F417909

General Info

Members Datasets Scaffolds Average Seq Length
349 229 698 140

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10002940|Ga0213875_100029406
Length 164
Sequence VLKPDRLSAADGDAGSSHIGNHGCMADTFVTDTFELTTGAQETAIDITERCEAFLARAAGGADGLLNIFVPHATAGVALIETGSGSDRDLIAALRNLLPADDRWQHRHGSLGHGRDHVLPAFVAPHATLPVLGGSLTLGTWQSVVLVDTNKDNPRRTVRLSFLG

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
30 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
49 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
50 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
57 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
60 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
61 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
62 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
63 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
64 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
65 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
66 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
192 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
193 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2547132424 Nocardia nova SH22a Isolate Unclassified
200 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
201 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
202 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
203 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
204 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
205 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
206 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
207 2862574272 Streptomyces sp. AcE210 Isolate Nodule
208 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
209 2867369537 Streptomyces sp. Z26 Isolate Unclassified
210 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
211 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
212 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
213 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
214 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
215 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
216 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
217 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
218 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
219 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
220 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
221 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
222 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
223 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
224 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
225 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
226 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
227 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
228 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
229 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.83
Metatranscriptomes 0.29
Isolates 8.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 0.29
Rhizoplane 2.87
Rhizosphere 84.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10002940 3300021388 Bacteria 9930
2 rootH2_10003253 3300003320 Bacteria 10031
3 JGI25160J50197_1069703 3300003354 Bacteria 675
4 Ga0070708_101799560 3300005445 Bacteria 568
5 Ga0070706_100133702 3300005467 Bacteria 2315
6 Ga0070707_101207160 3300005468 Bacteria 722
7 Ga0070698_100070788 3300005471 Bacteria 3499
8 Ga0070698_101713931 3300005471 Bacteria 581
