F417957

General Info

Members Datasets Scaffolds Average Seq Length
349 228 698 250

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0037986|Ga0373925_0037986_311_1159
Length 282
Sequence VSDRFHNKYRRMLMLQRWHRCWFWEIAVWRRKGIDMRGLDGRRVILTGGASGIGRAAALRLAAEGCVLGIFDLDEAGAQLTARQCAQAMAYRVDITDRDQVAASVASFEATWGPVQGLANVAGWDTPVAFLETDRALWDKVIQINLYGPLNMHHVVARGMAERGFGRVVNVASDAGRVGSSGEAVYSACKGGIIAFTKTLARELARKGVTLNVVCPGPTDTPLFDNFRAASPTIGDALARAVPLRRLGVPDDYAGMIAFLLSDDAAYITGQTISVSGGLTMA

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
222 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
223 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
224 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
225 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
226 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
227 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
228 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0.29
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 0.29
Rhizoplane 1.43
Rhizosphere 92.26
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0037986 3300037068 Bacteria 3557
2 JGI24741J21665_1000002 3300001915 Bacteria 64630
3 JGI24740J21852_10000005 3300001979 Bacteria 87250
4 JGI24739J22299_10037763 3300001989 Bacteria 1626
5 JGI24737J22298_10003464 3300001990 Bacteria 5575
6 JGI24737J22298_10021411 3300001990 Bacteria 2061
7 JGI24751J29686_10000134 3300002459 Bacteria 37360
8 JGI25406J46586_10001690 3300003203 Bacteria 10414
9 JGI25404J52841_10032212 3300003659 Bacteria 1118
10 JGI25405J52794_10010446 3300003911 Bacteria 1766
11 Ga0065707_10220755 3300005295 Bacteria 1226
12 Ga0070658_10000738 3300005327 Bacteria 28029
13 Ga0070658_10001208 3300005327 Bacteria 22135
14 Ga0070683_100382873 3300005329 Bacteria 1340
15 Ga0070690_100496228 3300005330 Bacteria 913
16 Ga0070680_100032762 3300005336 Bacteria 4184
17 Ga0068868_100549521 3300005338 Bacteria 1018
18 Ga0070660_100007378 3300005339 Bacteria 7659
19 Ga0070660_100349833 3300005339 Bacteria 1217
20 Ga0070689_100091619 3300005340 Bacteria 2397
21 Ga0070661_100002371 3300005344 Bacteria 12927
22 Ga0070675_100070770 3300005354 Bacteria 2892
23 Ga0070659_100001817 3300005366 Bacteria 15365
24 Ga0070709_10248685 3300005434 Bacteria 1280
25 Ga0070714_100366330 3300005435 Bacteria 1356
26 Ga0070713_100088115 3300005436 Bacteria 2663
27 Ga0070705_100281826 3300005440 Bacteria 1182
28 Ga0070694_100067368 3300005444 Bacteria 2458
29 Ga0070694_100378401 3300005444 Bacteria 1103
30 Ga0070708_100165714 3300005445 Bacteria 2061
31 Ga0070708_100196980 3300005445 Bacteria 1885
32 Ga0070663_100002745 3300005455 Bacteria 9977
33 Ga0070678_100022807 3300005456 Bacteria 4158
34 Ga0070681_10004615 3300005458 Bacteria 13154
35 Ga0070681_10034432 3300005458 Bacteria 5085
36 Ga0070681_10113060 3300005458 Bacteria 2655
37 Ga0070681_10196832 3300005458 Unclassified 1934
38 Ga0070706_100863247 3300005467 Bacteria 837
39 Ga0070707_100010182 3300005468 Bacteria 8752
40 Ga0070707_100439403 3300005468 Bacteria 1265
41 Ga0070698_100356002 3300005471 Bacteria 1395
42 Ga0070699_100669270 3300005518 Unclassified 948
43 Ga0070679_100008043 3300005530 Bacteria 9909
44 Ga0070679_100040612 3300005530 Bacteria 4628
45 Ga0070679_100078466 3300005530 Bacteria 3291
46 Ga0070679_100405890 3300005530 Bacteria 1308
47 Ga0070684_100049010 3300005535 Bacteria 3665
48 Ga0070697_100283673 3300005536 Bacteria 1421
