F418003

General Info

Members Datasets Scaffolds Average Seq Length
349 214 348 244

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0004523|Ga0495647_0004523_243_1097
Length 284
Sequence LDGWRCGRALAKKYKTFHPCLMGSSRPTVVILCGGRGTRLRERTETVPKALVEIGGRPILWHVIGIYAAQGFERFLLATGYLGEMVEGFAASESWPGGIAVECVDTGLDTPTGGRIARLDERLEDGTFCATYADGVADVDLGALLDFHRVHDALASVTVVQPRLQWGVVELADDGRVEGFVEKPRSEHWINGGFFCFEPGALDYLDENSVLEHEPLERLAADGQLRGYKHKGFWDCMDTYKDAVELNDLWASARAPWPTFSADWSLDPLIAWSNDQSASPGECR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.57
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 9.46
Rhizosphere 83.38
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015814 3300001979 Bacteria 2743
2 Ga0070683_100036000 3300005329 Bacteria 4528
3 Ga0070683_100117182 3300005329 Bacteria 2515
4 Ga0070677_10000008 3300005333 Bacteria 74027
5 Ga0070682_100000090 3300005337 Bacteria 82642
6 Ga0070691_10000044 3300005341 Bacteria 36029
7 Ga0070671_100101323 3300005355 Bacteria 2416
8 Ga0070659_100036169 3300005366 Bacteria 3848
9 Ga0070667_100155517 3300005367 Bacteria 2011
10 Ga0070703_10024980 3300005406 Bacteria 1769
11 Ga0070714_100161913 3300005435 Bacteria 2025
12 Ga0070714_100450166 3300005435 Bacteria 1223
13 Ga0070710_10000004 3300005437 Bacteria 270399
14 Ga0070710_10029915 3300005437 Bacteria 2926
15 Ga0070710_10329158 3300005437 Bacteria 1005
16 Ga0070711_100055054 3300005439 Bacteria 2747
17 Ga0068867_100005480 3300005459 Bacteria 8981
18 Ga0070685_10049549 3300005466 Bacteria 2423
19 Ga0070706_100078438 3300005467 Bacteria 3058
20 Ga0070679_100014554 3300005530 Bacteria 7558
21 Ga0070684_100177969 3300005535 Bacteria 1933
22 Ga0068853_100041279 3300005539 Bacteria 3940
23 Ga0070672_100296818 3300005543 Bacteria 1369
24 Ga0070665_100000135 3300005548 Bacteria 138925
25 Ga0070665_100080084 3300005548 Bacteria 3272
26 Ga0070704_100115774 3300005549 Bacteria 2049
27 Ga0068854_100059914 3300005578 Bacteria 2752
28 Ga0068856_100071931 3300005614 Bacteria 3424
29 Ga0068864_100000015 3300005618 Bacteria 303368
30 Ga0068866_10000008 3300005718 Bacteria 117658
31 Ga0068866_10002177 3300005718 Bacteria 8157
32 Ga0068861_100240266 3300005719 Bacteria 1540
33 Ga0068863_100000022 3300005841 Bacteria 188278
34 Ga0068863_100353574 3300005841 Bacteria 1431
35 Ga0068858_100004559 3300005842 Bacteria 13571
36 Ga0068858_100111574 3300005842 Bacteria 2554
37 Ga0068860_100022121 3300005843 Bacteria 6155
38 Ga0081455_10028717 3300005937 Bacteria 5078
39 Ga0081455_10320904 3300005937 Bacteria 1103
40 Ga0081538_10000229 3300005981 Bacteria 63078
41 Ga0081538_10000486 3300005981 Bacteria 44589
42 Ga0081538_10000959 3300005981 Bacteria 30827
43 Ga0081538_10008216 3300005981 Bacteria 8901
44 Ga0081538_10012402 3300005981 Bacteria 6831
45 Ga0081538_10026788 3300005981 Bacteria 4019
46 Ga0081538_10049948 3300005981 Bacteria 2532
47 Ga0081538_10055018 3300005981 Bacteria 2347
48 Ga0070717_10000019 3300006028 Bacteria 178051
49 Ga0075364_10169732 3300006051 Bacteria 1474
50 Ga0075432_10012026 3300006058 Bacteria 2941
51 Ga0075428_100086766 3300006844 Bacteria 3414
52 Ga0075428_100200644 3300006844 Bacteria 2156
53 Ga0075430_100065688 3300006846 Bacteria 3047
54 Ga0075430_100082696 3300006846 Bacteria 2690
55 Ga0075431_100002534 3300006847 Bacteria 17618
56 Ga0075431_100434162 3300006847 Bacteria 1311
57 Ga0075433_10406826 3300006852 Bacteria 1200
58 Ga0075434_100204106 3300006871 Bacteria 1997
59 Ga0075429_100016642 3300006880 Bacteria 6369
60 Ga0105240_10322050 3300009093 Bacteria 1762
61 Ga0105240_10511954 3300009093 Bacteria 1333
62 Ga0111539_10077221 3300009094 Bacteria 3920
63 Ga0111539_10397543 3300009094 Bacteria 1605
64 Ga0105245_10000415 3300009098 Bacteria 39764
65 Ga0105245_10001311 3300009098 Bacteria 22474
66 Ga0105245_11195609 3300009098 Bacteria 808
67 Ga0105247_10001706 3300009101 Bacteria 15492
68 Ga0114129_10018007 3300009147 Bacteria 10059
69 Ga0114129_10022570 3300009147 Bacteria 8927
70 Ga0114129_10110402 3300009147 Bacteria 3796
71 Ga0114129_10654308 3300009147 Bacteria 1356
72 Ga0105243_10525672 3300009148 Bacteria 1126
73 Ga0105242_10000603 3300009176 Bacteria 28175
74 Ga0105242_10047166 3300009176 Bacteria 3498
75 Ga0105238_10000055 3300009551 Bacteria 139232
76 Ga0105249_10000143 3300009553 Bacteria 92539
77 Ga0105239_10268795 3300010375 Bacteria 1917
78 Ga0157370_10003254 3300013104 Bacteria 19142
79 Ga0157374_10000486 3300013296 Bacteria 35981
80 Ga0157372_10169577 3300013307 Bacteria 2525
81 Ga0157372_10807748 3300013307 Unclassified 1090
82 Ga0157372_11124295 3300013307 Bacteria 909
83 Ga0157375_10014036 3300013308 Bacteria 7145
84 Ga0157375_10111493 3300013308 Bacteria 2835
85 Ga0157375_10245858 3300013308 Bacteria 1949
86 Ga0157375_10399591 3300013308 Bacteria 1541
87 Ga0157375_10892865 3300013308 Bacteria 1033
88 Ga0163163_10290939 3300014325 Bacteria 1686
89 Ga0163163_10704932 3300014325 Bacteria 1073
90 Ga0157380_10002828 3300014326 Bacteria 11801
91 Ga0157379_10006763 3300014968 Bacteria 9911
92 Ga0163161_10000053 3300017792 Bacteria 117408
