F417932

General Info

Members Datasets Scaffolds Average Seq Length
349 230 323 158

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10680031|Ga0268264_106800312
Length 192
Sequence MIPKAGSGFLGQTVSVCPGIMLYLFDLGRVTSNKGIDMADLDIGDAAPQFDLPRDGGGSLSLAALRGKPVVLYFYPQDDTTSCTTEAISFSQLKPEFEKAGAVVIGLSPDSVKKHDKFKTKYDLTIDLVADEERKVIEAYNLWVEKTMYGRNYMGVERATFLIGKDGKIARIWRKVRVKGHAEEVLEVVRAL

Samples

Sample ID Description Type Environment
1 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
2 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
3 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
4 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
5 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
6 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
7 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
8 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
9 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
10 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
11 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
12 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
13 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
14 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
15 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
16 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
17 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
18 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
19 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
20 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
21 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
22 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
23 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
24 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
220 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
226 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
227 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
228 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
230 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.26
Metatranscriptomes 0.29
Isolates 7.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.9
Nodule 6.02
Rhizoplane 3.44
Rhizosphere 67.34
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10024540 3300001989 Bacteria 2125
2 JGI24739J22299_10069458 3300001989 Bacteria 1098
3 JGI25165J46597_1000192 3300003214 Bacteria 91136
4 rootL2_10018371 3300003322 Bacteria 3409
5 Ga0055542_1000939 3300003762 Bacteria 19193
6 Ga0070660_100701371 3300005339 Bacteria 849
7 Ga0070661_100239376 3300005344 Bacteria 1397
8 Ga0070661_100560813 3300005344 Bacteria 920
9 Ga0070659_100484184 3300005366 Bacteria 1053
10 Ga0070659_100726590 3300005366 Bacteria 860
11 Ga0070714_100061247 3300005435 Bacteria 3232
12 Ga0070711_100232772 3300005439 Bacteria 1437
13 Ga0070663_100658715 3300005455 Bacteria 886
14 Ga0070665_100027182 3300005548 Bacteria 5762
15 Ga0070665_100464091 3300005548 Bacteria 1276
16 Ga0068855_100303955 3300005563 Bacteria 1766
17 Ga0068855_101100083 3300005563 Bacteria 831
18 Ga0070664_100734676 3300005564 Bacteria 921
19 Ga0068857_100152524 3300005577 Bacteria 2094
20 Ga0068856_100955218 3300005614 Bacteria 876
21 Ga0068852_100154943 3300005616 Bacteria 2133
22 Ga0068852_100708431 3300005616 Bacteria 1017
23 Ga0070717_10040110 3300006028 Bacteria 3813
24 Ga0075365_10008172 3300006038 Bacteria 5917
25 Ga0075365_10015035 3300006038 Bacteria 4671
26 Ga0075365_10030653 3300006038 Bacteria 3447
27 Ga0075363_100211335 3300006048 Bacteria 1110
28 Ga0075364_10034699 3300006051 Bacteria 3257
29 Ga0075364_10059302 3300006051 Bacteria 2508
30 Ga0075364_10531411 3300006051 Bacteria 804
31 Ga0070712_100279616 3300006175 Bacteria 1344
32 Ga0075362_10091013 3300006177 Bacteria 1416
33 Ga0075362_10106952 3300006177 Bacteria 1313
34 Ga0075367_10029067 3300006178 Bacteria 3159
35 Ga0075367_10118983 3300006178 Bacteria 1627
36 Ga0075367_10398411 3300006178 Bacteria 870
37 Ga0075369_10008088 3300006186 Bacteria 4033
38 Ga0075369_10079619 3300006186 Bacteria 1452
39 Ga0075369_10159478 3300006186 Bacteria 1034
40 Ga0075366_10097361 3300006195 Bacteria 1765
41 Ga0075366_10187486 3300006195 Bacteria 1257
42 Ga0097621_101002742 3300006237 Bacteria 781
43 Ga0075370_10021521 3300006353 Bacteria 3533
44 Ga0075370_10293269 3300006353 Bacteria 967
45 Ga0075433_11499668 3300006852 Bacteria 582
46 Ga0068865_100653451 3300006881 Bacteria 894
47 Ga0068865_101147923 3300006881 Bacteria 686
48 Ga0105240_10041609 3300009093 Bacteria 5863
49 Ga0105240_10088446 3300009093 Bacteria 3790
50 Ga0105240_10103299 3300009093 Bacteria 3463
51 Ga0105240_10293853 3300009093 Bacteria 1861
52 Ga0105240_11104964 3300009093 Bacteria 843
53 Ga0105245_10302378 3300009098 Bacteria 1570
54 Ga0105243_10968902 3300009148 Bacteria 851
55 Ga0105237_10002266 3300009545 Bacteria 23934
56 Ga0105237_10390669 3300009545 Bacteria 1396
57 Ga0105237_10419370 3300009545 Bacteria 1344
58 Ga0105237_10653683 3300009545 Bacteria 1058
59 Ga0105238_10015029 3300009551 Bacteria 7838