9 Ga0070699_101073975 3300005518 Bacteria 738
10 Ga0070697_101648529 3300005536 Bacteria 574
11 Ga0068853_100089318 3300005539 Bacteria 2706
12 Ga0070665_100764425 3300005548 Bacteria 979
13 Ga0068854_100557687 3300005578 Bacteria 973
14 Ga0068864_101668194 3300005618 Bacteria 642
15 Ga0081539_10150338 3300005985 Bacteria 1121
16 Ga0070717_10337254 3300006028 Bacteria 1346
17 Ga0070717_10781098 3300006028 Bacteria 869
18 Ga0075430_100853827 3300006846 Bacteria 750
19 Ga0075431_100045623 3300006847 Bacteria 4519
20 Ga0075431_100627015 3300006847 Bacteria 1057
21 Ga0075434_100675308 3300006871 Bacteria 1051
22 Ga0075429_100029256 3300006880 Bacteria 4785
23 Ga0075429_100598947 3300006880 Bacteria 966
24 Ga0111539_12337894 3300009094 Bacteria 620
25 Ga0114129_10050291 3300009147 Bacteria 5854
26 Ga0105248_11232149 3300009177 Bacteria 846
27 Ga0105246_10247889 3300011119 Bacteria 1412
28 Ga0157369_10102149 3300013105 Bacteria 3056
29 Ga0163162_10295694 3300013306 Bacteria 1751
30 Ga0157379_10526272 3300014968 Bacteria 1098
31 Ga0157376_12506946 3300014969 Bacteria 555
32 Ga0206354_11702026 3300020081 Bacteria 857
33 Ga0209758_1040269 3300025297 Bacteria 1765
34 Ga0207426_1005665 3300025302 Bacteria 5641
35 Ga0207426_1021050 3300025302 Bacteria 2258
36 Ga0207684_10037306 3300025910 Bacteria 4124
37 Ga0207646_10014179 3300025922 Bacteria 7577
38 Ga0207669_11383307 3300025937 Bacteria 599
39 Ga0207711_10599979 3300025941 Bacteria 1027
40 Ga0207679_10502861 3300025945 Bacteria 1082
41 Ga0207668_10648264 3300025972 Bacteria 924
42 Ga0207708_11014089 3300026075 Bacteria 721
43 Ga0207641_10433524 3300026088 Bacteria 1268
44 Ga0268264_10432597 3300028381 Bacteria 1271
45 Ga0307515_10000524 3300028794 Bacteria 91311
46 Ga0307513_10133256 3300031456 Bacteria 2425
47 Ga0307513_10452884 3300031456 Bacteria 1007
48 Ga0307509_10003139 3300031507 Bacteria 25603
49 Ga0307508_10014019 3300031616 Bacteria 7314
50 Ga0307508_10049105 3300031616 Bacteria 3758
51 Ga0307508_10392937 3300031616 Bacteria 978
52 Ga0307516_10034743 3300031730 Bacteria 5064
53 Ga0307413_10571311 3300031824 Bacteria 921
54 Ga0307413_11904678 3300031824 Bacteria 534
55 Ga0307518_10031866 3300031838 Bacteria 3821
56 Ga0307518_10151389 3300031838 Bacteria 1604
57 Ga0307411_11385373 3300032005 Bacteria 643
58 Ga0307507_10007410 3300033179 Bacteria 15995
59 Ga0307507_10037035 3300033179 Bacteria 4970
60 Ga0307507_10649350 3300033179 Bacteria 536
61 Ga0307510_10009355 3300033180 Bacteria 11671
62 Ga0307510_10054411 3300033180 Bacteria 4192
63 Ga0373932_0133546 3300035112 Bacteria 838
64 Ga0395899_0514311 3300037312 Bacteria 775
65 Ga0395900_0123896 3300037418 Bacteria 2651
66 Ga0395898_0002157 3300037466 Bacteria 24154
67 Ga0395898_0015135 3300037466 Bacteria 7917
68 Ga0436364_0380054 3300037853 Bacteria 24964
69 Ga0436365_0973361 3300039437 Bacteria 674
70 Ga0439436_0002399 3300041404 Bacteria 5618
71 Ga0439439_0069863 3300041406 Bacteria 940
72 Ga0451793_0747305 3300041452 Bacteria 592
73 Ga0451853_1119891 3300041512 Bacteria 3845
74 Ga0451853_2511075 3300041512 Bacteria 8383
75 Ga0439442_107810 3300042002 Bacteria 605
76 Ga0439457_001078 3300042014 Bacteria 8255
77 Ga0450890_030981 3300042127 Bacteria 761
78 Ga0450898_000048 3300042134 Bacteria 9912
79 Ga0450899_001184 3300042135 Bacteria 2962
80 Ga0450906_000772 3300042145 Bacteria 6973
81 Ga0450908_003533 3300042184 Bacteria 3046
82 Ga0466969_0014869 3300044656 Bacteria 4085
83 Ga0466969_0421491 3300044656 Bacteria 606
84 Ga0466972_0000710 3300044658 Bacteria 15914