49 Ga0068853_100028597 3300005539 Bacteria 4689
50 Ga0068853_100038681 3300005539 Unclassified 4064
51 Ga0068853_100118470 3300005539 Bacteria 2359
52 Ga0070696_100606620 3300005546 Bacteria 883
53 Ga0070665_100004342 3300005548 Bacteria 14911
54 Ga0070665_100082736 3300005548 Bacteria 3215
55 Ga0070665_100594941 3300005548 Bacteria 1119
56 Ga0068855_100005248 3300005563 Bacteria 15808
57 Ga0068855_100008502 3300005563 Bacteria 12409
58 Ga0068855_100022710 3300005563 Bacteria 7517
59 Ga0068855_100031638 3300005563 Bacteria 6318
60 Ga0068855_100075397 3300005563 Bacteria 3917
61 Ga0070664_100002556 3300005564 Bacteria 14671
62 Ga0068857_100064637 3300005577 Bacteria 3253
63 Ga0068857_100073716 3300005577 Bacteria 3042
64 Ga0068857_100177972 3300005577 Bacteria 1935
65 Ga0068854_100065852 3300005578 Bacteria 2635
66 Ga0068856_100015291 3300005614 Bacteria 7415
67 Ga0068856_100323948 3300005614 Bacteria 1558
68 Ga0068852_100061899 3300005616 Bacteria 3253
69 Ga0068852_100134741 3300005616 Bacteria 2280
70 Ga0068852_100154322 3300005616 Bacteria 2137
71 Ga0068864_100064293 3300005618 Bacteria 3182
72 Ga0068851_10006468 3300005834 Bacteria 5350
73 Ga0068851_10230592 3300005834 Bacteria 1044
74 Ga0081538_10022108 3300005981 Bacteria 4620
75 Ga0081540_1001323 3300005983 Bacteria 21619
76 Ga0081539_10000169 3300005985 Bacteria 153327
77 Ga0081539_10000987 3300005985 Bacteria 52947
78 Ga0081539_10009839 3300005985 Bacteria 7895
79 Ga0070717_10585543 3300006028 Bacteria 1012
80 Ga0070717_10627894 3300006028 Bacteria 975
81 Ga0075365_10043573 3300006038 Bacteria 2938
82 Ga0075364_10084574 3300006051 Bacteria 2101
83 Ga0075432_10058007 3300006058 Bacteria 1374
84 Ga0070716_100239540 3300006173 Bacteria 1229
85 Ga0070712_100113233 3300006175 Bacteria 2028
86 Ga0070712_100424728 3300006175 Bacteria 1102
87 Ga0075367_10002336 3300006178 Bacteria 8631
88 Ga0075367_10107515 3300006178 Bacteria 1710
89 Ga0075369_10020261 3300006186 Bacteria 2722
90 Ga0075366_10269392 3300006195 Bacteria 1040
91 Ga0075370_10041167 3300006353 Bacteria 2608
92 Ga0075428_100051064 3300006844 Bacteria 4534
93 Ga0075430_100000457 3300006846 Bacteria 30492
94 Ga0075434_100055022 3300006871 Unclassified 3954
95 Ga0075429_100240263 3300006880 Bacteria 1587
96 Ga0099794_10041565 3300007265 Bacteria 2189
97 Ga0099794_10051110 3300007265 Bacteria 1989
98 Ga0105240_10041842 3300009093 Bacteria 5843
99 Ga0105240_10097153 3300009093 Bacteria 3589
100 Ga0105240_10105752 3300009093 Bacteria 3415
101 Ga0105245_10167044 3300009098 Bacteria 2092
102 Ga0114129_10039139 3300009147 Bacteria 6686
103 Ga0105241_10000339 3300009174 Bacteria 35461
104 Ga0105241_10046735 3300009174 Bacteria 3288
105 Ga0105241_10903144 3300009174 Bacteria 820
106 Ga0105237_10013782 3300009545 Bacteria 8465
107 Ga0105237_10034719 3300009545 Bacteria 5104
108 Ga0105237_10050598 3300009545 Bacteria 4175
109 Ga0105237_10279091 3300009545 Bacteria 1673
110 Ga0105238_10049955 3300009551 Bacteria 4210
111 Ga0105238_10071960 3300009551 Bacteria 3455
112 Ga0105238_10072649 3300009551 Bacteria 3435
113 Ga0099796_10046967 3300010159 Bacteria 1484
114 Ga0105239_10046204 3300010375 Unclassified 4771
115 Ga0105239_10176085 3300010375 Bacteria 2393
116 Ga0157373_10042783 3300013100 Bacteria 3236
117 Ga0157371_10000111 3300013102 Bacteria 123977
118 Ga0157370_10008903 3300013104 Bacteria 10784