93 Ga0206353_10710222 3300020082 Bacteria 1036
94 Ga0213876_10006406 3300021384 Bacteria 6416
95 Ga0213876_10019239 3300021384 Bacteria 3606
96 Ga0213875_10034779 3300021388 Bacteria 2379
97 Ga0213875_10037865 3300021388 Bacteria 2272
98 Ga0224712_10134735 3300022467 Bacteria 1082
99 Ga0207653_10025530 3300025885 Bacteria 1890
100 Ga0207692_10000002 3300025898 Bacteria 453100
101 Ga0207692_10109030 3300025898 Bacteria 1533
102 Ga0207642_10000002 3300025899 Bacteria 658166
103 Ga0207642_10000080 3300025899 Bacteria 25169
104 Ga0207710_10000157 3300025900 Bacteria 72764
105 Ga0207695_10219730 3300025913 Bacteria 1808
106 Ga0207663_10041078 3300025916 Bacteria 2816
107 Ga0207652_10001733 3300025921 Bacteria 19037
108 Ga0207652_10723977 3300025921 Bacteria 887
109 Ga0207694_10000063 3300025924 Bacteria 139700
110 Ga0207687_10000032 3300025927 Bacteria 143196
111 Ga0207687_10000460 3300025927 Bacteria 27723
112 Ga0207664_10067896 3300025929 Bacteria 2862
113 Ga0207690_10053568 3300025932 Bacteria 2708
114 Ga0207706_10000001 3300025933 Bacteria 423014
115 Ga0207686_10000097 3300025934 Bacteria 72219
116 Ga0207686_10136529 3300025934 Bacteria 1689
117 Ga0207686_10572137 3300025934 Bacteria 886
118 Ga0207669_10000017 3300025937 Bacteria 119878
119 Ga0207669_10000026 3300025937 Bacteria 92199
120 Ga0207661_10004460 3300025944 Bacteria 9836
121 Ga0207661_10101297 3300025944 Bacteria 2419
122 Ga0207712_10000058 3300025961 Bacteria 140948
123 Ga0207640_10071795 3300025981 Bacteria 2333
124 Ga0207703_10000287 3300026035 Bacteria 55757
125 Ga0207639_10005999 3300026041 Bacteria 8242
126 Ga0207708_10037657 3300026075 Bacteria 3684
127 Ga0207708_10330906 3300026075 Bacteria 1245
128 Ga0207702_10054454 3300026078 Bacteria 3390
129 Ga0207641_10000016 3300026088 Bacteria 307363
130 Ga0207641_10250058 3300026088 Bacteria 1655
131 Ga0207648_10015345 3300026089 Bacteria 7048
132 Ga0207676_10000018 3300026095 Bacteria 306375
133 Ga0207675_100063661 3300026118 Bacteria 3446
134 Ga0207675_100197006 3300026118 Bacteria 1934
135 Ga0207675_100646668 3300026118 Bacteria 1063
136 Ga0207683_10513839 3300026121 Bacteria 1107
137 Ga0268266_10000056 3300028379 Bacteria 289176
138 Ga0268266_10058937 3300028379 Bacteria 3307
139 Ga0268266_10677631 3300028379 Bacteria 993
140 Ga0265337_1000066 3300028556 Bacteria 48673
141 Ga0265326_10000019 3300028558 Bacteria 137370
142 Ga0265319_1000469 3300028563 Bacteria 28589
143 Ga0265322_10000011 3300028654 Bacteria 167597
144 Ga0265336_10002798 3300028666 Bacteria 7048
145 Ga0265338_10000244 3300028800 Bacteria 100528
146 Ga0265338_10158711 3300028800 Bacteria 1749
147 Ga0265324_10000283 3300029957 Bacteria 37587
148 Ga0265332_10116314 3300031238 Bacteria 1124
149 Ga0265328_10000737 3300031239 Bacteria 15188
150 Ga0265320_10000011 3300031240 Bacteria 249534
151 Ga0265325_10080624 3300031241 Bacteria 1618
152 Ga0265329_10004312 3300031242 Bacteria 5950
153 Ga0265339_10051838 3300031249 Bacteria 2237
154 Ga0265331_10000858 3300031250 Bacteria 24739
155 Ga0265331_10154688 3300031250 Bacteria 1040
156 Ga0265327_10000015 3300031251 Bacteria 496677
157 Ga0265327_10096961 3300031251 Bacteria 1429
158 Ga0307408_100402767 3300031548 Bacteria 1175
159 Ga0265313_10037260 3300031595 Bacteria 2434
160 Ga0265314_10000640 3300031711 Bacteria 42944
161 Ga0307405_10039203 3300031731 Bacteria 2861
162 Ga0307410_10073494 3300031852 Bacteria 2378
163 Ga0307410_10111216 3300031852 Bacteria 1982
164 Ga0307406_10031038 3300031901 Bacteria 3251
165 Ga0307407_10156851 3300031903 Bacteria 1485
166 Ga0307407_10407817 3300031903 Bacteria 977
167 Ga0307409_100006038 3300031995 Bacteria 7066
168 Ga0307409_100158198 3300031995 Bacteria 1978
169 Ga0307409_100212185 3300031995 Bacteria 1741
170 Ga0307409_100284229 3300031995 Bacteria 1531
171 Ga0307416_100086573 3300032002 Bacteria 2671
172 Ga0307416_100129729 3300032002 Bacteria 2267
173 Ga0307415_100390379 3300032126 Bacteria 1185
174 Ga0373960_0034283 3300035121 Bacteria 1435
175 Ga0316574_0159256 3300035398 Bacteria 1454
176 Ga0373931_0051488 3300035691 Bacteria 2193
177 Ga0373937_0093812 3300036401 Bacteria 2783
178 Ga0395898_0124015 3300037466 Bacteria 2475
179 Ga0395898_0135837 3300037466 Bacteria 2355
180 Ga0395898_0294326 3300037466 Bacteria 1549
181 Ga0395898_0822190 3300037466 Bacteria 869
182 Ga0395905_0575518 3300037471 Bacteria 1028
183 Ga0436364_0188717 3300037853 Bacteria 10257
184 Ga0436364_0986067 3300037853 Bacteria 2495
185 Ga0436364_1487859 3300037853 Bacteria 6007
186 Ga0436364_1506207 3300037853 Bacteria 1850
187 Ga0395901_0144870 3300038443 Bacteria 2497
188 Ga0395901_0293434 3300038443 Bacteria 1687
189 Ga0395901_0451318 3300038443 Bacteria 1315
190 Ga0395901_0458305 3300038443 Bacteria 1303
191 Ga0395901_0741607 3300038443 Bacteria 976
192 Ga0436365_0333914 3300039437 Bacteria 2704
193 Ga0436365_0555733 3300039437 Bacteria 8089
194 Ga0436365_0626783 3300039437 Bacteria 19138
195 Ga0436360_1183010 3300039438 Bacteria 2309
196 Ga0436363_0121634 3300039450 Bacteria 972
197 Ga0436363_0776109 3300039450 Bacteria 3547