60 Ga0105238_10298928 3300009551 Bacteria 1593
61 Ga0105238_11447367 3300009551 Bacteria 715
62 Ga0105249_10109339 3300009553 Bacteria 2611
63 Ga0105239_10003444 3300010375 Bacteria 19377
64 Ga0105239_10058712 3300010375 Bacteria 4222
65 Ga0105239_10145465 3300010375 Bacteria 2643
66 Ga0105239_12115706 3300010375 Bacteria 654
67 Ga0157370_10137200 3300013104 Bacteria 2279
68 Ga0157369_10053803 3300013105 Bacteria 4349
69 Ga0157369_11550207 3300013105 Bacteria 674
70 Ga0157374_10432235 3300013296 Bacteria 1316
71 Ga0157378_10899734 3300013297 Bacteria 916
72 Ga0157376_11533948 3300014969 Bacteria 700
73 Ga0182007_10029337 3300015262 Bacteria 1884
74 Ga0213876_10012745 3300021384 Bacteria 4470
75 Ga0213875_10015555 3300021388 Unclassified 3700
76 Ga0213875_10057331 3300021388 Unclassified 1824
77 Ga0213871_10053033 3300021441 Bacteria 1116
78 Ga0209646_1010031 3300025246 Bacteria 1492
79 Ga0209026_1000002 3300025250 Bacteria 1136158
80 Ga0209148_1000038 3300025254 Bacteria 493744
81 Ga0209759_1000062 3300025256 Bacteria 197996
82 Ga0209233_1000027 3300025261 Bacteria 652089
83 Ga0209233_1012455 3300025261 Bacteria 2468
84 Ga0209233_1078434 3300025261 Bacteria 593
85 Ga0209455_1000068 3300025272 Bacteria 310024
86 Ga0209758_1129069 3300025297 Bacteria 671
87 Ga0207647_10011570 3300025904 Bacteria 6181
88 Ga0207654_10123854 3300025911 Bacteria 1627
89 Ga0207695_10000288 3300025913 Bacteria 125085
90 Ga0207695_10085569 3300025913 Bacteria 3181
91 Ga0207695_10100603 3300025913 Bacteria 2886
92 Ga0207695_10656082 3300025913 Bacteria 930
93 Ga0207695_10687504 3300025913 Bacteria 904
94 Ga0207671_10002453 3300025914 Bacteria 19840
95 Ga0207671_10326559 3300025914 Bacteria 1215
96 Ga0207671_10818453 3300025914 Bacteria 738
97 Ga0207693_10142306 3300025915 Bacteria 1886
98 Ga0207657_10034109 3300025919 Bacteria 4581
99 Ga0207657_10062442 3300025919 Bacteria 3189
100 Ga0207657_10103231 3300025919 Bacteria 2363
101 Ga0207649_10397596 3300025920 Bacteria 1030
102 Ga0207649_11262621 3300025920 Bacteria 584
103 Ga0207694_10132039 3300025924 Bacteria 2002
104 Ga0207694_10355033 3300025924 Bacteria 1214
105 Ga0207664_10108429 3300025929 Bacteria 2306
106 Ga0207690_10056912 3300025932 Bacteria 2640
107 Ga0207690_10415256 3300025932 Bacteria 1076
108 Ga0207706_10201804 3300025933 Bacteria 1744
109 Ga0207709_10440072 3300025935 Bacteria 1005
110 Ga0207669_10082505 3300025937 Bacteria 2064
111 Ga0207669_10382508 3300025937 Bacteria 1097
112 Ga0207669_10932436 3300025937 Bacteria 727
113 Ga0207691_11073533 3300025940 Bacteria 670
114 Ga0207711_10888056 3300025941 Bacteria 829
115 Ga0207667_10936151 3300025949 Bacteria 857
116 Ga0207667_11327560 3300025949 Bacteria 695
117 Ga0207712_10357259 3300025961 Bacteria 1216
118 Ga0207677_10669349 3300026023 Bacteria 918
119 Ga0207639_10144174 3300026041 Bacteria 1988
120 Ga0207639_10160153 3300026041 Bacteria 1895
121 Ga0207678_10636022 3300026067 Bacteria 937
122 Ga0207702_10189419 3300026078 Bacteria 1900
123 Ga0207648_10462378 3300026089 Bacteria 1157
124 Ga0207683_10395467 3300026121 Bacteria 1271
125 Ga0207698_10549630 3300026142 Bacteria 1131
126 Ga0268266_10019337 3300028379 Bacteria 5801
127 Ga0268266_10315409 3300028379 Bacteria 1462
128 Ga0268266_10389614 3300028379 Bacteria 1316
129 Ga0268266_10462513 3300028379 Bacteria 1207
130 Ga0268266_11266218 3300028379 Bacteria 713
131 Ga0268264_10680031 3300028381 Bacteria 1021
132 Ga0265334_10000009 3300028573 Bacteria 194312
133 Ga0265331_10000061 3300031250 Bacteria 168963
134 Ga0307408_100218647 3300031548 Bacteria 1553
135 Ga0265313_10002582 3300031595 Bacteria 15441
136 Ga0316576_10106570 3300031727 Bacteria 2099
137 Ga0307405_10029533 3300031731 Bacteria 3206
138 Ga0307413_11058377 3300031824 Bacteria 698
139 Ga0307410_10106353 3300031852 Bacteria 2022
140 Ga0307406_10144531 3300031901 Bacteria 1688
141 Ga0307407_10064852 3300031903 Bacteria 2148
142 Ga0307412_10008909 3300031911 Bacteria 5747
143 Ga0307412_10331956 3300031911 Bacteria 1214
144 Ga0307416_100052194 3300032002 Bacteria 3272
145 Ga0307414_11151499 3300032004 Bacteria 717
146 Ga0373926_0022784 3300035083 Bacteria 2173
147 Ga0373934_0080029 3300035086 Bacteria 1312
148 Ga0373945_0190469 3300035116 Bacteria 848
149 Ga0373953_0047610 3300035117 Bacteria 1725
150 Ga0373954_0023629 3300035118 Bacteria 2797
151 Ga0373955_0482489 3300035172 Bacteria 756
152 Ga0316574_0000179 3300035398 Bacteria 21450
153 Ga0373935_0050857 3300035692 Bacteria 2631
154 Ga0373927_0060977 3300035695 Bacteria 2440
155 Ga0373947_0124954 3300035725 Bacteria 1637
156 Ga0373937_0156467 3300036401 Bacteria 2136
157 Ga0316582_0015635 3300036647 Bacteria 4347
158 Ga0373925_0159816 3300037068 Bacteria 1774
159 Ga0395899_0109645 3300037312 Bacteria 1986
160 Ga0395899_0388600 3300037312 Bacteria 926
161 Ga0395900_0184915 3300037418 Bacteria 2115
162 Ga0395900_0458332 3300037418 Bacteria 1230
163 Ga0395900_0581662 3300037418 Bacteria 1062
164 Ga0395898_0210041 3300037466 Bacteria 1857
165 Ga0395898_0288408 3300037466 Bacteria 1566