119 Ga0157370_10092729 3300013104 Bacteria 2834
120 Ga0157369_10016581 3300013105 Bacteria 8281
121 Ga0157374_10200644 3300013296 Bacteria 1953
122 Ga0157372_10052174 3300013307 Bacteria 4553
123 Ga0182008_10013777 3300014497 Bacteria 4248
124 Ga0182008_10107631 3300014497 Bacteria 1380
125 Ga0157376_10542173 3300014969 Bacteria 1150
126 Ga0157376_10585364 3300014969 Bacteria 1109
127 Ga0206353_10816538 3300020082 Bacteria 1095
128 Ga0207656_10001030 3300025321 Bacteria 9097
129 Ga0207647_10003157 3300025904 Bacteria 12363
130 Ga0207647_10005080 3300025904 Bacteria 9707
131 Ga0207699_10038506 3300025906 Bacteria 2741
132 Ga0207645_10118666 3300025907 Bacteria 1716
133 Ga0207705_10002837 3300025909 Bacteria 13262
134 Ga0207654_10001428 3300025911 Bacteria 12679
135 Ga0207707_10000281 3300025912 Bacteria 54266
136 Ga0207707_10185098 3300025912 Bacteria 1818
137 Ga0207707_10302211 3300025912 Unclassified 1384
138 Ga0207695_10001225 3300025913 Bacteria 43972
139 Ga0207695_10047814 3300025913 Bacteria 4523
140 Ga0207695_10154536 3300025913 Bacteria 2230
141 Ga0207695_10398967 3300025913 Bacteria 1260
142 Ga0207695_10496159 3300025913 Bacteria 1103
143 Ga0207671_10000676 3300025914 Bacteria 44438
144 Ga0207671_10184343 3300025914 Bacteria 1625
145 Ga0207671_10504154 3300025914 Bacteria 965
146 Ga0207693_10077598 3300025915 Bacteria 2601
147 Ga0207660_10010032 3300025917 Bacteria 6135
148 Ga0207660_10155745 3300025917 Bacteria 1759
149 Ga0207657_10000074 3300025919 Bacteria 93185
150 Ga0207657_10324542 3300025919 Bacteria 1217
151 Ga0207649_10000887 3300025920 Bacteria 18902
152 Ga0207649_10149008 3300025920 Bacteria 1609
153 Ga0207652_10027662 3300025921 Bacteria 4727
154 Ga0207652_10064846 3300025921 Bacteria 3161
155 Ga0207652_10492739 3300025921 Bacteria 1103
156 Ga0207646_10008447 3300025922 Bacteria 10321
157 Ga0207646_10337122 3300025922 Bacteria 1362
158 Ga0207694_10005711 3300025924 Bacteria 9536
159 Ga0207694_10023461 3300025924 Bacteria 4683
160 Ga0207694_10226885 3300025924 Bacteria 1525
161 Ga0207687_10404970 3300025927 Bacteria 1123
162 Ga0207700_10095433 3300025928 Bacteria 2359
163 Ga0207700_10167066 3300025928 Bacteria 1832
164 Ga0207700_10262244 3300025928 Bacteria 1480
165 Ga0207690_10000840 3300025932 Bacteria 19665
166 Ga0207706_10435137 3300025933 Bacteria 1136
167 Ga0207706_10762624 3300025933 Bacteria 824
168 Ga0207665_10072357 3300025939 Bacteria 2355
169 Ga0207691_10261275 3300025940 Bacteria 1493
170 Ga0207661_10045130 3300025944 Bacteria 3486
171 Ga0207679_10029809 3300025945 Bacteria 3802
172 Ga0207667_10000004 3300025949 Bacteria 737718
173 Ga0207667_10010709 3300025949 Bacteria 10698
174 Ga0207667_10159412 3300025949 Bacteria 2321
175 Ga0207667_10324608 3300025949 Bacteria 1572
176 Ga0207640_10050118 3300025981 Bacteria 2707
177 Ga0207640_10141137 3300025981 Bacteria 1756
178 Ga0207640_10170383 3300025981 Bacteria 1622
179 Ga0207639_10001431 3300026041 Bacteria 16123
180 Ga0207639_10008863 3300026041 Bacteria 6919
181 Ga0207639_10063363 3300026041 Bacteria 2863
182 Ga0207678_10000056 3300026067 Bacteria 86903
183 Ga0207702_10000087 3300026078 Bacteria 105856
184 Ga0207702_10029412 3300026078 Unclassified 4571
185 Ga0207674_10000121 3300026116 Bacteria 90479
186 Ga0207674_10004440 3300026116 Bacteria 16861
187 Ga0207674_10210755 3300026116 Bacteria 1892
188 Ga0207683_10052797 3300026121 Bacteria 3562
189 Ga0207698_10003375 3300026142 Bacteria 9621