198 Ga0436363_0873386 3300039450 Bacteria 930
199 Ga0436363_1015902 3300039450 Bacteria 1339
200 Ga0436363_1097204 3300039450 Bacteria 1222
201 Ga0436363_1714203 3300039450 Bacteria 4229
202 Ga0436362_0379975 3300039453 Bacteria 1289
203 Ga0451853_4068494 3300041512 Bacteria 1499
204 Ga0466966_0042305 3300044684 Bacteria 2925
205 Ga0466966_0096466 3300044684 Bacteria 1831
206 Ga0466963_0000017 3300044694 Bacteria 58283
207 Ga0466963_0028646 3300044694 Bacteria 3579
208 Ga0466963_0030187 3300044694 Bacteria 3496
209 Ga0466960_0136433 3300044901 Bacteria 1299
210 Ga0466958_0299734 3300045836 Bacteria 1032
211 Ga0466967_0031886 3300045976 Bacteria 4443
212 Ga0466967_0249157 3300045976 Bacteria 1696
213 Ga0495592_0000607 3300046454 Bacteria 25304
214 Ga0495592_0073999 3300046454 Bacteria 2475
215 Ga0495603_0000286 3300046455 Bacteria 26902
216 Ga0495603_0011493 3300046455 Bacteria 5358
217 Ga0495629_0000245 3300046459 Bacteria 47272
218 Ga0495629_0207877 3300046459 Bacteria 1352
219 Ga0495638_0027459 3300046460 Bacteria 3684
220 Ga0495641_0042388 3300046461 Bacteria 2109
221 Ga0495653_0005438 3300046463 Bacteria 10376
222 Ga0495653_0169316 3300046463 Bacteria 1509
223 Ga0495582_0000001 3300046473 Bacteria 252434
224 Ga0495662_0000001 3300046476 Bacteria 179185
225 Ga0495594_0000089 3300046499 Bacteria 41876
226 Ga0495608_0023011 3300046511 Bacteria 4272
227 Ga0495618_0000014 3300046514 Bacteria 163136
228 Ga0495618_0000486 3300046514 Bacteria 28336
229 Ga0495620_0072027 3300046515 Bacteria 1412
230 Ga0495628_0031056 3300046516 Bacteria 4321
231 Ga0495628_0074492 3300046516 Bacteria 2644
232 Ga0495630_0000298 3300046517 Bacteria 39988
233 Ga0495637_0177154 3300046520 Bacteria 792
234 Ga0495644_0001871 3300046523 Bacteria 8485
235 Ga0495652_0000037 3300046529 Bacteria 133232
236 Ga0495640_0043829 3300046533 Bacteria 3113
237 Ga0495587_0014521 3300046536 Bacteria 4938
238 Ga0495587_0038649 3300046536 Bacteria 2860
239 Ga0495587_0209192 3300046536 Bacteria 1102
240 Ga0495598_0005076 3300046537 Bacteria 2894
241 Ga0495621_0017300 3300046539 Bacteria 2328
242 Ga0495645_0000012 3300046543 Bacteria 209044
243 Ga0495645_0046873 3300046543 Bacteria 3150
244 Ga0495622_0000080 3300046557 Bacteria 85557
245 Ga0495634_0001744 3300046642 Bacteria 18826
246 Ga0495635_0000076 3300046663 Bacteria 61665
247 Ga0495657_0000007 3300046675 Bacteria 222471
248 Ga0495657_0024829 3300046675 Bacteria 4263
249 Ga0495599_0046673 3300046678 Bacteria 2716
250 Ga0495646_0151250 3300046680 Bacteria 1291
251 Ga0495647_0000001 3300046681 Bacteria 222371
252 Ga0495647_0004523 3300046681 Bacteria 4525
253 Ga0495658_0000002 3300046683 Bacteria 309651
254 Ga0495669_0000113 3300046684 Bacteria 52780
255 Ga0495613_0000005 3300046689 Bacteria 222558
256 Ga0495624_0001010 3300046690 Bacteria 22278
257 Ga0495624_0164285 3300046690 Bacteria 1355
258 Ga0495670_0089123 3300046691 Bacteria 1578
259 Ga0495649_0002403 3300046694 Bacteria 13212
260 Ga0495604_0001251 3300047317 Bacteria 20805
261 Ga0495674_0000030 3300047319 Bacteria 115975
262 Ga0495676_0000827 3300047321 Bacteria 25944
263 Ga0495676_0002855 3300047321 Bacteria 15572
264 Ga0495676_0278233 3300047321 Bacteria 1134
265 Ga0495680_0000143 3300047322 Bacteria 71946
266 Ga0495680_0001430 3300047322 Bacteria 25733
267 Ga0495680_0100958 3300047322 Bacteria 2149
268 Ga0495684_0008590 3300047471 Bacteria 7905
269 Ga0495686_0185105 3300047472 Bacteria 1204
270 Ga0496100_0000001 3300048903 Bacteria 530179
271 Ga0496100_0000013 3300048903 Bacteria 177476
272 Ga0496100_0167195 3300048903 Bacteria 1581
273 Ga0496101_0000004 3300048904 Bacteria 331599
274 Ga0496101_0000035 3300048904 Bacteria 177237
275 Ga0496104_0000052 3300048907 Bacteria 137286
276 Ga0496104_0080316 3300048907 Bacteria 3109
277 Ga0496105_0000030 3300048908 Bacteria 137325
278 Ga0496105_0017537 3300048908 Bacteria 5743
279 Ga0496105_0027673 3300048908 Bacteria 4634
280 Ga0496106_0000076 3300048909 Bacteria 79088
281 Ga0496106_0000121 3300048909 Bacteria 59910
282 Ga0496106_0004512 3300048909 Bacteria 10312
283 Ga0496106_0496910 3300048909 Bacteria 980
284 Ga0496107_0000005 3300048910 Bacteria 281747
285 Ga0496107_0000020 3300048910 Bacteria 148990
286 Ga0496108_0000006 3300048911 Bacteria 469473
287 Ga0496109_0000009 3300048912 Bacteria 236561
288 Ga0496109_0027208 3300048912 Bacteria 5104
289 Ga0496109_0071319 3300048912 Bacteria 3189
290 Ga0496109_0244736 3300048912 Bacteria 1688
291 Ga0496109_0898680 3300048912 Unclassified 824
292 Ga0496111_0013051 3300048914 Bacteria 5641
293 Ga0496111_0026900 3300048914 Bacteria 4065
294 Ga0496112_0000025 3300048915 Bacteria 146197
295 Ga0496112_0002927 3300048915 Bacteria 13911
296 Ga0496112_0009927 3300048915 Bacteria 8611
297 Ga0496112_0148803 3300048915 Bacteria 2309
298 Ga0496112_0466628 3300048915 Bacteria 1200
299 Ga0496113_0007203 3300048916 Bacteria 7127
300 Ga0496113_0053767 3300048916 Bacteria 3011
301 Ga0496114_0034207 3300048917 Bacteria 4191
302 Ga0496114_0070615 3300048917 Bacteria 2934
303 Ga0496125_0056109 3300048928 Bacteria 3202