166 Ga0395905_0080115 3300037471 Bacteria 3060
167 Ga0395905_0118869 3300037471 Bacteria 2484
168 Ga0395905_0260704 3300037471 Bacteria 1618
169 Ga0316581_0153093 3300037588 Bacteria 711
170 Ga0436364_0351598 3300037853 Bacteria 2623
171 Ga0436364_1128780 3300037853 Bacteria 5079
172 Ga0395901_0247899 3300038443 Bacteria 1856
173 Ga0395901_1086389 3300038443 Bacteria 771
174 Ga0436365_1253031 3300039437 Bacteria 47093
175 Ga0436360_0209389 3300039438 Bacteria 1684
176 Ga0436360_0496476 3300039438 Bacteria 3585
177 Ga0436361_0730309 3300039447 Bacteria 1181
178 Ga0436363_0232632 3300039450 Bacteria 814
179 Ga0436363_1230015 3300039450 Bacteria 36424
180 Ga0436362_0874938 3300039453 Bacteria 2190
181 Ga0436362_1073620 3300039453 Bacteria 765
182 Ga0451793_1281330 3300041452 Bacteria 1038
183 Ga0451795_0525167 3300041456 Bacteria 619
184 Ga0451843_1197082 3300041509 Bacteria 1095
185 Ga0439458_0025092 3300042157 Bacteria 1397
186 Ga0466972_0004289 3300044658 Bacteria 7122
187 Ga0466965_0118138 3300044683 Bacteria 1368
188 Ga0466968_0050957 3300044735 Bacteria 1768
189 Ga0466960_0004144 3300044901 Bacteria 5642
190 Ga0466958_0284065 3300045836 Bacteria 1061
191 Ga0495629_0833898 3300046459 Bacteria 607
192 Ga0495651_0134959 3300046462 Bacteria 1797
193 Ga0495580_0009154 3300046472 Bacteria 7808
194 Ga0495605_0440481 3300046474 Bacteria 538
195 Ga0495664_0188955 3300046477 Bacteria 1249
196 Ga0495608_0089756 3300046511 Bacteria 1989
197 Ga0495610_0166644 3300046512 Bacteria 927
198 Ga0495630_0663694 3300046517 Bacteria 798
199 Ga0495643_0480675 3300046522 Bacteria 537
200 Ga0495654_0109653 3300046530 Bacteria 1261
201 Ga0495645_0574131 3300046543 Bacteria 696
202 Ga0495633_0000871 3300046558 Bacteria 26182
203 Ga0495667_0051264 3300046559 Bacteria 2723
204 Ga0495625_0282299 3300046660 Bacteria 1068
205 Ga0495635_0499910 3300046663 Bacteria 801
206 Ga0495674_0212531 3300047319 Bacteria 1602
207 Ga0495684_0073282 3300047471 Bacteria 2601
208 Ga0495686_0163237 3300047472 Bacteria 1300
209 Ga0495602_0166854 3300048088 Bacteria 1713
210 Ga0496100_0795693 3300048903 Bacteria 741
211 Ga0496105_1156607 3300048908 Bacteria 572
212 Ga0496106_1159992 3300048909 Bacteria 604
213 Ga0496108_0224106 3300048911 Bacteria 1634
214 Ga0496110_0295038 3300048913 Bacteria 1477
215 Ga0496110_0746170 3300048913 Bacteria 882
216 Ga0496111_0862609 3300048914 Bacteria 653
217 Ga0496112_1194371 3300048915 Bacteria 677
218 Ga0496113_0191137 3300048916 Bacteria 1625
219 Ga0496115_0872921 3300048918 Bacteria 695
220 Ga0496118_0155531 3300048921 Bacteria 1423
221 Ga0496120_0002753 3300048923 Bacteria 17147
222 Ga0496121_0001914 3300048924 Bacteria 33228
223 Ga0496121_0001919 3300048924 Bacteria 33213
224 Ga0496124_0146830 3300048927 Bacteria 1855
225 Ga0496124_0493028 3300048927 Bacteria 824
226 Ga0496125_0085131 3300048928 Bacteria 2397
227 Ga0496126_0009218 3300048929 Bacteria 10525
228 Ga0496126_0040195 3300048929 Bacteria 4337
229 Ga0496126_0066102 3300048929 Bacteria 3234
230 Ga0496126_0267066 3300048929 Bacteria 1421
231 Ga0501031_0000131 3300049568 Bacteria 41444
232 Ga0501031_0636235 3300049568 Bacteria 686
233 Ga0501032_0000003 3300049569 Bacteria 317700
234 Ga0501032_0067184 3300049569 Bacteria 2395
235 Ga0501032_0078160 3300049569 Bacteria 2203
236 Ga0501033_0000676 3300049570 Bacteria 31452
237 Ga0501033_0022776 3300049570 Bacteria 4723
238 Ga0501033_0032592 3300049570 Bacteria 3912
239 Ga0501033_0187660 3300049570 Bacteria 1480
240 Ga0501034_0000005 3300049571 Bacteria 367512
241 Ga0501034_0066140 3300049571 Bacteria 3627
242 Ga0501034_0070801 3300049571 Bacteria 3498
243 Ga0501034_0088296 3300049571 Bacteria 3099
244 Ga0501034_0228021 3300049571 Bacteria 1813
245 Ga0501036_0000005 3300049572 Bacteria 246420
246 Ga0501036_0069507 3300049572 Bacteria 2978
247 Ga0501037_0000521 3300049573 Bacteria 30852
248 Ga0501037_0045679 3300049573 Bacteria 3214
249 Ga0501038_0000001 3300049574 Bacteria 375481
250 Ga0501038_0060098 3300049574 Bacteria 3253
251 Ga0501039_0000007 3300049575 Bacteria 277831
252 Ga0501039_0083681 3300049575 Bacteria 2485
253 Ga0501039_0085070 3300049575 Bacteria 2463
254 Ga0501040_0014225 3300049576 Bacteria 5241
255 Ga0501040_0068846 3300049576 Bacteria 2441
256 Ga0501042_0059200 3300049578 Bacteria 2735
257 Ga0501043_0000616 3300049579 Bacteria 31427
258 Ga0501043_0099755 3300049579 Bacteria 2282
259 Ga0501043_0599861 3300049579 Bacteria 813
260 Ga0501046_0046486 3300049580 Bacteria 3445
261 Ga0501046_0108184 3300049580 Bacteria 2126
262 Ga0501047_0004302 3300049581 Bacteria 13404
263 Ga0501047_0073127 3300049581 Bacteria 3300
264 Ga0501047_0080697 3300049581 Bacteria 3126
265 Ga0501047_0432318 3300049581 Bacteria 1147
266 Ga0501047_1207300 3300049581 Bacteria 570
267 Ga0501048_0057786 3300049582 Bacteria 2750
268 Ga0501048_0405529 3300049582 Bacteria 975
269 Ga0501067_0032749 3300049583 Bacteria 2885
270 Ga0501069_0033371 3300049585 Bacteria 2836
271 Ga0501070_0008569 3300049586 Bacteria 8646