190 Ga0207698_10041825 3300026142 Bacteria 3419
191 Ga0268266_10011284 3300028379 Bacteria 7776
192 Ga0268266_10299677 3300028379 Bacteria 1499
193 Ga0268266_10496680 3300028379 Bacteria 1165
194 Ga0307511_10131291 3300030521 Bacteria 1508
195 Ga0265330_10004113 3300031235 Bacteria 7452
196 Ga0265332_10000343 3300031238 Bacteria 34921
197 Ga0265328_10000579 3300031239 Bacteria 16960
198 Ga0265329_10004554 3300031242 Bacteria 5742
199 Ga0265329_10015358 3300031242 Bacteria 2675
200 Ga0265331_10000051 3300031250 Bacteria 181262
201 Ga0265331_10069012 3300031250 Bacteria 1656
202 Ga0265316_10000030 3300031344 Bacteria 162620
203 Ga0307408_100308091 3300031548 Bacteria 1329
204 Ga0316575_10045507 3300031665 Bacteria 1743
205 Ga0265314_10000386 3300031711 Bacteria 59716
206 Ga0265314_10013127 3300031711 Bacteria 6711
207 Ga0265314_10094398 3300031711 Bacteria 1939
208 Ga0265314_10101332 3300031711 Bacteria 1850
209 Ga0265342_10001309 3300031712 Bacteria 23352
210 Ga0265342_10077770 3300031712 Bacteria 1921
211 Ga0316578_10030088 3300031728 Bacteria 3085
212 Ga0307405_10004673 3300031731 Bacteria 6508
213 Ga0307405_10109138 3300031731 Bacteria 1871
214 Ga0316577_10112624 3300031733 Unclassified 1527
215 Ga0307413_10012040 3300031824 Bacteria 4287
216 Ga0307410_10012421 3300031852 Bacteria 4925
217 Ga0307406_10148633 3300031901 Bacteria 1668
218 Ga0307412_10000540 3300031911 Bacteria 22480
219 Ga0307409_100049333 3300031995 Bacteria 3209
220 Ga0307414_10000185 3300032004 Bacteria 42230
221 Ga0307411_10008837 3300032005 Bacteria 5248
222 Ga0307415_100003423 3300032126 Bacteria 8070
223 Ga0373923_0008921 3300035111 Bacteria 3597
224 Ga0373932_0085843 3300035112 Bacteria 1002
225 Ga0373936_0251050 3300035113 Bacteria 790
226 Ga0373956_0099068 3300035119 Bacteria 1350
227 Ga0373943_0127701 3300035170 Bacteria 1358
228 Ga0373955_0061371 3300035172 Bacteria 2076
229 Ga0373955_0070565 3300035172 Bacteria 1952
230 Ga0316574_0017450 3300035398 Bacteria 4202
231 Ga0373924_0129812 3300035410 Bacteria 1096
232 Ga0373931_0039173 3300035691 Bacteria 2483
233 Ga0373935_0011977 3300035692 Bacteria 5211
234 Ga0373935_0066017 3300035692 Bacteria 2323
235 Ga0373935_0170546 3300035692 Bacteria 1488
236 Ga0373935_0462550 3300035692 Bacteria 917
237 Ga0373927_0055907 3300035695 Bacteria 2551
238 Ga0373933_0031579 3300035724 Bacteria 3072
239 Ga0373933_0066096 3300035724 Bacteria 2190
240 Ga0373933_0168187 3300035724 Bacteria 1394
241 Ga0373947_0028178 3300035725 Bacteria 3290
242 Ga0373947_0168767 3300035725 Bacteria 1419
243 Ga0373937_0026083 3300036401 Bacteria 5280
244 Ga0373937_0041911 3300036401 Bacteria 4177
245 Ga0316584_0006708 3300036712 Bacteria 7808
246 Ga0373925_0222022 3300037068 Bacteria 1508
247 Ga0373925_0374253 3300037068 Bacteria 1159
248 Ga0373925_0377175 3300037068 Bacteria 1154
249 Ga0373925_0396445 3300037068 Bacteria 1125
250 Ga0373925_0436279 3300037068 Bacteria 1071
251 Ga0373925_0664964 3300037068 Bacteria 859
252 Ga0395899_0000115 3300037312 Bacteria 133287
253 Ga0395899_0043328 3300037312 Bacteria 3357
254 Ga0395900_0000002 3300037418 Bacteria 671103
255 Ga0395900_0385196 3300037418 Bacteria 1369
256 Ga0395898_0014912 3300037466 Bacteria 7979
257 Ga0395905_0727476 3300037471 Bacteria 895
258 Ga0436364_0453766 3300037853 Bacteria 1118
259 Ga0395901_0000021 3300038443 Bacteria 307734
260 Ga0395901_0010514 3300038443 Bacteria 9372