304 Ga0501038_0546036 3300049574 Bacteria 882
305 Ga0501042_0272506 3300049578 Bacteria 1222
306 Ga0501048_0136158 3300049582 Bacteria 1736
307 Ga0501048_0371124 3300049582 Bacteria 1021
308 Ga0501068_0163148 3300049584 Bacteria 1405
309 Ga0501069_0028167 3300049585 Bacteria 3080
310 Ga0501072_0127916 3300049588 Bacteria 2024
311 Ga0501072_0407595 3300049588 Bacteria 1078
312 Ga0501074_0023989 3300049590 Bacteria 4433
313 Ga0501075_0044891 3300049591 Bacteria 3315
314 Ga0501075_0144806 3300049591 Bacteria 1811
315 Ga0501076_0339317 3300049592 Unclassified 1233
316 Ga0501077_0264231 3300049593 Bacteria 1095
317 Ga0501080_0002828 3300049742 Bacteria 15258
318 Ga0501045_0127128 3300049824 Bacteria 1894
319 Ga0501045_0222573 3300049824 Bacteria 1405
320 nmdc:mga05p37_104196_c1 3300050507 Bacteria 3490
321 nmdc:mga05p37_26494_c1 3300050507 Bacteria 7051
322 nmdc:mga05p37_547170_c1 3300050507 Bacteria 1318
323 nmdc:mga05p37_87299_c1 3300050507 Bacteria 3844
324 nmdc:mga09592_724886_c1 3300050508 Bacteria 845
325 nmdc:mga09592_853239_c1 3300050508 Bacteria 768
326 nmdc:mga09592_9130_c1 3300050508 Bacteria 8064
327 nmdc:mga06r32_274139_c1 3300050510 Bacteria 1674
328 nmdc:mga06r32_918124_c1 3300050510 Bacteria 831
329 nmdc:mga08y16_648350_c1 3300050511 Bacteria 1060
330 nmdc:mga0a205_139142_c1 3300050515 Bacteria 2328
331 Ga0495601_0000060 3300053077 Bacteria 60600
332 Ga0495601_0006994 3300053077 Bacteria 6609
333 Ga0495601_0030105 3300053077 Bacteria 3370
334 Ga0495601_0036251 3300053077 Bacteria 3079
335 Ga0495601_0059708 3300053077 Bacteria 2419
336 Ga0495612_0000033 3300053078 Bacteria 77643
337 Ga0495612_0000210 3300053078 Bacteria 24800
338 Ga0495612_0003362 3300053078 Bacteria 6629
339 Ga0495612_0005082 3300053078 Bacteria 5449
340 Ga0495655_0000002 3300053083 Bacteria 312752
341 Ga0495655_0015240 3300053083 Bacteria 1630
342 Ga0495595_0000045 3300053084 Bacteria 63054
343 Ga0495619_0000155 3300053085 Bacteria 50682
344 Ga0500556_0001503 3300053104 Bacteria 9623
345 Ga0500628_000001 3300053129 Bacteria 564074
346 Ga0500616_0004607 3300053153 Bacteria 9739
347 Ga0500599_004210 3300053736 Bacteria 1777
348 Ga0501082_0200786 3300060353 Bacteria 1735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0898680 Ga0496109_0898680_98_691 190
2 3300050508 nmdc:mga09592_853239_c1 nmdc:mga09592_853239_c1_57_719 192
3 3300049584 Ga0501068_0163148 Ga0501068_0163148_459_1172 199
4 3300050510 nmdc:mga06r32_918124_c1 nmdc:mga06r32_918124_c1_19_723 206
5 3300049582 Ga0501048_0371124 Ga0501048_0371124_48_854 207
6 3300006847 Ga0075431_100002534 Ga0075431_10000253414 215
7 3300005535 Ga0070684_100177969 Ga0070684_1001779693 216
8 3300025944 Ga0207661_10004460 Ga0207661_100044606 216
9 3300047322 Ga0495680_0001430 Ga0495680_0001430_7030_7725 216
10 3300005718 Ga0068866_10002177 Ga0068866_100021774 217
11 3300009098 Ga0105245_10000415 Ga0105245_100004159 217
12 3300009176 Ga0105242_10047166 Ga0105242_100471664 217
13 3300025899 Ga0207642_10000080 Ga0207642_1000008011 217
14 3300025927 Ga0207687_10000460 Ga0207687_100004606 217
15 3300025934 Ga0207686_10136529 Ga0207686_101365292 217
16 3300025937 Ga0207669_10000017 Ga0207669_1000001720 217
17 3300046694 Ga0495649_0002403 Ga0495649_0002403_1464_2162 217
18 3300048907 Ga0496104_0000052 Ga0496104_0000052_29706_30407 217
19 3300048908 Ga0496105_0000030 Ga0496105_0000030_106919_107620 217
20 3300046533 Ga0495640_0043829 Ga0495640_0043829_1089_1754 221
21 3300047319 Ga0495674_0000030 Ga0495674_0000030_12913_13578 221
22 3300047322 Ga0495680_0000143 Ga0495680_0000143_4803_5516 221
23 3300005333 Ga0070677_10000008 Ga0070677_1000000874 222
24 3300005366 Ga0070659_100036169 Ga0070659_1000361694 222
25 3300013308 Ga0157375_10014036 Ga0157375_100140364 222
26 3300013308 Ga0157375_10111493 Ga0157375_101114932 222
27 3300014326 Ga0157380_10002828 Ga0157380_1000282814 222
28 3300014968 Ga0157379_10006763 Ga0157379_100067634 222
29 3300025932 Ga0207690_10053568 Ga0207690_100535682 222
30 3300046536 Ga0495587_0038649 Ga0495587_0038649_879_1547 222
31 3300046678 Ga0495599_0046673 Ga0495599_0046673_1418_2128 222
32 3300046684 Ga0495669_0000113 Ga0495669_0000113_25160_25876 222
33 3300046690 Ga0495624_0164285 Ga0495624_0164285_499_1215 222
34 3300047317 Ga0495604_0001251 Ga0495604_0001251_11279_11995 222
35 3300048917 Ga0496114_0034207 Ga0496114_0034207_3322_4038 222
36 3300053077 Ga0495601_0000060 Ga0495601_0000060_32330_33046 222
37 3300053078 Ga0495612_0003362 Ga0495612_0003362_3473_4186 222
38 3300005341 Ga0070691_10000044 Ga0070691_1000004411 224
39 3300031995 Ga0307409_100212185 Ga0307409_1002121852 225
40 iso_pu_bacteria 8007375930 8007377584 225
41 3300005543 Ga0070672_100296818 Ga0070672_1002968182 226
42 3300013307 Ga0157372_10807748 Ga0157372_108077482 226
43 3300013308 Ga0157375_10245858 Ga0157375_102458582 226
44 3300005437 Ga0070710_10329158 Ga0070710_103291582 227
45 3300009147 Ga0114129_10018007 Ga0114129_100180072 227
46 3300050507 nmdc:mga05p37_87299_c1 nmdc:mga05p37_87299_c1_2337_3107 227
47 3300031903 Ga0307407_10407817 Ga0307407_104078172 228