272 Ga0501070_0469796 3300049586 Bacteria 1013
273 Ga0501070_0778454 3300049586 Bacteria 752
274 Ga0501071_0006769 3300049587 Bacteria 7462
275 Ga0501072_0094384 3300049588 Bacteria 2377
276 Ga0501074_0273251 3300049590 Bacteria 1201
277 Ga0501074_1153561 3300049590 Bacteria 544
278 Ga0501076_0782830 3300049592 Bacteria 787
279 Ga0501076_1484572 3300049592 Bacteria 557
280 Ga0501080_0047449 3300049742 Bacteria 3998
281 Ga0501083_0043394 3300049744 Bacteria 3047
282 Ga0501083_0137175 3300049744 Bacteria 1603
283 Ga0501035_0000008 3300049822 Bacteria 313425
284 Ga0501035_0003844 3300049822 Bacteria 14316
285 Ga0501035_0044332 3300049822 Bacteria 4005
286 Ga0501035_0256466 3300049822 Bacteria 1484
287 Ga0501044_0000001 3300049823 Bacteria 418087
288 Ga0501044_0057108 3300049823 Bacteria 4005
289 Ga0501044_0057134 3300049823 Bacteria 4004
290 Ga0501044_0466078 3300049823 Bacteria 1168
291 Ga0501044_0615298 3300049823 Bacteria 978
292 Ga0501044_0757142 3300049823 Bacteria 853
293 Ga0501045_0034621 3300049824 Bacteria 3666
294 Ga0501045_0892379 3300049824 Bacteria 653
295 nmdc:mga03683_165790_c1 3300050489 Bacteria 1002
296 nmdc:mga03683_166651_c1 3300050489 Bacteria 1000
297 nmdc:mga00v17_15451_c1 3300050491 Bacteria 4285
298 nmdc:mga00v17_243702_c1 3300050491 Bacteria 1166
299 nmdc:mga00v17_435499_c1 3300050491 Bacteria 851
300 nmdc:mga0yw44_159281_c1 3300050492 Bacteria 1477
301 nmdc:mga0yw44_199383_c1 3300050492 Bacteria 1322
302 nmdc:mga0yw44_890471_c1 3300050492 Bacteria 604
303 nmdc:mga0k408_132576_c1 3300050493 Bacteria 1479
304 nmdc:mga0k408_249978_c1 3300050493 Bacteria 1059
305 nmdc:mga06z11_39626_c1 3300050494 Bacteria 2346
306 nmdc:mga06z11_52967_c1 3300050494 Bacteria 2085
307 nmdc:mga04h51_160378_c1 3300050495 Bacteria 865
308 nmdc:mga07m45_200173_c1 3300050496 Bacteria 1162
309 nmdc:mga0sz30_136873_c1 3300050516 Bacteria 1081
310 Ga0495612_0316728 3300053078 Bacteria 701
311 Ga0500610_0034999 3300053079 Bacteria 2573
312 Ga0500610_0436927 3300053079 Bacteria 518
313 Ga0495655_0007152 3300053083 Bacteria 2063
314 Ga0495655_0088639 3300053083 Bacteria 898
315 Ga0500578_0196113 3300053086 Bacteria 1238
316 Ga0500658_0056636 3300053134 Bacteria 1618
317 Ga0500604_0113983 3300053151 Bacteria 899
318 Ga0500616_0004503 3300053153 Bacteria 9900
319 Ga0500620_006753 3300053155 Bacteria 2781
320 Ga0500627_0029286 3300053158 Bacteria 2295
321 Ga0500627_0031242 3300053158 Bacteria 2235
322 Ga0500611_015898 3300053727 Bacteria 1341
323 Ga0587072_071473 3300059643 Bacteria 734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221550 2643770553 152
2 3300006051 Ga0075364_10531411 Ga0075364_105314111 153
3 3300006177 Ga0075362_10091013 Ga0075362_100910132 153
4 3300006178 Ga0075367_10398411 Ga0075367_103984112 153
5 3300006353 Ga0075370_10021521 Ga0075370_100215213 153
6 3300006881 Ga0068865_100653451 Ga0068865_1006534512 153
7 3300010375 Ga0105239_12115706 Ga0105239_121157061 154
8 3300025261 Ga0209233_1078434 Ga0209233_10784341 154
9 3300031548 Ga0307408_100218647 Ga0307408_1002186471 154
10 3300039450 Ga0436363_0232632 Ga0436363_0232632_115_582 154
11 3300045836 Ga0466958_0284065 Ga0466958_0284065_538_1005 154
12 3300046558 Ga0495633_0000871 Ga0495633_0000871_15372_15836 154
13 3300048927 Ga0496124_0493028 Ga0496124_0493028_127_591 154
14 3300049592 Ga0501076_1484572 Ga0501076_1484572_42_527 154
15 3300001989 JGI24739J22299_10024540 JGI24739J22299_100245401 155
16 3300001989 JGI24739J22299_10069458 JGI24739J22299_100694582 155
17 3300003214 JGI25165J46597_1000192 JGI25165J46597_100019264 155
18 3300003322 rootL2_10018371 rootL2_100183712 155
19 3300003762 Ga0055542_1000939 Ga0055542_10009399 155
20 3300005339 Ga0070660_100701371 Ga0070660_1007013711 155
21 3300005344 Ga0070661_100239376 Ga0070661_1002393761 155
22 3300005344 Ga0070661_100560813 Ga0070661_1005608132 155
23 3300005366 Ga0070659_100484184 Ga0070659_1004841842 155
24 3300005366 Ga0070659_100726590 Ga0070659_1007265901 155
25 3300005435 Ga0070714_100061247 Ga0070714_1000612474 155
26 3300005439 Ga0070711_100232772 Ga0070711_1002327722 155
27 3300005455 Ga0070663_100658715 Ga0070663_1006587151 155
28 3300005548 Ga0070665_100027182 Ga0070665_1000271824 155
29 3300005548 Ga0070665_100464091 Ga0070665_1004640912 155
30 3300005563 Ga0068855_100303955 Ga0068855_1003039552 155
31 3300005563 Ga0068855_101100083 Ga0068855_1011000831 155
32 3300005564 Ga0070664_100734676 Ga0070664_1007346762 155
33 3300005577 Ga0068857_100152524 Ga0068857_1001525242 155
34 3300005614 Ga0068856_100955218 Ga0068856_1009552181 155
35 3300005616 Ga0068852_100154943 Ga0068852_1001549432 155
36 3300005616 Ga0068852_100708431 Ga0068852_1007084312 155
37 3300006028 Ga0070717_10040110 Ga0070717_100401102 155
38 3300006038 Ga0075365_10008172 Ga0075365_100081725 155
39 3300006038 Ga0075365_10015035 Ga0075365_100150352 155
40 3300006038 Ga0075365_10030653 Ga0075365_100306532 155
41 3300006048 Ga0075363_100211335 Ga0075363_1002113351 155
42 3300006051 Ga0075364_10034699 Ga0075364_100346992 155
43 3300006051 Ga0075364_10059302 Ga0075364_100593023 155