85 Ga0466972_0034231 3300044658 Bacteria 2490
86 Ga0466972_0045557 3300044658 Bacteria 2125
87 Ga0466965_0004021 3300044683 Bacteria 6518
88 Ga0466965_0114518 3300044683 Bacteria 1388
89 Ga0466966_0004675 3300044684 Bacteria 9013
90 Ga0466966_0007019 3300044684 Bacteria 7459
91 Ga0466966_0047668 3300044684 Bacteria 2731
92 Ga0466961_0003151 3300044693 Bacteria 10273
93 Ga0466963_0000808 3300044694 Bacteria 15622
94 Ga0466963_0742736 3300044694 Bacteria 692
95 Ga0466964_0003238 3300044706 Bacteria 5926
96 Ga0466971_0000359 3300044719 Bacteria 17431
97 Ga0466971_0031605 3300044719 Bacteria 2371
98 Ga0466971_0044615 3300044719 Bacteria 1991
99 Ga0466971_0055732 3300044719 Bacteria 1782
100 Ga0466970_0001445 3300044765 Bacteria 11494
101 Ga0466957_0002512 3300044842 Bacteria 9870
102 Ga0466957_0405960 3300044842 Bacteria 932
103 Ga0466959_0000546 3300045049 Bacteria 21926
104 Ga0466959_0055748 3300045049 Bacteria 2884
105 Ga0466959_0239407 3300045049 Bacteria 1254
106 Ga0466959_0424648 3300045049 Bacteria 902
107 Ga0466958_0000588 3300045836 Bacteria 15461
108 Ga0466967_0000066 3300045976 Bacteria 38575
109 Ga0466967_0578686 3300045976 Bacteria 1107
110 Ga0466967_0865065 3300045976 Bacteria 898
111 Ga0495617_132012 3300046452 Bacteria 800
112 Ga0495592_0010299 3300046454 Bacteria 7049
113 Ga0495592_0020586 3300046454 Bacteria 5020
114 Ga0495603_0042706 3300046455 Bacteria 2709
115 Ga0495629_0037662 3300046459 Bacteria 3408
116 Ga0495629_0051363 3300046459 Bacteria 2885
117 Ga0495629_0071545 3300046459 Bacteria 2420
118 Ga0495651_0021486 3300046462 Bacteria 5016
119 Ga0495653_0141807 3300046463 Bacteria 1689
120 Ga0495582_0277360 3300046473 Bacteria 962
121 Ga0495605_0004355 3300046474 Bacteria 8326
122 Ga0495662_0000110 3300046476 Bacteria 30405
123 Ga0495664_0001686 3300046477 Bacteria 11750
124 Ga0495664_0018833 3300046477 Bacteria 3962
125 Ga0495584_0321412 3300046491 Bacteria 786
126 Ga0495594_0077310 3300046499 Bacteria 1856
127 Ga0495596_0288026 3300046500 Bacteria 638
128 Ga0495607_0236218 3300046501 Bacteria 886
129 Ga0495583_0019668 3300046506 Bacteria 3518
130 Ga0495583_0084001 3300046506 Bacteria 1380
131 Ga0495583_0119115 3300046506 Bacteria 1112
132 Ga0495606_0041760 3300046507 Bacteria 3073
133 Ga0495610_0038769 3300046512 Bacteria 2416
134 Ga0495610_0074429 3300046512 Bacteria 1576
135 Ga0495616_0044367 3300046513 Bacteria 2255
136 Ga0495618_0058731 3300046514 Bacteria 2437
137 Ga0495620_0001291 3300046515 Bacteria 15265
138 Ga0495620_0003917 3300046515 Bacteria 8483
139 Ga0495620_0166973 3300046515 Bacteria 854
140 Ga0495628_0009638 3300046516 Bacteria 8239
141 Ga0495628_0026026 3300046516 Bacteria 4776
142 Ga0495628_0207007 3300046516 Bacteria 1476
143 Ga0495631_0012263 3300046518 Bacteria 4194
144 Ga0495632_0155317 3300046519 Bacteria 1056
145 Ga0495643_0011709 3300046522 Bacteria 5325
146 Ga0495648_0013500 3300046524 Bacteria 6031
147 Ga0495648_0118774 3300046524 Bacteria 1425
148 Ga0495666_0012793 3300046526 Bacteria 4183
149 Ga0495666_0196913 3300046526 Bacteria 927
150 Ga0495642_0120837 3300046528 Bacteria 1124
151 Ga0495652_0000984 3300046529 Bacteria 32577
152 Ga0495640_0056519 3300046533 Bacteria 2681
153 Ga0495609_0012796 3300046538 Bacteria 3974
154 Ga0495597_0017766 3300046542 Bacteria 3342
155 Ga0495645_0188695 3300046543 Bacteria 1406
156 Ga0495645_0418002 3300046543 Bacteria 851
157 Ga0495622_0017722 3300046557 Bacteria 3314
158 Ga0495633_0111327 3300046558 Bacteria 1269
159 Ga0495668_0024300 3300046616 Bacteria 3447