261 Ga0436360_0315794 3300039438 Bacteria 2765
262 Ga0436360_1022929 3300039438 Bacteria 1905
263 Ga0436360_1051214 3300039438 Bacteria 898
264 Ga0436361_0740576 3300039447 Bacteria 4062
265 Ga0436361_1197697 3300039447 Bacteria 1059
266 Ga0436363_0578241 3300039450 Bacteria 2098
267 Ga0451577_0175667 3300042876 Bacteria 1931
268 Ga0466963_0031591 3300044694 Bacteria 3424
269 Ga0466963_0097121 3300044694 Bacteria 2013
270 Ga0466963_0160697 3300044694 Bacteria 1563
271 Ga0466957_0162407 3300044842 Bacteria 1451
272 Ga0466958_0093273 3300045836 Bacteria 1865
273 Ga0466967_0314232 3300045976 Bacteria 1510
274 Ga0466967_0369413 3300045976 Bacteria 1391
275 Ga0466967_1097932 3300045976 Bacteria 793
276 Ga0495592_0018077 3300046454 Bacteria 5356
277 Ga0495592_0339555 3300046454 Bacteria 966
278 Ga0495651_0035927 3300046462 Bacteria 3857
279 Ga0495651_0134655 3300046462 Bacteria 1799
280 Ga0495650_0048046 3300046471 Bacteria 1781
281 Ga0495580_0100996 3300046472 Bacteria 2006
282 Ga0495639_0134724 3300046475 Bacteria 1184
283 Ga0495662_0028489 3300046476 Bacteria 2696
284 Ga0495664_0003717 3300046477 Bacteria 8322
285 Ga0495664_0067077 3300046477 Bacteria 2140
286 Ga0495664_0183274 3300046477 Bacteria 1269
287 Ga0495608_0051891 3300046511 Bacteria 2716
288 Ga0495628_0235522 3300046516 Bacteria 1371
289 Ga0495630_0075239 3300046517 Bacteria 2544
290 Ga0495652_0124451 3300046529 Bacteria 2051
291 Ga0495640_0039338 3300046533 Bacteria 3319
292 Ga0495640_0042279 3300046533 Bacteria 3181
293 Ga0495587_0033658 3300046536 Bacteria 3092
294 Ga0495645_0115376 3300046543 Bacteria 1897
295 Ga0495645_0147769 3300046543 Bacteria 1635
296 Ga0495667_0085839 3300046559 Bacteria 2042
297 Ga0495634_0011672 3300046642 Bacteria 6390
298 Ga0495635_0079696 3300046663 Bacteria 2241
299 Ga0495623_0006693 3300046679 Bacteria 7498
300 Ga0495646_0058326 3300046680 Bacteria 2308
301 Ga0495658_0033900 3300046683 Bacteria 2799
302 Ga0495624_0288174 3300046690 Bacteria 991
303 Ga0495581_0068784 3300047315 Bacteria 2047
304 Ga0495604_0039544 3300047317 Bacteria 3707
305 Ga0495674_0012181 3300047319 Bacteria 8105
306 Ga0495674_0100454 3300047319 Bacteria 2462
307 Ga0495672_0008803 3300047320 Bacteria 7390
308 Ga0495672_0049626 3300047320 Bacteria 2483
309 Ga0495676_0349716 3300047321 Bacteria 988
310 Ga0495680_0218115 3300047322 Bacteria 1363
311 Ga0495675_0115810 3300047444 Bacteria 1671
312 Ga0495684_0011161 3300047471 Bacteria 6942
313 Ga0495684_0122637 3300047471 Bacteria 1956
314 Ga0495684_0197776 3300047471 Bacteria 1483
315 Ga0495593_0011648 3300047673 Bacteria 5047
316 Ga0495602_0007536 3300048088 Bacteria 11387
317 Ga0496101_0113165 3300048904 Bacteria 2045
318 Ga0496102_0164733 3300048905 Bacteria 2086
319 Ga0496104_0003626 3300048907 Bacteria 13338
320 Ga0496105_0017893 3300048908 Bacteria 5688
321 Ga0496110_0737287 3300048913 Bacteria 888
322 Ga0496126_0119007 3300048929 Bacteria 2292
323 Ga0501034_0045339 3300049571 Bacteria 4443
324 Ga0501038_0235856 3300049574 Bacteria 1454
325 Ga0501043_0200275 3300049579 Bacteria 1550
326 Ga0501046_0127658 3300049580 Bacteria 1931
327 Ga0501080_0055502 3300049742 Bacteria 3690
328 nmdc:mga00v17_10407_c1 3300050491 Bacteria 5076
329 nmdc:mga0yw44_1207_c1 3300050492 Bacteria 10116
330 nmdc:mga0yw44_46333_c1 3300050492 Bacteria 2610
331 nmdc:mga0k408_322442_c1 3300050493 Bacteria 922
332 nmdc:mga06z11_7370_c1 3300050494 Bacteria 4521