44 3300006175 Ga0070712_100279616 Ga0070712_1002796162 155
45 3300006177 Ga0075362_10106952 Ga0075362_101069522 155
46 3300006178 Ga0075367_10029067 Ga0075367_100290672 155
47 3300006178 Ga0075367_10118983 Ga0075367_101189832 155
48 3300006186 Ga0075369_10008088 Ga0075369_100080884 155
49 3300006186 Ga0075369_10079619 Ga0075369_100796191 155
50 3300006186 Ga0075369_10159478 Ga0075369_101594782 155
51 3300006195 Ga0075366_10097361 Ga0075366_100973612 155
52 3300006195 Ga0075366_10187486 Ga0075366_101874861 155
53 3300006237 Ga0097621_101002742 Ga0097621_1010027422 155
54 3300006353 Ga0075370_10293269 Ga0075370_102932692 155
55 3300006852 Ga0075433_11499668 Ga0075433_114996681 155
56 3300006881 Ga0068865_101147923 Ga0068865_1011479231 155
57 3300009093 Ga0105240_10041609 Ga0105240_100416092 155
58 3300009093 Ga0105240_10088446 Ga0105240_100884463 155
59 3300009093 Ga0105240_10103299 Ga0105240_101032992 155
60 3300009093 Ga0105240_10293853 Ga0105240_102938532 155
61 3300009093 Ga0105240_11104964 Ga0105240_111049641 155
62 3300009098 Ga0105245_10302378 Ga0105245_103023782 155
63 3300009148 Ga0105243_10968902 Ga0105243_109689022 155
64 3300009545 Ga0105237_10002266 Ga0105237_1000226613 155
65 3300009545 Ga0105237_10390669 Ga0105237_103906692 155
66 3300009545 Ga0105237_10419370 Ga0105237_104193702 155
67 3300009545 Ga0105237_10653683 Ga0105237_106536832 155
68 3300009551 Ga0105238_10015029 Ga0105238_100150299 155
69 3300009551 Ga0105238_10298928 Ga0105238_102989281 155
70 3300009551 Ga0105238_11447367 Ga0105238_114473672 155
71 3300009553 Ga0105249_10109339 Ga0105249_101093392 155
72 3300010375 Ga0105239_10003444 Ga0105239_1000344418 155
73 3300010375 Ga0105239_10058712 Ga0105239_100587122 155
74 3300010375 Ga0105239_10145465 Ga0105239_101454652 155
75 3300013104 Ga0157370_10137200 Ga0157370_101372002 155
76 3300013105 Ga0157369_10053803 Ga0157369_100538032 155
77 3300013105 Ga0157369_11550207 Ga0157369_115502072 155
78 3300013296 Ga0157374_10432235 Ga0157374_104322352 155
79 3300013297 Ga0157378_10899734 Ga0157378_108997342 155
80 3300014969 Ga0157376_11533948 Ga0157376_115339482 155
81 3300015262 Ga0182007_10029337 Ga0182007_100293372 155
82 3300021384 Ga0213876_10012745 Ga0213876_100127452 155
83 3300021388 Ga0213875_10015555 Ga0213875_100155554 155
84 3300021388 Ga0213875_10057331 Ga0213875_100573312 155
85 3300021441 Ga0213871_10053033 Ga0213871_100530331 155
86 3300025246 Ga0209646_1010031 Ga0209646_10100312 155
87 3300025250 Ga0209026_1000002 Ga0209026_1000002170 155
88 3300025254 Ga0209148_1000038 Ga0209148_1000038347 155
89 3300025256 Ga0209759_1000062 Ga0209759_1000062147 155
90 3300025261 Ga0209233_1000027 Ga0209233_1000027176 155
91 3300025261 Ga0209233_1012455 Ga0209233_10124551 155
92 3300025272 Ga0209455_1000068 Ga0209455_100006879 155
93 3300025297 Ga0209758_1129069 Ga0209758_11290691 155
94 3300025904 Ga0207647_10011570 Ga0207647_100115704 155
95 3300025911 Ga0207654_10123854 Ga0207654_101238542 155
96 3300025913 Ga0207695_10000288 Ga0207695_1000028836 155
97 3300025913 Ga0207695_10085569 Ga0207695_100855692 155
98 3300025913 Ga0207695_10100603 Ga0207695_101006033 155
99 3300025913 Ga0207695_10656082 Ga0207695_106560821 155
100 3300025913 Ga0207695_10687504 Ga0207695_106875042 155
101 3300025914 Ga0207671_10002453 Ga0207671_1000245314 155
102 3300025914 Ga0207671_10326559 Ga0207671_103265591 155
103 3300025914 Ga0207671_10818453 Ga0207671_108184531 155
104 3300025915 Ga0207693_10142306 Ga0207693_101423063 155
105 3300025919 Ga0207657_10034109 Ga0207657_100341093 155
106 3300025919 Ga0207657_10062442 Ga0207657_100624422 155
107 3300025919 Ga0207657_10103231 Ga0207657_101032312 155
108 3300025920 Ga0207649_10397596 Ga0207649_103975961 155
109 3300025920 Ga0207649_11262621 Ga0207649_112626211 155
110 3300025924 Ga0207694_10132039 Ga0207694_101320392 155
111 3300025924 Ga0207694_10355033 Ga0207694_103550332 155
112 3300025929 Ga0207664_10108429 Ga0207664_101084292 155
113 3300025932 Ga0207690_10056912 Ga0207690_100569122 155
114 3300025932 Ga0207690_10415256 Ga0207690_104152562 155
115 3300025933 Ga0207706_10201804 Ga0207706_102018042 155
116 3300025935 Ga0207709_10440072 Ga0207709_104400722 155
117 3300025937 Ga0207669_10082505 Ga0207669_100825052 155
118 3300025937 Ga0207669_10382508 Ga0207669_103825082 155
119 3300025937 Ga0207669_10932436 Ga0207669_109324361 155
120 3300025940 Ga0207691_11073533 Ga0207691_110735331 155
121 3300025941 Ga0207711_10888056 Ga0207711_108880562 155
122 3300025949 Ga0207667_10936151 Ga0207667_109361512 155
123 3300025949 Ga0207667_11327560 Ga0207667_113275601 155
124 3300025961 Ga0207712_10357259 Ga0207712_103572592 155
125 3300026023 Ga0207677_10669349 Ga0207677_106693492 155
126 3300026041 Ga0207639_10144174 Ga0207639_101441743 155
127 3300026041 Ga0207639_10160153 Ga0207639_101601532 155
128 3300026067 Ga0207678_10636022 Ga0207678_106360222 155
129 3300026078 Ga0207702_10189419 Ga0207702_101894192 155
130 3300026089 Ga0207648_10462378 Ga0207648_104623782 155