160 Ga0495634_0031104 3300046642 Bacteria 3678
161 Ga0495634_0078421 3300046642 Bacteria 2164
162 Ga0495634_0227951 3300046642 Bacteria 1147
163 Ga0495611_0041798 3300046648 Bacteria 2045
164 Ga0495625_0029266 3300046660 Bacteria 4122
165 Ga0495625_0067411 3300046660 Bacteria 2518
166 Ga0495625_0104100 3300046660 Bacteria 1946
167 Ga0495625_0178653 3300046660 Bacteria 1413
168 Ga0495625_0213547 3300046660 Bacteria 1267
169 Ga0495635_0051981 3300046663 Bacteria 2822
170 Ga0495635_0075282 3300046663 Bacteria 2313
171 Ga0495588_0043085 3300046674 Bacteria 2308
172 Ga0495657_0000437 3300046675 Bacteria 38928
173 Ga0495623_0103139 3300046679 Bacteria 1736
174 Ga0495646_0000400 3300046680 Bacteria 22769
175 Ga0495646_0015787 3300046680 Bacteria 4795
176 Ga0495658_0117513 3300046683 Bacteria 1605
177 Ga0495613_0002753 3300046689 Bacteria 13204
178 Ga0495613_0291991 3300046689 Bacteria 1130
179 Ga0495624_0052041 3300046690 Bacteria 2589
180 Ga0495671_0082514 3300046692 Bacteria 1575
181 Ga0495649_0084649 3300046694 Bacteria 1693
182 Ga0495649_0091275 3300046694 Bacteria 1623
183 Ga0495649_0110251 3300046694 Bacteria 1459
184 Ga0495589_0076767 3300046794 Bacteria 1628
185 Ga0495589_0089086 3300046794 Bacteria 1498
186 Ga0495660_0035114 3300046810 Bacteria 2803
187 Ga0495581_0007413 3300047315 Bacteria 6344
188 Ga0495581_0351706 3300047315 Bacteria 860
189 Ga0495604_0000673 3300047317 Bacteria 28933
190 Ga0495636_0002826 3300047318 Bacteria 6699
191 Ga0495636_0020197 3300047318 Bacteria 2683
192 Ga0495636_0261478 3300047318 Bacteria 802
193 Ga0495676_0002857 3300047321 Bacteria 15570
194 Ga0495676_0003781 3300047321 Bacteria 13756
195 Ga0495676_0004612 3300047321 Bacteria 12622
196 Ga0495683_0060265 3300047323 Bacteria 1882
197 Ga0495683_0068346 3300047323 Bacteria 1747
198 Ga0495683_0125747 3300047323 Bacteria 1213
199 Ga0495687_004181 3300047443 Bacteria 9913
200 Ga0495687_014304 3300047443 Bacteria 4090
201 Ga0495687_028009 3300047443 Bacteria 2627
202 Ga0495687_030078 3300047443 Bacteria 2504
203 Ga0495687_030933 3300047443 Bacteria 2461
204 Ga0495675_0135340 3300047444 Bacteria 1530
205 Ga0495677_0319265 3300047445 Bacteria 612
206 Ga0495685_001838 3300047447 Bacteria 6557
207 Ga0495685_031002 3300047447 Bacteria 1838
208 Ga0495685_040639 3300047447 Bacteria 1590
209 Ga0495681_0008911 3300047470 Bacteria 6232
210 Ga0495681_0280529 3300047470 Bacteria 650
211 Ga0495684_0106985 3300047471 Bacteria 2113
212 Ga0495686_0115546 3300047472 Bacteria 1605
213 Ga0495686_0256584 3300047472 Bacteria 980
214 Ga0495593_0002874 3300047673 Bacteria 10384
215 Ga0495602_0059408 3300048088 Bacteria 3338
216 Ga0495614_0007263 3300048089 Bacteria 4936
217 Ga0495614_0023128 3300048089 Bacteria 2680
218 Ga0495626_0015543 3300048091 Bacteria 3892
219 Ga0496100_0601972 3300048903 Bacteria 853
220 Ga0496101_0467559 3300048904 Bacteria 995
221 Ga0496105_0026655 3300048908 Bacteria 4717
222 Ga0496107_0014638 3300048910 Bacteria 5492
223 Ga0496109_0269441 3300048912 Bacteria 1604
224 Ga0496109_1590512 3300048912 Bacteria 588
225 Ga0496111_0296037 3300048914 Bacteria 1200
226 Ga0496115_0003215 3300048918 Bacteria 11728
227 Ga0495678_032827 3300049459 Bacteria 2148
228 Ga0495678_044649 3300049459 Bacteria 1752
229 Ga0495682_0131591 3300049460 Bacteria 895
230 Ga0501032_0005007 3300049569 Bacteria 9909
231 Ga0501032_0014152 3300049569 Bacteria 5655
232 Ga0501033_0001228 3300049570 Bacteria 22982
233 Ga0501033_0014806 3300049570 Bacteria 5921