48 3300046499 Ga0495594_0000089 Ga0495594_0000089_35941_36627 228
49 3300046557 Ga0495622_0000080 Ga0495622_0000080_78854_79540 228
50 3300046642 Ga0495634_0001744 Ga0495634_0001744_13549_14238 228
51 3300047472 Ga0495686_0185105 Ga0495686_0185105_218_904 228
52 3300048916 Ga0496113_0053767 Ga0496113_0053767_106_792 228
53 3300005435 Ga0070714_100450166 Ga0070714_1004501661 229
54 3300005843 Ga0068860_100022121 Ga0068860_1000221213 229
55 3300006880 Ga0075429_100016642 Ga0075429_1000166424 229
56 3300025929 Ga0207664_10067896 Ga0207664_100678964 229
57 3300046476 Ga0495662_0000001 Ga0495662_0000001_19888_20625 229
58 3300046690 Ga0495624_0001010 Ga0495624_0001010_19705_20442 229
59 3300050508 nmdc:mga09592_9130_c1 nmdc:mga09592_9130_c1_6229_7017 229
60 3300031995 Ga0307409_100284229 Ga0307409_1002842292 230
61 3300005937 Ga0081455_10320904 Ga0081455_103209042 231
62 3300035398 Ga0316574_0159256 Ga0316574_0159256_731_1432 231
63 3300032002 Ga0307416_100129729 Ga0307416_1001297292 232
64 3300045976 Ga0466967_0031886 Ga0466967_0031886_2342_3079 232
65 3300046517 Ga0495630_0000298 Ga0495630_0000298_31492_32217 232
66 3300046675 Ga0495657_0000007 Ga0495657_0000007_31316_32041 232
67 3300047471 Ga0495684_0008590 Ga0495684_0008590_2431_3156 232
68 3300053077 Ga0495601_0036251 Ga0495601_0036251_2084_2830 232
69 3300005981 Ga0081538_10000959 Ga0081538_100009594 233
70 3300039450 Ga0436363_1097204 Ga0436363_1097204_216_917 233
71 3300046514 Ga0495618_0000486 Ga0495618_0000486_10237_10965 233
72 3300046543 Ga0495645_0000012 Ga0495645_0000012_184027_184755 233
73 3300048915 Ga0496112_0002927 Ga0496112_0002927_2523_3263 233
74 3300048914 Ga0496111_0026900 Ga0496111_0026900_3190_3918 234
75 3300005437 Ga0070710_10000004 Ga0070710_10000004156 235
76 3300005467 Ga0070706_100078438 Ga0070706_1000784382 235
77 3300006028 Ga0070717_10000019 Ga0070717_1000001913 235
78 3300006844 Ga0075428_100200644 Ga0075428_1002006442 235
79 3300009148 Ga0105243_10525672 Ga0105243_105256722 235
80 3300010375 Ga0105239_10268795 Ga0105239_102687953 235
81 3300013308 Ga0157375_10399591 Ga0157375_103995912 235
82 3300013308 Ga0157375_10892865 Ga0157375_108928652 235
83 3300014325 Ga0163163_10290939 Ga0163163_102909392 235
84 3300020082 Ga0206353_10710222 Ga0206353_107102222 235
85 3300025898 Ga0207692_10000002 Ga0207692_10000002125 235
86 3300025921 Ga0207652_10723977 Ga0207652_107239771 235
87 3300025934 Ga0207686_10572137 Ga0207686_105721371 235
88 3300026118 Ga0207675_100646668 Ga0207675_1006466682 235
89 3300035691 Ga0373931_0051488 Ga0373931_0051488_1470_2180 235
90 3300038443 Ga0395901_0458305 Ga0395901_0458305_45_755 235
91 3300038443 Ga0395901_0741607 Ga0395901_0741607_180_890 235
92 3300041512 Ga0451853_4068494 Ga0451853_4068494_101_811 235
93 3300048903 Ga0496100_0167195 Ga0496100_0167195_675_1385 235
94 3300048907 Ga0496104_0080316 Ga0496104_0080316_414_1124 235
95 3300048908 Ga0496105_0017537 Ga0496105_0017537_583_1293 235
96 3300048909 Ga0496106_0004512 Ga0496106_0004512_5539_6258 235
97 3300048909 Ga0496106_0496910 Ga0496106_0496910_177_887 235
98 3300048912 Ga0496109_0071319 Ga0496109_0071319_1917_2627 235
99 3300048912 Ga0496109_0244736 Ga0496109_0244736_503_1213 235
100 3300048915 Ga0496112_0009927 Ga0496112_0009927_2674_3384 235
101 3300048915 Ga0496112_0148803 Ga0496112_0148803_1126_1836 235
102 3300048915 Ga0496112_0466628 Ga0496112_0466628_418_1131 235
103 3300048916 Ga0496113_0007203 Ga0496113_0007203_4273_4983 235
104 3300049593 Ga0501077_0264231 Ga0501077_0264231_373_1083 235
105 3300005435 Ga0070714_100161913 Ga0070714_1001619132 236
106 3300005981 Ga0081538_10000229 Ga0081538_1000022940 236
107 3300005981 Ga0081538_10008216 Ga0081538_100082169 236
108 3300005981 Ga0081538_10012402 Ga0081538_100124024 236
109 3300005981 Ga0081538_10026788 Ga0081538_100267883 236
110 3300005981 Ga0081538_10049948 Ga0081538_100499482 236
111 3300005981 Ga0081538_10055018 Ga0081538_100550182 236
112 3300006058 Ga0075432_10012026 Ga0075432_100120263 236
113 3300006844 Ga0075428_100086766 Ga0075428_1000867664 236
114 3300006846 Ga0075430_100082696 Ga0075430_1000826962 236
115 3300006852 Ga0075433_10406826 Ga0075433_104068262 236
116 3300009094 Ga0111539_10077221 Ga0111539_100772212 236
117 3300009094 Ga0111539_10397543 Ga0111539_103975431 236
118 3300009098 Ga0105245_11195609 Ga0105245_111956091 236
119 3300013307 Ga0157372_10169577 Ga0157372_101695772 236
120 3300021384 Ga0213876_10019239 Ga0213876_100192393 236
121 3300026075 Ga0207708_10330906 Ga0207708_103309061 236
122 3300026121 Ga0207683_10513839 Ga0207683_105138391 236
123 3300031548 Ga0307408_100402767 Ga0307408_1004027672 236
124 3300031731 Ga0307405_10039203 Ga0307405_100392032 236
125 3300031852 Ga0307410_10073494 Ga0307410_100734943 236
126 3300031852 Ga0307410_10111216 Ga0307410_101112162 236
127 3300031901 Ga0307406_10031038 Ga0307406_100310382 236
128 3300031903 Ga0307407_10156851 Ga0307407_101568512 236
129 3300031995 Ga0307409_100006038 Ga0307409_1000060384 236
130 3300031995 Ga0307409_100158198 Ga0307409_1001581981 236
