050490 nmdc:mga03n38_20273_c1 nmdc:mga03n38_20273_c1_1518_2405 284
117 3300053077 Ga0495601_0178832 Ga0495601_0178832_140_997 284
118 3300053084 Ga0495595_0082686 Ga0495595_0082686_199_1056 284
119 3300006051 Ga0075364_10000418 Ga0075364_1000041818 285
120 3300044735 Ga0466968_0150181 Ga0466968_0150181_24_941 285
121 3300050491 nmdc:mga00v17_915_c1 nmdc:mga00v17_915_c1_10634_11491 285
122 3300050516 nmdc:mga0sz30_400_c1 nmdc:mga0sz30_400_c1_11581_12480 285
123 3300026078 Ga0207702_10133463 Ga0207702_101334632 286
124 3300048905 Ga0496102_0399215 Ga0496102_0399215_148_1032 286
125 3300048912 Ga0496109_0070256 Ga0496109_0070256_496_1380 286
126 3300048914 Ga0496111_0230488 Ga0496111_0230488_193_1077 286
127 3300048923 Ga0496120_0011054 Ga0496120_0011054_3507_4367 286
128 3300009177 Ga0105248_10004631 Ga0105248_100046317 287
129 3300013307 Ga0157372_10009714 Ga0157372_1000971412 287
130 3300028380 Ga0268265_10010695 Ga0268265_100106955 287
131 3300046460 Ga0495638_0002049 Ga0495638_0002049_13583_14461 287
132 3300046616 Ga0495668_0264374 Ga0495668_0264374_31_906 287
133 3300046660 Ga0495625_0024976 Ga0495625_0024976_3604_4467 287
134 3300048916 Ga0496113_0103813 Ga0496113_0103813_540_1406 287
135 3300053079 Ga0500610_0001046 Ga0500610_0001046_5495_6358 287
136 3300053104 Ga0500556_0001025 Ga0500556_0001025_10200_11078 287
137 3300002077 JGI24744J21845_10004208 JGI24744J21845_100042083 288
138 3300002239 JGI24034J26672_10005621 JGI24034J26672_100056212 288
139 3300002244 JGI24742J22300_10000324 JGI24742J22300_100003246 288
140 3300005328 Ga0070676_10002153 Ga0070676_1000215310 288
141 3300005330 Ga0070690_100224353 Ga0070690_1002243532 288
142 3300005335 Ga0070666_10006827 Ga0070666_100068272 288
143 3300005336 Ga0070680_100160470 Ga0070680_1001604702 288
144 3300005337 Ga0070682_100008293 Ga0070682_1000082935 288
145 3300005341 Ga0070691_10029436 Ga0070691_100294363 288
146 3300005345 Ga0070692_10077610 Ga0070692_100776101 288
147 3300005347 Ga0070668_100000221 Ga0070668_1000002218 288
148 3300005347 Ga0070668_100000350 Ga0070668_10000035019 288
149 3300005353 Ga0070669_100000405 Ga0070669_10000040517 288
150 3300005353 Ga0070669_100001553 Ga0070669_10000155312 288
151 3300005356 Ga0070674_100000230 Ga0070674_10000023019 288
152 3300005364 Ga0070673_100435549 Ga0070673_1004355491 288
153 3300005365 Ga0070688_100011446 Ga0070688_1000114465 288
154 3300005367 Ga0070667_100000077 Ga0070667_10000007710 288
155 3300005367 Ga0070667_100000632 Ga0070667_10000063213 288
156 3300005367 Ga0070667_100013100 Ga0070667_1000131003 288
157 3300005435 Ga0070714_100170923 Ga0070714_1001709232 288
158 3300005437 Ga0070710_10037853 Ga0070710_100378532 288
159 3300005439 Ga0070711_100000378 Ga0070711_1000003782 288
160 3300005439 Ga0070711_100050788 Ga0070711_1000507881 288
161 3300005440 Ga0070705_100007968 Ga0070705_1000079685 288
162 3300005441 Ga0070700_100019320 Ga0070700_1000193204 288
163 3300005444 Ga0070694_100042388 Ga0070694_1000423883 288
164 3300005456 Ga0070678_100000472 Ga0070678_10000047218 288
165 3300005459 Ga0068867_100003511 Ga0068867_1000035116 288
166 3300005466 Ga0070685_10036261 Ga0070685_100362612 288