234 Ga0501033_0050669 3300049570 Bacteria 3078
235 Ga0501033_0155339 3300049570 Bacteria 1649
236 Ga0501033_0170824 3300049570 Bacteria 1561
237 Ga0501034_0011325 3300049571 Bacteria 9252
238 Ga0501034_0016533 3300049571 Bacteria 7565
239 Ga0501034_0041180 3300049571 Bacteria 4673
240 Ga0501034_0856994 3300049571 Bacteria 798
241 Ga0501036_0001619 3300049572 Bacteria 17396
242 Ga0501036_0002429 3300049572 Bacteria 14586
243 Ga0501036_0009818 3300049572 Bacteria 7881
244 Ga0501036_0039519 3300049572 Bacteria 3992
245 Ga0501036_0358588 3300049572 Bacteria 1217
246 Ga0501037_0001974 3300049573 Bacteria 14840
247 Ga0501037_0019353 3300049573 Bacteria 5021
248 Ga0501037_0098311 3300049573 Bacteria 2114
249 Ga0501037_0218683 3300049573 Bacteria 1341
250 Ga0501038_0010933 3300049574 Bacteria 8291
251 Ga0501038_0014347 3300049574 Bacteria 7220
252 Ga0501038_0057678 3300049574 Bacteria 3333
253 Ga0501039_0000783 3300049575 Bacteria 22832
254 Ga0501039_0067260 3300049575 Bacteria 2782
255 Ga0501040_0053532 3300049576 Bacteria 2764
256 Ga0501042_0024661 3300049578 Bacteria 4219
257 Ga0501043_0003903 3300049579 Bacteria 12238
258 Ga0501043_0040496 3300049579 Bacteria 3662
259 Ga0501043_0050737 3300049579 Bacteria 3261
260 Ga0501043_0054568 3300049579 Bacteria 3138
261 Ga0501043_1072131 3300049579 Bacteria 570
262 Ga0501046_0022775 3300049580 Bacteria 5158
263 Ga0501046_0371770 3300049580 Bacteria 1035
264 Ga0501047_0011072 3300049581 Bacteria 8536
265 Ga0501047_0016359 3300049581 Bacteria 7079
266 Ga0501047_0048813 3300049581 Bacteria 4087
267 Ga0501047_0995407 3300049581 Bacteria 652
268 Ga0501048_0116948 3300049582 Bacteria 1883
269 Ga0501048_0575879 3300049582 Bacteria 808
270 Ga0501067_0028781 3300049583 Bacteria 3079
271 Ga0501068_0003235 3300049584 Bacteria 8731
272 Ga0501068_0143671 3300049584 Bacteria 1497
273 Ga0501069_0013750 3300049585 Bacteria 4318
274 Ga0501069_0095965 3300049585 Bacteria 1679
275 Ga0501070_0002326 3300049586 Bacteria 16679
276 Ga0501070_0022181 3300049586 Bacteria 5318
277 Ga0501070_0066835 3300049586 Bacteria 2977
278 Ga0501070_0087151 3300049586 Bacteria 2585
279 Ga0501071_0007328 3300049587 Bacteria 7230
280 Ga0501072_0012458 3300049588 Bacteria 6500
281 Ga0501074_0003416 3300049590 Bacteria 11247
282 Ga0501076_0274589 3300049592 Bacteria 1380
283 Ga0501077_0030363 3300049593 Bacteria 3438
284 Ga0501079_0026946 3300049741 Bacteria 4407
285 Ga0501080_0189996 3300049742 Bacteria 1887
286 Ga0501083_0003083 3300049744 Bacteria 11583
287 Ga0501035_0000667 3300049822 Bacteria 37784
288 Ga0501035_0013378 3300049822 Bacteria 7575
289 Ga0501035_0052544 3300049822 Bacteria 3646
290 Ga0501035_0060789 3300049822 Bacteria 3363
291 Ga0501035_0069772 3300049822 Bacteria 3114
292 Ga0501035_0699692 3300049822 Bacteria 817
293 Ga0501044_0019105 3300049823 Bacteria 7336
294 Ga0501044_0041390 3300049823 Bacteria 4796
295 Ga0501044_0115679 3300049823 Bacteria 2687
296 Ga0501044_0204916 3300049823 Bacteria 1929
297 Ga0501045_0291925 3300049824 Bacteria 1213
298 nmdc:mga05p37_93864_c1 3300050507 Bacteria 3697
299 nmdc:mga09592_1170468_c1 3300050508 Bacteria 637
300 nmdc:mga06r32_573346_c1 3300050510 Bacteria 1101
301 nmdc:mga0n895_1275008_c1 3300050512 Bacteria 706
302 Ga0495601_0001187 3300053077 Bacteria 14248
303 Ga0495601_1075625 3300053077 Bacteria 504
304 Ga0495612_0000313 3300053078 Bacteria 19537
305 Ga0500610_0209666 3300053079 Bacteria 932
306 Ga0495619_0038262 3300053085 Bacteria 3129
307 Ga0500640_011827 3300053095 Bacteria 3567