131 3300032002 Ga0307416_100086573 Ga0307416_1000865731 236
132 3300032126 Ga0307415_100390379 Ga0307415_1003903792 236
133 3300035121 Ga0373960_0034283 Ga0373960_0034283_78_791 236
134 3300037466 Ga0395898_0294326 Ga0395898_0294326_693_1406 236
135 3300037466 Ga0395898_0822190 Ga0395898_0822190_46_759 236
136 3300037471 Ga0395905_0575518 Ga0395905_0575518_267_980 236
137 3300037853 Ga0436364_0986067 Ga0436364_0986067_435_1154 236
138 3300038443 Ga0395901_0293434 Ga0395901_0293434_449_1159 236
139 3300039437 Ga0436365_0333914 Ga0436365_0333914_360_1175 236
140 3300039437 Ga0436365_0626783 Ga0436365_0626783_4675_5394 236
141 3300039450 Ga0436363_0776109 Ga0436363_0776109_2415_3230 236
142 3300044684 Ga0466966_0096466 Ga0466966_0096466_123_836 236
143 3300044901 Ga0466960_0136433 Ga0466960_0136433_208_933 236
144 3300047321 Ga0495676_0278233 Ga0495676_0278233_367_1092 236
145 3300049574 Ga0501038_0546036 Ga0501038_0546036_63_776 236
146 3300050507 nmdc:mga05p37_547170_c1 nmdc:mga05p37_547170_c1_35_748 236
147 3300050508 nmdc:mga09592_724886_c1 nmdc:mga09592_724886_c1_59_772 236
148 3300050511 nmdc:mga08y16_648350_c1 nmdc:mga08y16_648350_c1_63_776 236
149 3300050515 nmdc:mga0a205_139142_c1 nmdc:mga0a205_139142_c1_133_846 236
150 3300053077 Ga0495601_0006994 Ga0495601_0006994_4205_5011 236
151 3300053078 Ga0495612_0000033 Ga0495612_0000033_69049_69870 236
152 3300053083 Ga0495655_0015240 Ga0495655_0015240_752_1465 236
153 3300053104 Ga0500556_0001503 Ga0500556_0001503_2534_3244 236
154 3300053153 Ga0500616_0004607 Ga0500616_0004607_2650_3360 236
155 3300053736 Ga0500599_004210 Ga0500599_004210_311_1021 236
156 3300005437 Ga0070710_10029915 Ga0070710_100299153 237
157 3300005719 Ga0068861_100240266 Ga0068861_1002402663 237
158 3300006846 Ga0075430_100065688 Ga0075430_1000656882 237
159 3300006871 Ga0075434_100204106 Ga0075434_1002041062 237
160 3300009147 Ga0114129_10022570 Ga0114129_1002257011 237
161 3300013307 Ga0157372_11124295 Ga0157372_111242952 237
162 3300021384 Ga0213876_10006406 Ga0213876_100064065 237
163 3300025898 Ga0207692_10109030 Ga0207692_101090301 237
164 3300026118 Ga0207675_100197006 Ga0207675_1001970063 237
165 3300037466 Ga0395898_0124015 Ga0395898_0124015_394_1110 237
166 3300037853 Ga0436364_1487859 Ga0436364_1487859_4307_5029 237
167 3300038443 Ga0395901_0144870 Ga0395901_0144870_747_1463 237
168 3300039437 Ga0436365_0555733 Ga0436365_0555733_2843_3565 237
169 3300039438 Ga0436360_1183010 Ga0436360_1183010_591_1316 237
170 3300039450 Ga0436363_0873386 Ga0436363_0873386_131_859 237
171 3300039450 Ga0436363_1714203 Ga0436363_1714203_3188_3910 237
172 3300039453 Ga0436362_0379975 Ga0436362_0379975_79_801 237
173 3300044684 Ga0466966_0042305 Ga0466966_0042305_1153_1866 237
174 3300044694 Ga0466963_0028646 Ga0466963_0028646_2149_2874 237
175 3300045836 Ga0466958_0299734 Ga0466958_0299734_289_1011 237
176 3300046463 Ga0495653_0005438 Ga0495653_0005438_7899_8708 237
177 3300046515 Ga0495620_0072027 Ga0495620_0072027_511_1227 237
178 3300046537 Ga0495598_0005076 Ga0495598_0005076_214_930 237
179 3300048912 Ga0496109_0027208 Ga0496109_0027208_3694_4494 237
180 3300049578 Ga0501042_0272506 Ga0501042_0272506_132_869 237
181 3300049588 Ga0501072_0127916 Ga0501072_0127916_706_1443 237
182 3300049588 Ga0501072_0407595 Ga0501072_0407595_68_805 237
183 3300049824 Ga0501045_0127128 Ga0501045_0127128_658_1395 237
184 3300050507 nmdc:mga05p37_26494_c1 nmdc:mga05p37_26494_c1_5041_5778 237
185 3300021388 Ga0213875_10037865 Ga0213875_100378653 238
186 3300037466 Ga0395898_0135837 Ga0395898_0135837_1154_1870 238
187 3300037853 Ga0436364_0188717 Ga0436364_0188717_5247_5975 238
188 3300046681 Ga0495647_0000001 Ga0495647_0000001_109961_110677 238
189 3300049582 Ga0501048_0136158 Ga0501048_0136158_58_894 238
190 3300049591 Ga0501075_0144806 Ga0501075_0144806_96_932 238
191 3300049592 Ga0501076_0339317 Ga0501076_0339317_185_1021 238
192 3300060353 Ga0501082_0200786 Ga0501082_0200786_818_1654 238
193 3300009553 Ga0105249_10000143 Ga0105249_1000014369 239
194 3300025961 Ga0207712_10000058 Ga0207712_10000058119 239
195 3300039450 Ga0436363_0121634 Ga0436363_0121634_85_813 239
196 3300039450 Ga0436363_1015902 Ga0436363_1015902_314_1093 239
197 3300005530 Ga0070679_100014554 Ga0070679_1000145543 240
198 3300005549 Ga0070704_100115774 Ga0070704_1001157742 240
199 3300005578 Ga0068854_100059914 Ga0068854_1000599142 240
200 3300005841 Ga0068863_100000022 Ga0068863_10000002272 240
201 3300005981 Ga0081538_10000486 Ga0081538_1000048627 240
202 3300006847 Ga0075431_100434162 Ga0075431_1004341621 240
203 3300009551 Ga0105238_10000055 Ga0105238_1000005523 240
204 3300013296 Ga0157374_10000486 Ga0157374_1000048612 240
205 3300017792 Ga0163161_10000053 Ga0163161_10000053118 240
206 3300022467 Ga0224712_10134735 Ga0224712_101347351 240
207 3300025921 Ga0207652_10001733 Ga0207652_1000173314 240
208 3300025924 Ga0207694_10000063 Ga0207694_10000063118 240
209 3300025981 Ga0207640_10071795 Ga0207640_100717953 240
210 3300026075 Ga0207708_10037657 Ga0207708_100376572 240