333 nmdc:mga07m45_10118_c1 3300050496 Bacteria 4915
334 nmdc:mga05p37_15645_c1 3300050507 Bacteria 6123
335 nmdc:mga0n895_786432_c1 3300050512 Bacteria 943
336 nmdc:mga0rr50_87049_c1 3300050513 Bacteria 2424
337 Ga0495601_0031880 3300053077 Bacteria 3277
338 Ga0495601_0263824 3300053077 Bacteria 1124
339 Ga0495612_0011688 3300053078 Bacteria 3538
340 Ga0500568_0032371 3300053139 Bacteria 2151
341 Ga0501082_0259166 3300060353 Bacteria 1513
342 2809064041 2808606401 Bacteria 4586670
343 2809080009 2808606404 Bacteria 4652788
344 2809084374 2808606405 Bacteria 4586632
345 2848554656 2848551377 Bacteria 3720646
346 2880522818 2880518877 Bacteria 5012590
347 2882637583 2882632389 Bacteria 8154593
348 2917737246 2917736166 Bacteria 9690793
349 2921254361 2921250672 Bacteria 6677771
350 Ga0373925_0037986
351 JGI24741J21665_1000002
352 JGI24740J21852_10000005
353 JGI24739J22299_10037763
354 JGI24737J22298_10003464
355 JGI24737J22298_10021411
356 JGI24751J29686_10000134
357 JGI25406J46586_10001690
358 JGI25404J52841_10032212
359 JGI25405J52794_10010446
360 Ga0065707_10220755
361 Ga0070658_10000738
362 Ga0070658_10001208
363 Ga0070683_100382873
364 Ga0070690_100496228
365 Ga0070680_100032762
366 Ga0068868_100549521
367 Ga0070660_100007378
368 Ga0070660_100349833
369 Ga0070689_100091619
370 Ga0070661_100002371
371 Ga0070675_100070770
372 Ga0070659_100001817
373 Ga0070709_10248685
374 Ga0070714_100366330
375 Ga0070713_100088115
376 Ga0070705_100281826
377 Ga0070694_100067368
378 Ga0070694_100378401
379 Ga0070708_100165714
380 Ga0070708_100196980
381 Ga0070663_100002745
382 Ga0070678_100022807
383 Ga0070681_10004615
384 Ga0070681_10034432
385 Ga0070681_10113060
386 Ga0070681_10196832
387 Ga0070706_100863247
388 Ga0070707_100010182
389 Ga0070707_100439403
390 Ga0070698_100356002
391 Ga0070699_100669270
392 Ga0070679_100008043
393 Ga0070679_100040612
394 Ga0070679_100078466
395 Ga0070679_100405890
396 Ga0070684_100049010
397 Ga0070697_100283673
398 Ga0068853_100028597
399 Ga0068853_100038681
400 Ga0068853_100118470
401 Ga0070696_100606620
402 Ga0070665_100004342
403 Ga0070665_100082736
404 Ga0070665_100594941
405 Ga0068855_100005248
406 Ga0068855_100008502
407 Ga0068855_100022710
408 Ga0068855_100031638
409 Ga0068855_100075397
410 Ga0070664_100002556
411 Ga0068857_100064637
412 Ga0068857_100073716
413 Ga0068857_100177972
414 Ga0068854_100065852
415 Ga0068856_100015291
416 Ga0068856_100323948
417 Ga0068852_100061899
418 Ga0068852_100134741
419 Ga0068852_100154322
420 Ga0068864_100064293
421 Ga0068851_10006468
422 Ga0068851_10230592
423 Ga0081538_10022108
424 Ga0081540_1001323
425 Ga0081539_10000169
426 Ga0081539_10000987
427 Ga0081539_10009839
428 Ga0070717_10585543
429 Ga0070717_10627894
430 Ga0075365_10043573
431 Ga0075364_10084574
432 Ga0075432_10058007
433 Ga0070716_100239540
434 Ga0070712_100113233
435 Ga0070712_100424728
436 Ga0075367_10002336
437 Ga0075367_10107515
438 Ga0075369_10020261
439 Ga0075366_10269392
440 Ga0075370_10041167
441 Ga0075428_100051064
442 Ga0075430_100000457
443 Ga0075434_100055022
444 Ga0075429_100240263
445 Ga0099794_10041565
446 Ga0099794_10051110
447 Ga0105240_10041842
448 Ga0105240_10097153
449 Ga0105240_10105752
450 Ga0105245_10167044
451 Ga0114129_10039139
452 Ga0105241_10000339
453 Ga0105241_10046735
454 Ga0105241_10903144
455 Ga0105237_10013782
456 Ga0105237_10034719
457 Ga0105237_10050598