308 Ga0500560_174016 3300053107 Bacteria 707
309 Ga0500560_175744 3300053107 Bacteria 702
310 Ga0500624_009863 3300053157 Bacteria 1365
311 Ga0500636_0183118 3300053177 Bacteria 1123
312 Ga0501084_0201447 3300054114 Bacteria 1679
313 Ga0501082_0017946 3300060353 Bacteria 6094
314 Ga0466962_0012810 3300061719 Bacteria 4034
315 Ga0466962_0023165 3300061719 Bacteria 2985
316 Ga0466962_0030051 3300061719 Bacteria 2601
317 Ga0466962_0060260 3300061719 Bacteria 1812
318 Ga0530510_0267280 3300061734 Bacteria 1276
319 2548692574 2547132424 Bacteria 8348532
320 2585317389 2582581314 Bacteria 11452267
321 2644403110 2643221673 Bacteria 9196637
322 2731907955 2731639228 Bacteria 4187555
323 2768647796 2767802112 Bacteria 6465194
324 2793981545 2791355406 Bacteria 11364898
325 2811846704 2808606982 Bacteria 7791042
326 2819739309 2818991472 Bacteria 10089953
327 2862580337 2862574272 Bacteria 10567477
328 2863407660 2863404153 Bacteria 9672205
329 2867375125 2867369537 Bacteria 6501581
330 2873158131 2873151551 Bacteria 8625867
331 2875392426 2875391855 Bacteria 7600475
332 2912726558 2912723979 Bacteria 8557534
333 2912758482 2912757875 Bacteria 7940295
334 2946052318 2946045630 Bacteria 8527308
335 2946073533 2946072368 Bacteria 8999607
336 2947232226 2947224130 Bacteria 9938529
337 2990046125 2990044586 Bacteria 6603797
338 2990092076 2990088156 Bacteria 6657676
339 3006327713 3006321560 Bacteria 8247479
340 3006491163 3006486233 Bacteria 8157040
341 8008486394 8008485437 Bacteria 7198341
342 8023626040 8023623736 Bacteria 8593882
343 8025528173 8025524527 Bacteria 7197316
344 8047900979 8047893842 Bacteria 11723082
345 8048357922 8048356638 Bacteria 11044339
346 8048377921 8048369669 Bacteria 11666822
347 8048387019 8048379754 Bacteria 11877923
348 8048407357 8048406513 Bacteria 8936924
349 8056832682 8056829672 Bacteria 9045328
350 Ga0213875_10002940
351 rootH2_10003253
352 JGI25160J50197_1069703
353 Ga0070708_101799560
354 Ga0070706_100133702
355 Ga0070707_101207160
356 Ga0070698_100070788
357 Ga0070698_101713931
358 Ga0070699_101073975
359 Ga0070697_101648529
360 Ga0068853_100089318
361 Ga0070665_100764425
362 Ga0068854_100557687
363 Ga0068864_101668194
364 Ga0081539_10150338
365 Ga0070717_10337254
366 Ga0070717_10781098
367 Ga0075430_100853827
368 Ga0075431_100045623
369 Ga0075431_100627015
370 Ga0075434_100675308
371 Ga0075429_100029256
372 Ga0075429_100598947
373 Ga0111539_12337894
374 Ga0114129_10050291
375 Ga0105248_11232149
376 Ga0105246_10247889
377 Ga0157369_10102149
378 Ga0163162_10295694
379 Ga0157379_10526272
380 Ga0157376_12506946
381 Ga0206354_11702026
382 Ga0209758_1040269
383 Ga0207426_1005665
384 Ga0207426_1021050
385 Ga0207684_10037306
386 Ga0207646_10014179
387 Ga0207669_11383307
388 Ga0207711_10599979
389 Ga0207679_10502861
390 Ga0207668_10648264
391 Ga0207708_11014089
392 Ga0207641_10433524
393 Ga0268264_10432597
394 Ga0307515_10000524
395 Ga0307513_10133256
396 Ga0307513_10452884
397 Ga0307509_10003139
398 Ga0307508_10014019
399 Ga0307508_10049105
400 Ga0307508_10392937
401 Ga0307516_10034743
402 Ga0307413_10571311
403 Ga0307413_11904678
404 Ga0307518_10031866
405 Ga0307518_10151389
406 Ga0307411_11385373
407 Ga0307507_10007410
408 Ga0307507_10037035
409 Ga0307507_10649350
410 Ga0307510_10009355
411 Ga0307510_10054411
412 Ga0373932_0133546
413 Ga0395899_0514311
414 Ga0395900_0123896
415 Ga0395898_0002157
416 Ga0395898_0015135
417 Ga0436364_0380054
418 Ga0436365_0973361
419 Ga0439436_0002399
420 Ga0439439_0069863