167 3300005539 Ga0068853_100002903 Ga0068853_1000029032 288
168 3300005545 Ga0070695_100011231 Ga0070695_1000112313 288
169 3300005546 Ga0070696_100017833 Ga0070696_1000178335 288
170 3300005548 Ga0070665_100024342 Ga0070665_1000243425 288
171 3300005549 Ga0070704_100000434 Ga0070704_10000043418 288
172 3300005563 Ga0068855_100051281 Ga0068855_1000512815 288
173 3300005578 Ga0068854_100004397 Ga0068854_10000439710 288
174 3300005615 Ga0070702_100004119 Ga0070702_1000041194 288
175 3300005617 Ga0068859_100000755 Ga0068859_10000075518 288
176 3300005617 Ga0068859_100001515 Ga0068859_1000015157 288
177 3300005617 Ga0068859_100009421 Ga0068859_1000094218 288
178 3300005618 Ga0068864_100258423 Ga0068864_1002584231 288
179 3300005718 Ga0068866_10000175 Ga0068866_1000017518 288
180 3300005719 Ga0068861_100000292 Ga0068861_1000002929 288
181 3300005841 Ga0068863_100000389 Ga0068863_10000038927 288
182 3300005841 Ga0068863_100012412 Ga0068863_1000124127 288
183 3300005842 Ga0068858_100000340 Ga0068858_10000034033 288
184 3300005842 Ga0068858_100006197 Ga0068858_1000061972 288
185 3300005842 Ga0068858_100011922 Ga0068858_1000119227 288
186 3300005842 Ga0068858_100215589 Ga0068858_1002155892 288
187 3300005843 Ga0068860_100000010 Ga0068860_100000010339 288
188 3300005843 Ga0068860_100000162 Ga0068860_10000016289 288
189 3300005843 Ga0068860_100062109 Ga0068860_1000621094 288
190 3300005844 Ga0068862_100000052 Ga0068862_10000005215 288
191 3300005844 Ga0068862_100000234 Ga0068862_10000023412 288
192 3300005844 Ga0068862_100057697 Ga0068862_1000576974 288
193 3300005937 Ga0081455_10110322 Ga0081455_101103222 288
194 3300006048 Ga0075363_100015986 Ga0075363_1000159864 288
195 3300006051 Ga0075364_10025561 Ga0075364_100255612 288
196 3300006051 Ga0075364_10051791 Ga0075364_100517912 288
197 3300006173 Ga0070716_100001581 Ga0070716_1000015814 288
198 3300006173 Ga0070716_100125823 Ga0070716_1001258231 288
199 3300006175 Ga0070712_100003597 Ga0070712_1000035972 288
200 3300006178 Ga0075367_10099087 Ga0075367_100990872 288
201 3300006358 Ga0068871_100105875 Ga0068871_1001058752 288
202 3300006881 Ga0068865_100000274 Ga0068865_1000002744 288
203 3300006931 Ga0097620_100000755 Ga0097620_10000075518 288
204 3300006931 Ga0097620_100001515 Ga0097620_10000151514 288
205 3300006931 Ga0097620_100009421 Ga0097620_1000094216 288
206 3300009098 Ga0105245_10000714 Ga0105245_100007146 288
207 3300009101 Ga0105247_10000079 Ga0105247_1000007989 288
208 3300009101 Ga0105247_10000220 Ga0105247_1000022042 288
209 3300009101 Ga0105247_10001259 Ga0105247_1000125912 288
210 3300009148 Ga0105243_10003910 Ga0105243_100039102 288
211 3300009174 Ga0105241_10209130 Ga0105241_102091301 288
212 3300009176 Ga0105242_10000182 Ga0105242_1000018230 288
213 3300009177 Ga0105248_10000172 Ga0105248_1000017258 288
214 3300009177 Ga0105248_10000745 Ga0105248_1000074510 288
215 3300009177 Ga0105248_10213837 Ga0105248_102138372 288
216 3300009545 Ga0105237_10093740 Ga0105237_100937402 288
217 3300009551 Ga0105238_10159673 Ga0105238_101596732 288
218 3300009553 Ga0105249_10000098 Ga0105249_10000098103 288