458 Ga0105237_10279091
459 Ga0105238_10049955
460 Ga0105238_10071960
461 Ga0105238_10072649
462 Ga0099796_10046967
463 Ga0105239_10046204
464 Ga0105239_10176085
465 Ga0157373_10042783
466 Ga0157371_10000111
467 Ga0157370_10008903
468 Ga0157370_10092729
469 Ga0157369_10016581
470 Ga0157374_10200644
471 Ga0157372_10052174
472 Ga0182008_10013777
473 Ga0182008_10107631
474 Ga0157376_10542173
475 Ga0157376_10585364
476 Ga0206353_10816538
477 Ga0207656_10001030
478 Ga0207647_10003157
479 Ga0207647_10005080
480 Ga0207699_10038506
481 Ga0207645_10118666
482 Ga0207705_10002837
483 Ga0207654_10001428
484 Ga0207707_10000281
485 Ga0207707_10185098
486 Ga0207707_10302211
487 Ga0207695_10001225
488 Ga0207695_10047814
489 Ga0207695_10154536
490 Ga0207695_10398967
491 Ga0207695_10496159
492 Ga0207671_10000676
493 Ga0207671_10184343
494 Ga0207671_10504154
495 Ga0207693_10077598
496 Ga0207660_10010032
497 Ga0207660_10155745
498 Ga0207657_10000074
499 Ga0207657_10324542
500 Ga0207649_10000887
501 Ga0207649_10149008
502 Ga0207652_10027662
503 Ga0207652_10064846
504 Ga0207652_10492739
505 Ga0207646_10008447
506 Ga0207646_10337122
507 Ga0207694_10005711
508 Ga0207694_10023461
509 Ga0207694_10226885
510 Ga0207687_10404970
511 Ga0207700_10095433
512 Ga0207700_10167066
513 Ga0207700_10262244
514 Ga0207690_10000840
515 Ga0207706_10435137
516 Ga0207706_10762624
517 Ga0207665_10072357
518 Ga0207691_10261275
519 Ga0207661_10045130
520 Ga0207679_10029809
521 Ga0207667_10000004
522 Ga0207667_10010709
523 Ga0207667_10159412
524 Ga0207667_10324608
525 Ga0207640_10050118
526 Ga0207640_10141137
527 Ga0207640_10170383
528 Ga0207639_10001431
529 Ga0207639_10008863
530 Ga0207639_10063363
531 Ga0207678_10000056
532 Ga0207702_10000087
533 Ga0207702_10029412
534 Ga0207674_10000121
535 Ga0207674_10004440
536 Ga0207674_10210755
537 Ga0207683_10052797
538 Ga0207698_10003375
539 Ga0207698_10041825
540 Ga0268266_10011284
541 Ga0268266_10299677
542 Ga0268266_10496680
543 Ga0307511_10131291
544 Ga0265330_10004113
545 Ga0265332_10000343
546 Ga0265328_10000579
547 Ga0265329_10004554
548 Ga0265329_10015358
549 Ga0265331_10000051
550 Ga0265331_10069012
551 Ga0265316_10000030
552 Ga0307408_100308091
553 Ga0316575_10045507
554 Ga0265314_10000386
555 Ga0265314_10013127
556 Ga0265314_10094398
557 Ga0265314_10101332
558 Ga0265342_10001309
559 Ga0265342_10077770
560 Ga0316578_10030088
561 Ga0307405_10004673
562 Ga0307405_10109138
563 Ga0316577_10112624
564 Ga0307413_10012040
565 Ga0307410_10012421
566 Ga0307406_10148633
567 Ga0307412_10000540
568 Ga0307409_100049333
569 Ga0307414_10000185
570 Ga0307411_10008837
571 Ga0307415_100003423
572 Ga0373923_0008921
573 Ga0373932_0085843
574 Ga0373936_0251050
575 Ga0373956_0099068
576 Ga0373943_0127701
577 Ga0373955_0061371
578 Ga0373955_0070565
579 Ga0316574_0017450
580 Ga0373924_0129812
581 Ga0373931_0039173
582 Ga0373935_0011977
583 Ga0373935_0066017
584 Ga0373935_0170546
585 Ga0373935_0462550
586 Ga0373927_0055907
587 Ga0373933_0031579
588 Ga0373933_0066096
589 Ga0373933_0168187
590 Ga0373947_0028178
591 Ga0373947_0168767
592 Ga0373937_0026083
593 Ga0373937_0041911
594 Ga0316584_0006708
595 Ga0373925_0222022
596 Ga0373925_0374253
597 Ga0373925_0377175
598 Ga0373925_0396445
599 Ga0373925_0436279
600 Ga0373925_0664964
601 Ga0395899_0000115
602 Ga0395899_0043328
603 Ga0395900_0000002
604 Ga0395900_0385196
605 Ga0395898_0014912
606 Ga0395905_0727476