131 3300026121 Ga0207683_10395467 Ga0207683_103954672 155
132 3300026142 Ga0207698_10549630 Ga0207698_105496301 155
133 3300028379 Ga0268266_10019337 Ga0268266_100193374 155
134 3300028379 Ga0268266_10315409 Ga0268266_103154092 155
135 3300028379 Ga0268266_10389614 Ga0268266_103896142 155
136 3300028379 Ga0268266_10462513 Ga0268266_104625131 155
137 3300028379 Ga0268266_11266218 Ga0268266_112662181 155
138 3300028381 Ga0268264_10680031 Ga0268264_106800312 155
139 3300028573 Ga0265334_10000009 Ga0265334_1000000943 155
140 3300031250 Ga0265331_10000061 Ga0265331_1000006141 155
141 3300031595 Ga0265313_10002582 Ga0265313_1000258215 155
142 3300031727 Ga0316576_10106570 Ga0316576_101065702 155
143 3300031731 Ga0307405_10029533 Ga0307405_100295332 155
144 3300031824 Ga0307413_11058377 Ga0307413_110583772 155
145 3300031852 Ga0307410_10106353 Ga0307410_101063532 155
146 3300031901 Ga0307406_10144531 Ga0307406_101445312 155
147 3300031903 Ga0307407_10064852 Ga0307407_100648522 155
148 3300031911 Ga0307412_10008909 Ga0307412_100089092 155
149 3300031911 Ga0307412_10331956 Ga0307412_103319562 155
150 3300032002 Ga0307416_100052194 Ga0307416_1000521942 155
151 3300032004 Ga0307414_11151499 Ga0307414_111514992 155
152 3300035083 Ga0373926_0022784 Ga0373926_0022784_1225_1695 155
153 3300035086 Ga0373934_0080029 Ga0373934_0080029_134_604 155
154 3300035116 Ga0373945_0190469 Ga0373945_0190469_365_835 155
155 3300035117 Ga0373953_0047610 Ga0373953_0047610_1173_1643 155
156 3300035118 Ga0373954_0023629 Ga0373954_0023629_485_955 155
157 3300035172 Ga0373955_0482489 Ga0373955_0482489_202_672 155
158 3300035398 Ga0316574_0000179 Ga0316574_0000179_572_1042 155
159 3300035692 Ga0373935_0050857 Ga0373935_0050857_1390_1860 155
160 3300035695 Ga0373927_0060977 Ga0373927_0060977_990_1460 155
161 3300035725 Ga0373947_0124954 Ga0373947_0124954_98_568 155
162 3300036401 Ga0373937_0156467 Ga0373937_0156467_716_1186 155
163 3300036647 Ga0316582_0015635 Ga0316582_0015635_2162_2632 155
164 3300037068 Ga0373925_0159816 Ga0373925_0159816_103_573 155
165 3300037312 Ga0395899_0109645 Ga0395899_0109645_1416_1889 155
166 3300037312 Ga0395899_0388600 Ga0395899_0388600_405_872 155
167 3300037418 Ga0395900_0184915 Ga0395900_0184915_1625_2092 155
168 3300037418 Ga0395900_0458332 Ga0395900_0458332_413_880 155
169 3300037418 Ga0395900_0581662 Ga0395900_0581662_454_927 155
170 3300037466 Ga0395898_0210041 Ga0395898_0210041_332_805 155
171 3300037466 Ga0395898_0288408 Ga0395898_0288408_731_1198 155
172 3300037471 Ga0395905_0080115 Ga0395905_0080115_206_673 155
173 3300037471 Ga0395905_0118869 Ga0395905_0118869_1857_2324 155
174 3300037471 Ga0395905_0260704 Ga0395905_0260704_890_1363 155
175 3300037588 Ga0316581_0153093 Ga0316581_0153093_82_552 155
176 3300037853 Ga0436364_0351598 Ga0436364_0351598_1249_1719 155
177 3300037853 Ga0436364_1128780 Ga0436364_1128780_1214_1684 155
178 3300038443 Ga0395901_0247899 Ga0395901_0247899_330_797 155
179 3300038443 Ga0395901_1086389 Ga0395901_1086389_279_746 155
180 3300039437 Ga0436365_1253031 Ga0436365_1253031_17367_17858 155
181 3300039438 Ga0436360_0209389 Ga0436360_0209389_617_1108 155
182 3300039438 Ga0436360_0496476 Ga0436360_0496476_670_1161 155
183 3300039447 Ga0436361_0730309 Ga0436361_0730309_320_811 155
184 3300039450 Ga0436363_1230015 Ga0436363_1230015_8149_8640 155
185 3300039453 Ga0436362_0874938 Ga0436362_0874938_1096_1587 155
186 3300039453 Ga0436362_1073620 Ga0436362_1073620_84_575 155
187 3300041452 Ga0451793_1281330 Ga0451793_1281330_391_861 155
188 3300041456 Ga0451795_0525167 Ga0451795_0525167_120_587 155
189 3300041509 Ga0451843_1197082 Ga0451843_1197082_382_849 155
190 3300042157 Ga0439458_0025092 Ga0439458_0025092_520_987 155
191 3300044658 Ga0466972_0004289 Ga0466972_0004289_2712_3179 155
192 3300044683 Ga0466965_0118138 Ga0466965_0118138_122_589 155
193 3300044735 Ga0466968_0050957 Ga0466968_0050957_281_766 155
194 3300044901 Ga0466960_0004144 Ga0466960_0004144_983_1450 155
195 3300046459 Ga0495629_0833898 Ga0495629_0833898_127_594 155
196 3300046462 Ga0495651_0134959 Ga0495651_0134959_296_766 155
197 3300046472 Ga0495580_0009154 Ga0495580_0009154_6768_7238 155
198 3300046474 Ga0495605_0440481 Ga0495605_0440481_20_487 155
199 3300046477 Ga0495664_0188955 Ga0495664_0188955_378_848 155
200 3300046511 Ga0495608_0089756 Ga0495608_0089756_423_893 155
201 3300046512 Ga0495610_0166644 Ga0495610_0166644_13_480 155
202 3300046517 Ga0495630_0663694 Ga0495630_0663694_307_777 155
203 3300046522 Ga0495643_0480675 Ga0495643_0480675_24_491 155
204 3300046530 Ga0495654_0109653 Ga0495654_0109653_675_1142 155
205 3300046543 Ga0495645_0574131 Ga0495645_0574131_38_508 155
206 3300046559 Ga0495667_0051264 Ga0495667_0051264_214_684 155
207 3300046660 Ga0495625_0282299 Ga0495625_0282299_210_677 155
208 3300046663 Ga0495635_0499910 Ga0495635_0499910_16_486 155
209 3300047319 Ga0495674_0212531 Ga0495674_0212531_752_1222 155
210 3300047471 Ga0495684_0073282 Ga0495684_0073282_710_1180 155
211 3300047472 Ga0495686_0163237 Ga0495686_0163237_391_858 155