421 Ga0451793_0747305
422 Ga0451853_1119891
423 Ga0451853_2511075
424 Ga0439442_107810
425 Ga0439457_001078
426 Ga0450890_030981
427 Ga0450898_000048
428 Ga0450899_001184
429 Ga0450906_000772
430 Ga0450908_003533
431 Ga0466969_0014869
432 Ga0466969_0421491
433 Ga0466972_0000710
434 Ga0466972_0034231
435 Ga0466972_0045557
436 Ga0466965_0004021
437 Ga0466965_0114518
438 Ga0466966_0004675
439 Ga0466966_0007019
440 Ga0466966_0047668
441 Ga0466961_0003151
442 Ga0466963_0000808
443 Ga0466963_0742736
444 Ga0466964_0003238
445 Ga0466971_0000359
446 Ga0466971_0031605
447 Ga0466971_0044615
448 Ga0466971_0055732
449 Ga0466970_0001445
450 Ga0466957_0002512
451 Ga0466957_0405960
452 Ga0466959_0000546
453 Ga0466959_0055748
454 Ga0466959_0239407
455 Ga0466959_0424648
456 Ga0466958_0000588
457 Ga0466967_0000066
458 Ga0466967_0578686
459 Ga0466967_0865065
460 Ga0495617_132012
461 Ga0495592_0010299
462 Ga0495592_0020586
463 Ga0495603_0042706
464 Ga0495629_0037662
465 Ga0495629_0051363
466 Ga0495629_0071545
467 Ga0495651_0021486
468 Ga0495653_0141807
469 Ga0495582_0277360
470 Ga0495605_0004355
471 Ga0495662_0000110
472 Ga0495664_0001686
473 Ga0495664_0018833
474 Ga0495584_0321412
475 Ga0495594_0077310
476 Ga0495596_0288026
477 Ga0495607_0236218
478 Ga0495583_0019668
479 Ga0495583_0084001
480 Ga0495583_0119115
481 Ga0495606_0041760
482 Ga0495610_0038769
483 Ga0495610_0074429
484 Ga0495616_0044367
485 Ga0495618_0058731
486 Ga0495620_0001291
487 Ga0495620_0003917
488 Ga0495620_0166973
489 Ga0495628_0009638
490 Ga0495628_0026026
491 Ga0495628_0207007
492 Ga0495631_0012263
493 Ga0495632_0155317
494 Ga0495643_0011709
495 Ga0495648_0013500
496 Ga0495648_0118774
497 Ga0495666_0012793
498 Ga0495666_0196913
499 Ga0495642_0120837
500 Ga0495652_0000984
501 Ga0495640_0056519
502 Ga0495609_0012796
503 Ga0495597_0017766
504 Ga0495645_0188695
505 Ga0495645_0418002
506 Ga0495622_0017722
507 Ga0495633_0111327
508 Ga0495668_0024300
509 Ga0495634_0031104
510 Ga0495634_0078421
511 Ga0495634_0227951
512 Ga0495611_0041798
513 Ga0495625_0029266
514 Ga0495625_0067411
515 Ga0495625_0104100
516 Ga0495625_0178653
517 Ga0495625_0213547
518 Ga0495635_0051981
519 Ga0495635_0075282
520 Ga0495588_0043085
521 Ga0495657_0000437
522 Ga0495623_0103139
523 Ga0495646_0000400
524 Ga0495646_0015787
525 Ga0495658_0117513
526 Ga0495613_0002753
527 Ga0495613_0291991
528 Ga0495624_0052041
529 Ga0495671_0082514
530 Ga0495649_0084649
531 Ga0495649_0091275
532 Ga0495649_0110251
533 Ga0495589_0076767
534 Ga0495589_0089086
535 Ga0495660_0035114
536 Ga0495581_0007413
537 Ga0495581_0351706
538 Ga0495604_0000673
539 Ga0495636_0002826
540 Ga0495636_0020197
541 Ga0495636_0261478
542 Ga0495676_0002857
543 Ga0495676_0003781
544 Ga0495676_0004612
545 Ga0495683_0060265
546 Ga0495683_0068346
547 Ga0495683_0125747
548 Ga0495687_004181
549 Ga0495687_014304
550 Ga0495687_028009
551 Ga0495687_030078
552 Ga0495687_030933
553 Ga0495675_0135340
554 Ga0495677_0319265
555 Ga0495685_001838
556 Ga0495685_031002
557 Ga0495685_040639
558 Ga0495681_0008911
559 Ga0495681_0280529
560 Ga0495684_0106985
561 Ga0495686_0115546
562 Ga0495686_0256584
563 Ga0495593_0002874
564 Ga0495602_0059408
565 Ga0495614_0007263
566 Ga0495614_0023128
567 Ga0495626_0015543
568 Ga0496100_0601972
569 Ga0496101_0467559
570 Ga0496105_0026655
571 Ga0496107_0014638
572 Ga0496109_0269441
573 Ga0496109_1590512
574 Ga0496111_0296037
575 Ga0496115_0003215
576 Ga0495678_032827
577 Ga0495678_044649
578 Ga0495682_0131591
579 Ga0501032_0005007
580 Ga0501032_0014152