211 3300026088 Ga0207641_10000016 Ga0207641_10000016193 240
212 3300028563 Ga0265319_1000469 Ga0265319_100046924 240
213 3300028800 Ga0265338_10000244 Ga0265338_1000024492 240
214 3300031241 Ga0265325_10080624 Ga0265325_100806242 240
215 3300031250 Ga0265331_10154688 Ga0265331_101546882 240
216 3300036401 Ga0373937_0093812 Ga0373937_0093812_1007_1777 240
217 3300046455 Ga0495603_0011493 Ga0495603_0011493_297_1025 240
218 3300046463 Ga0495653_0169316 Ga0495653_0169316_562_1305 240
219 3300046511 Ga0495608_0023011 Ga0495608_0023011_2312_3055 240
220 3300046514 Ga0495618_0000014 Ga0495618_0000014_114476_115282 240
221 3300046689 Ga0495613_0000005 Ga0495613_0000005_100757_101497 240
222 3300048908 Ga0496105_0027673 Ga0496105_0027673_3034_3765 240
223 3300049591 Ga0501075_0044891 Ga0501075_0044891_2521_3261 240
224 3300053084 Ga0495595_0000045 Ga0495595_0000045_21473_22216 240
225 3300053085 Ga0495619_0000155 Ga0495619_0000155_42080_42811 240
226 3300005466 Ga0070685_10049549 Ga0070685_100495493 241
227 3300014325 Ga0163163_10704932 Ga0163163_107049321 241
228 3300046529 Ga0495652_0000037 Ga0495652_0000037_22444_23169 241
229 3300046536 Ga0495587_0209192 Ga0495587_0209192_85_810 241
230 3300053077 Ga0495601_0030105 Ga0495601_0030105_1560_2285 241
231 3300005618 Ga0068864_100000015 Ga0068864_100000015200 242
232 3300005937 Ga0081455_10028717 Ga0081455_100287175 242
233 3300006051 Ga0075364_10169732 Ga0075364_101697321 242
234 3300026095 Ga0207676_10000018 Ga0207676_10000018100 242
235 3300038443 Ga0395901_0451318 Ga0395901_0451318_95_829 242
236 3300046691 Ga0495670_0089123 Ga0495670_0089123_161_895 242
237 3300047321 Ga0495676_0002855 Ga0495676_0002855_12357_13091 242
238 3300048914 Ga0496111_0013051 Ga0496111_0013051_4556_5290 242
239 3300005329 Ga0070683_100036000 Ga0070683_1000360005 243
240 3300005337 Ga0070682_100000090 Ga0070682_1000000904 243
241 3300005355 Ga0070671_100101323 Ga0070671_1001013232 243
242 3300005367 Ga0070667_100155517 Ga0070667_1001555173 243
243 3300005548 Ga0070665_100080084 Ga0070665_1000800843 243
244 3300005841 Ga0068863_100353574 Ga0068863_1003535742 243
245 3300005842 Ga0068858_100111574 Ga0068858_1001115743 243
246 3300009093 Ga0105240_10511954 Ga0105240_105119543 243
247 3300009176 Ga0105242_10000603 Ga0105242_100006033 243
248 3300025933 Ga0207706_10000001 Ga0207706_10000001411 243
249 3300025934 Ga0207686_10000097 Ga0207686_1000009717 243
250 3300026088 Ga0207641_10250058 Ga0207641_102500582 243
251 3300028379 Ga0268266_10058937 Ga0268266_100589373 243
252 3300028379 Ga0268266_10677631 Ga0268266_106776311 243
253 3300044694 Ga0466963_0030187 Ga0466963_0030187_1770_2507 243
254 3300045976 Ga0466967_0249157 Ga0466967_0249157_780_1517 243
255 3300046454 Ga0495592_0073999 Ga0495592_0073999_143_874 243
256 3300046459 Ga0495629_0000245 Ga0495629_0000245_39591_40343 243
257 3300046459 Ga0495629_0207877 Ga0495629_0207877_330_1067 243
258 3300046460 Ga0495638_0027459 Ga0495638_0027459_979_1710 243
259 3300046461 Ga0495641_0042388 Ga0495641_0042388_271_1002 243
260 3300046516 Ga0495628_0074492 Ga0495628_0074492_1228_1968 243
261 3300046536 Ga0495587_0014521 Ga0495587_0014521_2900_3631 243
262 3300046543 Ga0495645_0046873 Ga0495645_0046873_1708_2442 243
263 3300046663 Ga0495635_0000076 Ga0495635_0000076_6282_7061 243
264 3300046675 Ga0495657_0024829 Ga0495657_0024829_2848_3630 243
265 3300046680 Ga0495646_0151250 Ga0495646_0151250_474_1214 243
266 3300048917 Ga0496114_0070615 Ga0496114_0070615_1171_1902 243
267 3300049824 Ga0501045_0222573 Ga0501045_0222573_648_1382 243
268 3300053077 Ga0495601_0059708 Ga0495601_0059708_1162_1902 243
269 3300053078 Ga0495612_0000210 Ga0495612_0000210_6633_7373 243
270 3300053083 Ga0495655_0000002 Ga0495655_0000002_200515_201246 243
271 3300053129 Ga0500628_000001 Ga0500628_000001_289184_289915 243
272 3300001979 JGI24740J21852_10015814 JGI24740J21852_100158143 244
273 3300005329 Ga0070683_100117182 Ga0070683_1001171822 244
274 3300005406 Ga0070703_10024980 Ga0070703_100249801 244
275 3300005439 Ga0070711_100055054 Ga0070711_1000550542 244
276 3300005459 Ga0068867_100005480 Ga0068867_1000054808 244
277 3300005539 Ga0068853_100041279 Ga0068853_1000412793 244
278 3300005548 Ga0070665_100000135 Ga0070665_10000013524 244
279 3300005614 Ga0068856_100071931 Ga0068856_1000719315 244
280 3300005718 Ga0068866_10000008 Ga0068866_10000008118 244
281 3300005842 Ga0068858_100004559 Ga0068858_10000455914 244
282 3300009093 Ga0105240_10322050 Ga0105240_103220502 244
283 3300009098 Ga0105245_10001311 Ga0105245_1000131120 244
284 3300009101 Ga0105247_10001706 Ga0105247_1000170610 244
285 3300009147 Ga0114129_10110402 Ga0114129_101104022 244
286 3300009147 Ga0114129_10654308 Ga0114129_106543082 244
287 3300013104 Ga0157370_10003254 Ga0157370_1000325411 244
288 3300021388 Ga0213875_10034779 Ga0213875_100347792 244
289 3300025885 Ga0207653_10025530 Ga0207653_100255302 244
290 3300025899 Ga0207642_10000002 Ga0207642_10000002551 244
291 3300025900 Ga0207710_10000157 Ga0207710_1000015763 244
292 3300025913 Ga0207695_10219730 Ga0207695_102197303 244