212 3300048088 Ga0495602_0166854 Ga0495602_0166854_146_616 155
213 3300048903 Ga0496100_0795693 Ga0496100_0795693_145_615 155
214 3300048908 Ga0496105_1156607 Ga0496105_1156607_23_490 155
215 3300048909 Ga0496106_1159992 Ga0496106_1159992_91_561 155
216 3300048911 Ga0496108_0224106 Ga0496108_0224106_550_1017 155
217 3300048913 Ga0496110_0295038 Ga0496110_0295038_959_1450 155
218 3300048913 Ga0496110_0746170 Ga0496110_0746170_196_663 155
219 3300048914 Ga0496111_0862609 Ga0496111_0862609_12_479 155
220 3300048915 Ga0496112_1194371 Ga0496112_1194371_86_553 155
221 3300048916 Ga0496113_0191137 Ga0496113_0191137_379_846 155
222 3300048918 Ga0496115_0872921 Ga0496115_0872921_41_532 155
223 3300048921 Ga0496118_0155531 Ga0496118_0155531_822_1301 155
224 3300048923 Ga0496120_0002753 Ga0496120_0002753_5890_6357 155
225 3300048924 Ga0496121_0001914 Ga0496121_0001914_16898_17377 155
226 3300048924 Ga0496121_0001919 Ga0496121_0001919_13592_14071 155
227 3300048927 Ga0496124_0146830 Ga0496124_0146830_16_483 155
228 3300048928 Ga0496125_0085131 Ga0496125_0085131_1209_1712 155
229 3300048929 Ga0496126_0009218 Ga0496126_0009218_4407_4886 155
230 3300048929 Ga0496126_0040195 Ga0496126_0040195_3148_3618 155
231 3300048929 Ga0496126_0066102 Ga0496126_0066102_1020_1487 155
232 3300048929 Ga0496126_0267066 Ga0496126_0267066_927_1394 155
233 3300049568 Ga0501031_0000131 Ga0501031_0000131_3240_3719 155
234 3300049568 Ga0501031_0636235 Ga0501031_0636235_183_662 155
235 3300049569 Ga0501032_0000003 Ga0501032_0000003_222583_223062 155
236 3300049569 Ga0501032_0067184 Ga0501032_0067184_1704_2213 155
237 3300049569 Ga0501032_0078160 Ga0501032_0078160_1465_1938 155
238 3300049570 Ga0501033_0000676 Ga0501033_0000676_3181_3660 155
239 3300049570 Ga0501033_0022776 Ga0501033_0022776_1638_2111 155
240 3300049570 Ga0501033_0032592 Ga0501033_0032592_1890_2399 155
241 3300049570 Ga0501033_0187660 Ga0501033_0187660_98_565 155
242 3300049571 Ga0501034_0000005 Ga0501034_0000005_222583_223062 155
243 3300049571 Ga0501034_0066140 Ga0501034_0066140_763_1272 155
244 3300049571 Ga0501034_0070801 Ga0501034_0070801_1283_1750 155
245 3300049571 Ga0501034_0088296 Ga0501034_0088296_1821_2294 155
246 3300049571 Ga0501034_0228021 Ga0501034_0228021_1087_1569 155
247 3300049572 Ga0501036_0000005 Ga0501036_0000005_101451_101930 155
248 3300049572 Ga0501036_0069507 Ga0501036_0069507_763_1272 155
249 3300049573 Ga0501037_0000521 Ga0501037_0000521_27134_27613 155
250 3300049573 Ga0501037_0045679 Ga0501037_0045679_1514_2023 155
251 3300049574 Ga0501038_0000001 Ga0501038_0000001_222583_223062 155
252 3300049574 Ga0501038_0060098 Ga0501038_0060098_763_1272 155
253 3300049575 Ga0501039_0000007 Ga0501039_0000007_274113_274592 155
254 3300049575 Ga0501039_0083681 Ga0501039_0083681_504_986 155
255 3300049575 Ga0501039_0085070 Ga0501039_0085070_1192_1701 155
256 3300049576 Ga0501040_0014225 Ga0501040_0014225_3154_3633 155
257 3300049576 Ga0501040_0068846 Ga0501040_0068846_335_844 155
258 3300049578 Ga0501042_0059200 Ga0501042_0059200_917_1426 155
259 3300049579 Ga0501043_0000616 Ga0501043_0000616_27801_28280 155
260 3300049579 Ga0501043_0099755 Ga0501043_0099755_582_1091 155
261 3300049579 Ga0501043_0599861 Ga0501043_0599861_151_660 155
262 3300049580 Ga0501046_0046486 Ga0501046_0046486_1100_1579 155
263 3300049580 Ga0501046_0108184 Ga0501046_0108184_710_1219 155
264 3300049581 Ga0501047_0004302 Ga0501047_0004302_3169_3648 155
265 3300049581 Ga0501047_0073127 Ga0501047_0073127_1014_1523 155
266 3300049581 Ga0501047_0080697 Ga0501047_0080697_840_1349 155
267 3300049581 Ga0501047_0432318 Ga0501047_0432318_576_1043 155
268 3300049581 Ga0501047_1207300 Ga0501047_1207300_29_496 155
269 3300049582 Ga0501048_0057786 Ga0501048_0057786_490_999 155
270 3300049582 Ga0501048_0405529 Ga0501048_0405529_128_607 155
271 3300049583 Ga0501067_0032749 Ga0501067_0032749_1134_1616 155
272 3300049585 Ga0501069_0033371 Ga0501069_0033371_254_763 155
273 3300049586 Ga0501070_0008569 Ga0501070_0008569_2357_2836 155
274 3300049586 Ga0501070_0469796 Ga0501070_0469796_485_952 155
275 3300049586 Ga0501070_0778454 Ga0501070_0778454_33_542 155
276 3300049587 Ga0501071_0006769 Ga0501071_0006769_6055_6564 155
277 3300049588 Ga0501072_0094384 Ga0501072_0094384_1697_2206 155
278 3300049590 Ga0501074_0273251 Ga0501074_0273251_490_999 155
279 3300049590 Ga0501074_1153561 Ga0501074_1153561_14_481 155
280 3300049592 Ga0501076_0782830 Ga0501076_0782830_58_567 155
281 3300049742 Ga0501080_0047449 Ga0501080_0047449_1622_2131 155
282 3300049744 Ga0501083_0043394 Ga0501083_0043394_2383_2892 155
283 3300049744 Ga0501083_0137175 Ga0501083_0137175_702_1169 155
284 3300049822 Ga0501035_0000008 Ga0501035_0000008_168462_168941 155
285 3300049822 Ga0501035_0003844 Ga0501035_0003844_1514_2023 155
286 3300049822 Ga0501035_0044332 Ga0501035_0044332_1983_2492 155
287 3300049822 Ga0501035_0256466 Ga0501035_0256466_251_730 155
288 3300049823 Ga0501044_0000001 Ga0501044_0000001_195026_195505 155
289 3300049823 Ga0501044_0057108 Ga0501044_0057108_1983_2492 155