581 Ga0501033_0001228
582 Ga0501033_0014806
583 Ga0501033_0050669
584 Ga0501033_0155339
585 Ga0501033_0170824
586 Ga0501034_0011325
587 Ga0501034_0016533
588 Ga0501034_0041180
589 Ga0501034_0856994
590 Ga0501036_0001619
591 Ga0501036_0002429
592 Ga0501036_0009818
593 Ga0501036_0039519
594 Ga0501036_0358588
595 Ga0501037_0001974
596 Ga0501037_0019353
597 Ga0501037_0098311
598 Ga0501037_0218683
599 Ga0501038_0010933
600 Ga0501038_0014347
601 Ga0501038_0057678
602 Ga0501039_0000783
603 Ga0501039_0067260
604 Ga0501040_0053532
605 Ga0501042_0024661
606 Ga0501043_0003903
607 Ga0501043_0040496
608 Ga0501043_0050737
609 Ga0501043_0054568
610 Ga0501043_1072131
611 Ga0501046_0022775
612 Ga0501046_0371770
613 Ga0501047_0011072
614 Ga0501047_0016359
615 Ga0501047_0048813
616 Ga0501047_0995407
617 Ga0501048_0116948
618 Ga0501048_0575879
619 Ga0501067_0028781
620 Ga0501068_0003235
621 Ga0501068_0143671
622 Ga0501069_0013750
623 Ga0501069_0095965
624 Ga0501070_0002326
625 Ga0501070_0022181
626 Ga0501070_0066835
627 Ga0501070_0087151
628 Ga0501071_0007328
629 Ga0501072_0012458
630 Ga0501074_0003416
631 Ga0501076_0274589
632 Ga0501077_0030363
633 Ga0501079_0026946
634 Ga0501080_0189996
635 Ga0501083_0003083
636 Ga0501035_0000667
637 Ga0501035_0013378
638 Ga0501035_0052544
639 Ga0501035_0060789
640 Ga0501035_0069772
641 Ga0501035_0699692
642 Ga0501044_0019105
643 Ga0501044_0041390
644 Ga0501044_0115679
645 Ga0501044_0204916
646 Ga0501045_0291925
647 nmdc:mga05p37_93864_c1
648 nmdc:mga09592_1170468_c1
649 nmdc:mga06r32_573346_c1
650 nmdc:mga0n895_1275008_c1
651 Ga0495601_0001187
652 Ga0495601_1075625
653 Ga0495612_0000313
654 Ga0500610_0209666
655 Ga0495619_0038262
656 Ga0500640_011827
657 Ga0500560_174016
658 Ga0500560_175744
659 Ga0500624_009863
660 Ga0500636_0183118
661 Ga0501084_0201447
662 Ga0501082_0017946
663 Ga0466962_0012810
664 Ga0466962_0023165
665 Ga0466962_0030051
666 Ga0466962_0060260
667 Ga0530510_0267280
668 2548692574
669 2585317389
670 2644403110
671 2731907955
672 2768647796
673 2793981545
674 2811846704
675 2819739309
676 2862580337
677 2863407660
678 2867375125
679 2873158131
680 2875392426
681 2912726558
682 2912758482
683 2946052318
684 2946073533
685 2947232226
686 2990046125
687 2990092076
688 3006327713
689 3006491163
690 8008486394
691 8023626040
692 8025528173
693 8047900979
694 8048357922
695 8048377921
696 8048387019
697 8048407357
698 8056832682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

46

162

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.911 5 139
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9071 1 138
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9068 1 138
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9039 5 139
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9018 7 138
ID Description Score Start End Superfamily
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9269 5 139 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9135 5 139 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9042 1 138 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8953 7 139 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8861 5 139 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A1H7X437-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9528 3 139
AF-A0A7K1UPK5-F1-model_v4 YjbQ family protein 0.9503 5 139
AF-A0A7W7R783-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9501 4 139
AF-A0A2G6XX76-F1-model_v4 deleted 0.9493 4 138
AF-A0A445NID0-F1-model_v4 deleted 0.949 4 139

Map