219 3300009553 Ga0105249_10000534 Ga0105249_1000053421 288
220 3300009553 Ga0105249_10001369 Ga0105249_1000136915 288
221 3300010159 Ga0099796_10021843 Ga0099796_100218432 288
222 3300010375 Ga0105239_10108850 Ga0105239_101088502 288
223 3300013104 Ga0157370_10289624 Ga0157370_102896242 288
224 3300013105 Ga0157369_10158041 Ga0157369_101580413 288
225 3300013297 Ga0157378_10000481 Ga0157378_1000048118 288
226 3300013306 Ga0163162_10128985 Ga0163162_101289853 288
227 3300013308 Ga0157375_10000354 Ga0157375_1000035421 288
228 3300014325 Ga0163163_10027047 Ga0163163_100270473 288
229 3300014325 Ga0163163_10075737 Ga0163163_100757373 288
230 3300014326 Ga0157380_10000407 Ga0157380_1000040723 288
231 3300014745 Ga0157377_10189776 Ga0157377_101897761 288
232 3300014968 Ga0157379_10009900 Ga0157379_100099007 288
233 3300014968 Ga0157379_10056945 Ga0157379_100569452 288
234 3300017792 Ga0163161_10004903 Ga0163161_100049035 288
235 3300017792 Ga0163161_10133753 Ga0163161_101337531 288
236 3300021384 Ga0213876_10099827 Ga0213876_100998272 288
237 3300021388 Ga0213875_10006514 Ga0213875_100065147 288
238 3300025898 Ga0207692_10026591 Ga0207692_100265912 288
239 3300025899 Ga0207642_10001101 Ga0207642_100011012 288
240 3300025900 Ga0207710_10000022 Ga0207710_10000022181 288
241 3300025900 Ga0207710_10000204 Ga0207710_100002049 288
242 3300025900 Ga0207710_10042027 Ga0207710_100420271 288
243 3300025901 Ga0207688_10000081 Ga0207688_1000008116 288
244 3300025903 Ga0207680_10069035 Ga0207680_100690352 288
245 3300025904 Ga0207647_10038660 Ga0207647_100386603 288
246 3300025904 Ga0207647_10086703 Ga0207647_100867032 288
247 3300025906 Ga0207699_10027918 Ga0207699_100279183 288
248 3300025907 Ga0207645_10114799 Ga0207645_101147992 288
249 3300025915 Ga0207693_10000292 Ga0207693_1000029217 288
250 3300025916 Ga0207663_10015800 Ga0207663_100158004 288
251 3300025917 Ga0207660_10109898 Ga0207660_101098982 288
252 3300025923 Ga0207681_10000319 Ga0207681_1000031917 288
253 3300025923 Ga0207681_10001041 Ga0207681_1000104110 288
254 3300025923 Ga0207681_10005648 Ga0207681_100056487 288
255 3300025924 Ga0207694_10287466 Ga0207694_102874662 288
256 3300025927 Ga0207687_10003173 Ga0207687_100031735 288
257 3300025931 Ga0207644_10021707 Ga0207644_100217072 288
258 3300025933 Ga0207706_10002110 Ga0207706_1000211010 288
259 3300025935 Ga0207709_10007961 Ga0207709_100079612 288
260 3300025937 Ga0207669_10000810 Ga0207669_100008104 288
261 3300025938 Ga0207704_10091080 Ga0207704_100910802 288
262 3300025939 Ga0207665_10003679 Ga0207665_100036794 288
263 3300025939 Ga0207665_10089928 Ga0207665_100899282 288
264 3300025939 Ga0207665_10247329 Ga0207665_102473291 288
265 3300025941 Ga0207711_10000600 Ga0207711_1000060026 288
266 3300025941 Ga0207711_10000667 Ga0207711_1000066713 288
267 3300025941 Ga0207711_10047077 Ga0207711_100470773 288
268 3300025941 Ga0207711_10054892 Ga0207711_100548922 288
269 3300025944 Ga0207661_10069104 Ga0207661_100691042 288
270 3300025949 Ga0207667_10100481 Ga0207667_101004812 288
271 3300025961 Ga0207712_10000076 Ga0207712_10000076102 288
272 3300025961 Ga0207712_10000905 Ga0207712_1000090515 288