290 3300049823 Ga0501044_0057134 Ga0501044_0057134_1982_2491 155
291 3300049823 Ga0501044_0466078 Ga0501044_0466078_408_875 155
292 3300049823 Ga0501044_0615298 Ga0501044_0615298_51_524 155
293 3300049823 Ga0501044_0757142 Ga0501044_0757142_178_645 155
294 3300049824 Ga0501045_0034621 Ga0501045_0034621_1179_1688 155
295 3300049824 Ga0501045_0892379 Ga0501045_0892379_161_640 155
296 3300050489 nmdc:mga03683_165790_c1 nmdc:mga03683_165790_c1_509_976 155
297 3300050489 nmdc:mga03683_166651_c1 nmdc:mga03683_166651_c1_384_851 155
298 3300050491 nmdc:mga00v17_15451_c1 nmdc:mga00v17_15451_c1_609_1112 155
299 3300050491 nmdc:mga00v17_243702_c1 nmdc:mga00v17_243702_c1_273_740 155
300 3300050491 nmdc:mga00v17_435499_c1 nmdc:mga00v17_435499_c1_270_737 155
301 3300050492 nmdc:mga0yw44_159281_c1 nmdc:mga0yw44_159281_c1_366_833 155
302 3300050492 nmdc:mga0yw44_199383_c1 nmdc:mga0yw44_199383_c1_250_753 155
303 3300050492 nmdc:mga0yw44_890471_c1 nmdc:mga0yw44_890471_c1_15_482 155
304 3300050493 nmdc:mga0k408_132576_c1 nmdc:mga0k408_132576_c1_158_625 155
305 3300050493 nmdc:mga0k408_249978_c1 nmdc:mga0k408_249978_c1_291_758 155
306 3300050494 nmdc:mga06z11_39626_c1 nmdc:mga06z11_39626_c1_1592_2059 155
307 3300050494 nmdc:mga06z11_52967_c1 nmdc:mga06z11_52967_c1_911_1378 155
308 3300050495 nmdc:mga04h51_160378_c1 nmdc:mga04h51_160378_c1_377_844 155
309 3300050496 nmdc:mga07m45_200173_c1 nmdc:mga07m45_200173_c1_283_786 155
310 3300050516 nmdc:mga0sz30_136873_c1 nmdc:mga0sz30_136873_c1_167_634 155
311 3300053078 Ga0495612_0316728 Ga0495612_0316728_200_670 155
312 3300053079 Ga0500610_0034999 Ga0500610_0034999_1023_1490 155
313 3300053079 Ga0500610_0436927 Ga0500610_0436927_39_506 155
314 3300053083 Ga0495655_0007152 Ga0495655_0007152_637_1104 155
315 3300053083 Ga0495655_0088639 Ga0495655_0088639_420_887 155
316 3300053086 Ga0500578_0196113 Ga0500578_0196113_201_668 155
317 3300053134 Ga0500658_0056636 Ga0500658_0056636_961_1428 155
318 3300053151 Ga0500604_0113983 Ga0500604_0113983_199_666 155
319 3300053153 Ga0500616_0004503 Ga0500616_0004503_2858_3328 155
320 3300053155 Ga0500620_006753 Ga0500620_006753_869_1336 155
321 3300053158 Ga0500627_0029286 Ga0500627_0029286_1331_1798 155
322 3300053158 Ga0500627_0031242 Ga0500627_0031242_1611_2078 155
323 3300053727 Ga0500611_015898 Ga0500611_015898_817_1284 155
324 3300059643 Ga0587072_071473 Ga0587072_071473_108_575 155
325 iso_pu_bacteria 2643221564 2643840657 155
326 iso_pu_bacteria 2871444079 2871451200 155
327 iso_pu_bacteria 2903540706 2903548310 155
328 iso_pu_bacteria 2937891427 2937892155 155
329 iso_pu_bacteria 2958115193 2958122140 155
330 iso_pu_bacteria 2958165035 2958172188 155
331 iso_pu_bacteria 2961163497 2961170636 155
332 iso_pu_bacteria 2965018300 2965025383 155
333 iso_pu_bacteria 2965062239 2965063271 155
334 iso_pu_bacteria 2968091066 2968095949 155
335 iso_pu_bacteria 2968097103 2968099718 155
336 iso_pu_bacteria 2968110612 2968112534 155
337 iso_pu_bacteria 2968117919 2968121308 155
338 iso_pu_bacteria 2968128360 2968130840 155
339 iso_pu_bacteria 2968171901 2968179022 155
340 iso_pu_bacteria 2970524798 2970532036 155
341 iso_pu_bacteria 2970540015 2970544643 155
342 iso_pu_bacteria 2970554993 2970561866 155
343 iso_pu_bacteria 2977858184 2977859315 155
344 iso_pu_bacteria 2979779861 2979781430 155
345 iso_pu_bacteria 2987659509 2987666875 155
346 iso_pu_bacteria 2996341866 2996348456 155
347 iso_pu_bacteria 3004188549 3004195879 155
348 iso_pu_bacteria 8004445564 8004446026 155
349 iso_pu_bacteria 8004703790 8004713574 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

43

172

0.99

PF08534

Redoxin

Redoxin

42

189

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9493 1 154
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9451 2 155
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9392 2 155
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9374 1 154
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.937 9 154
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9774 5 152 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9665 4 154 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.965 13 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9646 5 152 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9544 4 152 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A439KK28-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 1.001 1 120 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-B6B4M5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9996 34 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2G4YMR3-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9969 4 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A501PRV1-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9968 4 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1Z8AE70-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9963 4 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
94.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map