293 3300025916 Ga0207663_10041078 Ga0207663_100410782 244
294 3300025927 Ga0207687_10000032 Ga0207687_1000003221 244
295 3300025937 Ga0207669_10000026 Ga0207669_1000002611 244
296 3300025944 Ga0207661_10101297 Ga0207661_101012973 244
297 3300026035 Ga0207703_10000287 Ga0207703_1000028754 244
298 3300026041 Ga0207639_10005999 Ga0207639_100059996 244
299 3300026078 Ga0207702_10054454 Ga0207702_100544545 244
300 3300026089 Ga0207648_10015345 Ga0207648_100153453 244
301 3300026118 Ga0207675_100063661 Ga0207675_1000636614 244
302 3300028379 Ga0268266_10000056 Ga0268266_10000056173 244
303 3300028556 Ga0265337_1000066 Ga0265337_100006622 244
304 3300028558 Ga0265326_10000019 Ga0265326_10000019142 244
305 3300028654 Ga0265322_10000011 Ga0265322_10000011142 244
306 3300028666 Ga0265336_10002798 Ga0265336_100027983 244
307 3300028800 Ga0265338_10158711 Ga0265338_101587113 244
308 3300029957 Ga0265324_10000283 Ga0265324_1000028324 244
309 3300031238 Ga0265332_10116314 Ga0265332_101163142 244
310 3300031239 Ga0265328_10000737 Ga0265328_1000073713 244
311 3300031240 Ga0265320_10000011 Ga0265320_10000011142 244
312 3300031242 Ga0265329_10004312 Ga0265329_100043123 244
313 3300031249 Ga0265339_10051838 Ga0265339_100518383 244
314 3300031250 Ga0265331_10000858 Ga0265331_1000085820 244
315 3300031251 Ga0265327_10000015 Ga0265327_10000015250 244
316 3300031251 Ga0265327_10096961 Ga0265327_100969612 244
317 3300031595 Ga0265313_10037260 Ga0265313_100372603 244
318 3300031711 Ga0265314_10000640 Ga0265314_1000064035 244
319 3300037853 Ga0436364_1506207 Ga0436364_1506207_157_999 244
320 3300044694 Ga0466963_0000017 Ga0466963_0000017_25735_26481 244
321 3300046454 Ga0495592_0000607 Ga0495592_0000607_18356_19144 244
322 3300046455 Ga0495603_0000286 Ga0495603_0000286_15281_16015 244
323 3300046473 Ga0495582_0000001 Ga0495582_0000001_77768_78511 244
324 3300046516 Ga0495628_0031056 Ga0495628_0031056_1326_2114 244
325 3300046520 Ga0495637_0177154 Ga0495637_0177154_28_762 244
326 3300046523 Ga0495644_0001871 Ga0495644_0001871_4733_5524 244
327 3300046539 Ga0495621_0017300 Ga0495621_0017300_440_1174 244
328 3300046681 Ga0495647_0004523 Ga0495647_0004523_243_1097 244
329 3300046683 Ga0495658_0000002 Ga0495658_0000002_201374_202117 244
330 3300047321 Ga0495676_0000827 Ga0495676_0000827_9688_10422 244
331 3300047322 Ga0495680_0100958 Ga0495680_0100958_103_840 244
332 3300048903 Ga0496100_0000001 Ga0496100_0000001_424462_425196 244
333 3300048903 Ga0496100_0000013 Ga0496100_0000013_65582_66367 244
334 3300048904 Ga0496101_0000004 Ga0496101_0000004_225814_226548 244
335 3300048904 Ga0496101_0000035 Ga0496101_0000035_65582_66367 244
336 3300048909 Ga0496106_0000076 Ga0496106_0000076_21652_22386 244
337 3300048909 Ga0496106_0000121 Ga0496106_0000121_35483_36268 244
338 3300048910 Ga0496107_0000005 Ga0496107_0000005_105052_105786 244
339 3300048910 Ga0496107_0000020 Ga0496107_0000020_36731_37516 244
340 3300048911 Ga0496108_0000006 Ga0496108_0000006_341933_342718 244
341 3300048912 Ga0496109_0000009 Ga0496109_0000009_109021_109806 244
342 3300048915 Ga0496112_0000025 Ga0496112_0000025_109849_110631 244
343 3300048928 Ga0496125_0056109 Ga0496125_0056109_806_1591 244
344 3300049585 Ga0501069_0028167 Ga0501069_0028167_1278_2051 244
345 3300049590 Ga0501074_0023989 Ga0501074_0023989_1226_2002 244
346 3300049742 Ga0501080_0002828 Ga0501080_0002828_1660_2436 244
347 3300050507 nmdc:mga05p37_104196_c1 nmdc:mga05p37_104196_c1_197_946 244
348 3300050510 nmdc:mga06r32_274139_c1 nmdc:mga06r32_274139_c1_637_1386 244
349 3300053078 Ga0495612_0005082 Ga0495612_0005082_3355_4101 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

29

118

0.88

PF00483

NTP_transferase

Nucleotidyl transferase

28

251

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9108 2 236
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8881 1 236
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.875 2 236
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8568 1 236
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8437 4 229
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8881 1 236 3.90.550.10
af_A4I3X5_10_117_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8748 2 83 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8568 1 236 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8185 4 229 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.808 4 229 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V8ZHU4-F1-model_v4 NTP transferase domain-containing protein 0.9862 1 236 GO:0009058
GO:0047343
AF-A0A2E1NCM4-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9855 4 233 GO:0009058
GO:0047343
AF-A0A840IEV4-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.983 2 233 GO:0009058
GO:0047343
AF-A0A7V8ZHU4-F1-model_v4 NTP transferase domain-containing protein 0.978 1 236 GO:0009058
GO:0047343
AF-A0A7Y5XVL5-F1-model_v4 NTP transferase domain-containing protein 0.9775 1 189 GO:0009058
GO:0047343

Feature Viewer

pLDDT pTM Quality
91.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map