273 3300025961 Ga0207712_10029805 Ga0207712_100298054 288
274 3300025972 Ga0207668_10000212 Ga0207668_1000021215 288
275 3300025972 Ga0207668_10027923 Ga0207668_100279232 288
276 3300025981 Ga0207640_10000732 Ga0207640_100007322 288
277 3300025986 Ga0207658_10000963 Ga0207658_1000096317 288
278 3300025986 Ga0207658_10001055 Ga0207658_1000105513 288
279 3300025986 Ga0207658_10043973 Ga0207658_100439733 288
280 3300026023 Ga0207677_10000558 Ga0207677_1000055818 288
281 3300026035 Ga0207703_10006435 Ga0207703_100064352 288
282 3300026035 Ga0207703_10084218 Ga0207703_100842183 288
283 3300026035 Ga0207703_10127856 Ga0207703_101278562 288
284 3300026041 Ga0207639_10225169 Ga0207639_102251691 288
285 3300026075 Ga0207708_10002119 Ga0207708_1000211915 288
286 3300026088 Ga0207641_10001390 Ga0207641_1000139019 288
287 3300026088 Ga0207641_10002383 Ga0207641_1000238312 288
288 3300026089 Ga0207648_10001214 Ga0207648_1000121424 288
289 3300026095 Ga0207676_10232383 Ga0207676_102323831 288
290 3300026118 Ga0207675_100000390 Ga0207675_10000039034 288
291 3300026121 Ga0207683_10000502 Ga0207683_1000050210 288
292 3300028379 Ga0268266_10016948 Ga0268266_100169482 288
293 3300028380 Ga0268265_10000063 Ga0268265_1000006315 288
294 3300028380 Ga0268265_10000245 Ga0268265_1000024512 288
295 3300028381 Ga0268264_10000007 Ga0268264_10000007123 288
296 3300028381 Ga0268264_10000017 Ga0268264_10000017388 288
297 3300028381 Ga0268264_10007313 Ga0268264_100073135 288
298 3300035114 Ga0373939_0097191 Ga0373939_0097191_99_965 288
299 3300035691 Ga0373931_0146713 Ga0373931_0146713_171_1037 288
300 3300037853 Ga0436364_0840345 Ga0436364_0840345_366_1232 288
301 3300037853 Ga0436364_0917836 Ga0436364_0917836_11121_11990 288
302 3300039437 Ga0436365_1286763 Ga0436365_1286763_3934_4803 288
303 3300044719 Ga0466971_0015521 Ga0466971_0015521_1200_2087 288
304 3300045976 Ga0466967_0165585 Ga0466967_0165585_209_1075 288
305 3300048903 Ga0496100_0003313 Ga0496100_0003313_4606_5472 288
306 3300048903 Ga0496100_0006303 Ga0496100_0006303_1899_2780 288
307 3300048904 Ga0496101_0002167 Ga0496101_0002167_10379_11245 288
308 3300048904 Ga0496101_0005034 Ga0496101_0005034_7476_8357 288
309 3300048904 Ga0496101_0063032 Ga0496101_0063032_1482_2348 288
310 3300048905 Ga0496102_0000112 Ga0496102_0000112_115087_115953 288
311 3300048905 Ga0496102_0000169 Ga0496102_0000169_12526_13392 288
312 3300048905 Ga0496102_0000810 Ga0496102_0000810_11953_12819 288
313 3300048906 Ga0496103_0000260 Ga0496103_0000260_13834_14700 288
314 3300048906 Ga0496103_0000778 Ga0496103_0000778_14694_15560 288
315 3300048906 Ga0496103_0004085 Ga0496103_0004085_588_1454 288
316 3300048907 Ga0496104_0012551 Ga0496104_0012551_2928_3809 288
317 3300048908 Ga0496105_0003220 Ga0496105_0003220_5479_6360 288
318 3300048909 Ga0496106_0001545 Ga0496106_0001545_11230_12096 288
319 3300048909 Ga0496106_0005130 Ga0496106_0005130_2935_3816 288
320 3300048910 Ga0496107_0000176 Ga0496107_0000176_23577_24443 288
321 3300048910 Ga0496107_0021377 Ga0496107_0021377_535_1416 288
322 3300048910 Ga0496107_0232191 Ga0496107_0232191_70_936 288
323 3300048912 Ga0496109_0499145 Ga0496109_0499145_191_1072 288