607 Ga0436364_0453766
608 Ga0395901_0000021
609 Ga0395901_0010514
610 Ga0436360_0315794
611 Ga0436360_1022929
612 Ga0436360_1051214
613 Ga0436361_0740576
614 Ga0436361_1197697
615 Ga0436363_0578241
616 Ga0451577_0175667
617 Ga0466963_0031591
618 Ga0466963_0097121
619 Ga0466963_0160697
620 Ga0466957_0162407
621 Ga0466958_0093273
622 Ga0466967_0314232
623 Ga0466967_0369413
624 Ga0466967_1097932
625 Ga0495592_0018077
626 Ga0495592_0339555
627 Ga0495651_0035927
628 Ga0495651_0134655
629 Ga0495650_0048046
630 Ga0495580_0100996
631 Ga0495639_0134724
632 Ga0495662_0028489
633 Ga0495664_0003717
634 Ga0495664_0067077
635 Ga0495664_0183274
636 Ga0495608_0051891
637 Ga0495628_0235522
638 Ga0495630_0075239
639 Ga0495652_0124451
640 Ga0495640_0039338
641 Ga0495640_0042279
642 Ga0495587_0033658
643 Ga0495645_0115376
644 Ga0495645_0147769
645 Ga0495667_0085839
646 Ga0495634_0011672
647 Ga0495635_0079696
648 Ga0495623_0006693
649 Ga0495646_0058326
650 Ga0495658_0033900
651 Ga0495624_0288174
652 Ga0495581_0068784
653 Ga0495604_0039544
654 Ga0495674_0012181
655 Ga0495674_0100454
656 Ga0495672_0008803
657 Ga0495672_0049626
658 Ga0495676_0349716
659 Ga0495680_0218115
660 Ga0495675_0115810
661 Ga0495684_0011161
662 Ga0495684_0122637
663 Ga0495684_0197776
664 Ga0495593_0011648
665 Ga0495602_0007536
666 Ga0496101_0113165
667 Ga0496102_0164733
668 Ga0496104_0003626
669 Ga0496105_0017893
670 Ga0496110_0737287
671 Ga0496126_0119007
672 Ga0501034_0045339
673 Ga0501038_0235856
674 Ga0501043_0200275
675 Ga0501046_0127658
676 Ga0501080_0055502
677 nmdc:mga00v17_10407_c1
678 nmdc:mga0yw44_1207_c1
679 nmdc:mga0yw44_46333_c1
680 nmdc:mga0k408_322442_c1
681 nmdc:mga06z11_7370_c1
682 nmdc:mga07m45_10118_c1
683 nmdc:mga05p37_15645_c1
684 nmdc:mga0n895_786432_c1
685 nmdc:mga0rr50_87049_c1
686 Ga0495601_0031880
687 Ga0495601_0263824
688 Ga0495612_0011688
689 Ga0500568_0032371
690 Ga0501082_0259166
691 2809064041
692 2809080009
693 2809084374
694 2848554656
695 2880522818
696 2882637583
697 2917737246
698 2921254361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

42

232

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

48

280

0.94

PF08659

KR

KR domain

43

219

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cqm-assembly3.cif.gz_N crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9689 7 248
4cqm-assembly1.cif.gz_K crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9656 7 247
4cqm-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9642 7 248
4cql-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9631 7 247
4cql-assembly1.cif.gz_F crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.962 7 247
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9687 4 180 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9656 7 247 3.40.50.720
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9637 4 184 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9596 4 247 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9587 4 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3B8XKY7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9845 4 178 GO:0016616
AF-A0A1A0ML37-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.9786 4 189 GO:0016616
GO:0030497
AF-A0A2T1IZ11-F1-model_v4 deleted 0.9747 1 252
AF-A0A1Q3KHL8-F1-model_v4 Short-chain dehydrogenase 0.9746 4 247 GO:0016491
AF-A0A5C5TEW2-F1-model_v4 SDR family oxidoreductase 0.9741 4 247 GO:0016491

Map