324 3300048917 Ga0496114_0000908 Ga0496114_0000908_9900_10766 288
325 3300048917 Ga0496114_0003299 Ga0496114_0003299_9738_10619 288
326 3300048918 Ga0496115_0003611 Ga0496115_0003611_762_1628 288
327 3300048918 Ga0496115_0005382 Ga0496115_0005382_2414_3295 288
328 3300048919 Ga0496116_0010483 Ga0496116_0010483_3691_4557 288
329 3300048920 Ga0496117_0000197 Ga0496117_0000197_76233_77099 288
330 3300048920 Ga0496117_0002058 Ga0496117_0002058_10587_11453 288
331 3300048921 Ga0496118_0000171 Ga0496118_0000171_112445_113311 288
332 3300048921 Ga0496118_0000816 Ga0496118_0000816_7489_8355 288
333 3300048921 Ga0496118_0001434 Ga0496118_0001434_10095_10976 288
334 3300048922 Ga0496119_0002003 Ga0496119_0002003_3878_4744 288
335 3300048922 Ga0496119_0012763 Ga0496119_0012763_3545_4411 288
336 3300048924 Ga0496121_0005250 Ga0496121_0005250_14368_15234 288
337 3300048924 Ga0496121_0052082 Ga0496121_0052082_421_1287 288
338 3300048927 Ga0496124_0078500 Ga0496124_0078500_1408_2274 288
339 3300048928 Ga0496125_0013347 Ga0496125_0013347_2940_3806 288
340 3300048928 Ga0496125_0055846 Ga0496125_0055846_198_1064 288
341 3300048929 Ga0496126_0002986 Ga0496126_0002986_12439_13305 288
342 3300048929 Ga0496126_0003494 Ga0496126_0003494_1172_2038 288
343 3300048929 Ga0496126_0024721 Ga0496126_0024721_405_1271 288
344 3300049570 Ga0501033_0083670 Ga0501033_0083670_1240_2106 288
345 3300049822 Ga0501035_0196108 Ga0501035_0196108_211_1083 288
346 3300053130 Ga0500642_0119746 Ga0500642_0119746_272_1138 288
347 3300053131 Ga0500652_001136 Ga0500652_001136_7154_8083 288
348 3300053153 Ga0500616_0072754 Ga0500616_0072754_192_1058 288
349 3300061719 Ga0466962_0081426 Ga0466962_0081426_285_1172 288

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2b-assembly1.cif.gz_A crystal structure of the c-terminal domain of mouse acyl-coa thioesterase 7 0.849 202 284
4qda-assembly4.cif.gz_F crystal structure of mutant thioesterase pa1618 (e64a) from pseudomonas aeruginosa 0.8473 77 147
5dm5-assembly1.cif.gz_A crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.8398 200 288
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.8396 173 288
2qq2-assembly2.cif.gz_G crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.8376 202 288
ID Description Score Start End Superfamily
af_A0A1D6K9H0_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8849 212 288 3.10.129.10
af_Q9VMA4_98_246_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8625 203 285 3.10.129.10
5egjA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8438 202 288 3.10.129.10
2cwzA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8404 84 146 3.10.129.10
af_Q94245_291_459_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8404 202 287 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1X0JGX6-F1-model_v4 Thioesterase 0.9816 4 287
AF-A0A1X0JGX6-F1-model_v4 Thioesterase 0.9781 4 287
AF-A0A1B7UEA3-F1-model_v4 Uncharacterized protein 0.9766 1 203
AF-A0A255GVY5-F1-model_v4 Uncharacterized protein 0.9738 78 288
AF-A0A1B7UEA3-F1-model_v4 Uncharacterized protein 0.9719 1 203

Feature Viewer

pLDDT pTM Quality
91.68 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map