F417897

General Info

Members Datasets Scaffolds Average Seq Length
349 223 698 322

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10045768|Ga0157372_100457685
Length 361
Sequence LGGGAGGGQRASAHEGILPGEPWSIELFSAAGPGDSTFMVQIGYTMMTEQAGPRDLVDHLVRAEGAGYDFSVTSDHYFPWLRSQGHSPYAWSVLGAAAQATSHIPLMTYVTCPTVRYHPAVVAQKAATMQLLSEGRFRLGLGSGENLNEHVVGGGWPSVDVRHEMLEEAVEIIRALFKGGHVNHRGTHFDVESARLWDLPDQPPPIGIAVSGEQSSALAGRLADLVIATEPEAGLLTAFDRHGGEGKPRVGQLPVCYDPDRDTAVKRAHAQFRWFGGGWKVNSELPHPDSFESATQYVTPDDVAASIPCGDNPDDFVEAVRPYADAGFDEVALVQIGGESQPAYLDWAEKTLLPALRDSFG

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
33 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
80 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
156 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
157 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
158 2643221548 Streptomyces sp. Root55 Isolate Unclassified
159 2643221561 Nocardioides sp. Root151 Isolate Unclassified
160 2643221647 Streptomyces sp. Root369 Isolate Unclassified
161 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
162 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
163 2643221696 Nocardioides sp. Root140 Isolate Unclassified
164 2643221714 Streptomyces sp. Root264 Isolate Unclassified
165 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
166 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
167 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
168 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
169 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
170 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
171 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
172 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
173 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
174 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
175 2808606394 Promicromonospora sp. C35 Isolate Unclassified
176 2808606448 Streptomyces sp. 193411 Isolate Unclassified
177 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
178 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
179 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
180 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
181 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
182 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
183 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
184 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
185 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
186 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
187 2867428634 Streptomyces sp. RP5T Isolate Unclassified
188 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
189 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
190 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
191 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
192 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
193 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
194 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
195 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
196 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
197 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
198 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
199 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
200 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
201 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
202 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
203 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
204 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
205 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
206 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
207 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
208 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
209 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
210 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
211 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
212 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
213 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
214 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
215 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
216 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
217 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
218 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
219 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
220 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
221 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
222 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
223 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.37
Metatranscriptomes 0.86
Isolates 19.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0.86
Rhizoplane 1.15
Rhizosphere 77.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10045768 3300013307 Bacteria 4856
2 JGI24737J22298_10002106 3300001990 Bacteria 7099
3 Ga0006562J51391_1095764 3300003578 Bacteria 4756
4 Ga0006562J51391_1095766 3300003578 Bacteria 2420
5 Ga0070683_100055527 3300005329 Bacteria 3675
6 Ga0070682_100234361 3300005337 Bacteria 1314
7 Ga0070691_10043262 3300005341 Bacteria 2133
8 Ga0070671_100006749 3300005355 Bacteria 9185
9 Ga0070674_100347751 3300005356 Bacteria 1196
10 Ga0070659_100000286 3300005366 Bacteria 39444
11 Ga0070659_100052110 3300005366 Bacteria 3218
12 Ga0070714_100010363 3300005435 Bacteria 7365
13 Ga0070714_100026133 3300005435 Bacteria 4824
14 Ga0070714_100236710 3300005435 Bacteria 1684
15 Ga0070684_100180955 3300005535 Bacteria 1917
16 Ga0070684_100447464 3300005535 Bacteria 1194
17 Ga0070665_100001370 3300005548 Bacteria 28697
18 Ga0070665_100001588 3300005548 Bacteria 26177
19 Ga0068855_100024671 3300005563 Bacteria 7192
20 Ga0068854_100208212 3300005578 Bacteria 1541
21 Ga0068856_100062910 3300005614 Bacteria 3665
22 Ga0068863_100018805 3300005841 Bacteria 6612
23 Ga0070717_10000049 3300006028 Bacteria 103751
24 Ga0070717_10013187 3300006028 Bacteria 6321
25 Ga0070717_10020241 3300006028 Bacteria 5230
26 Ga0075363_100006715 3300006048 Bacteria 5251
27 Ga0075367_10000753 3300006178 Bacteria 12627
28 Ga0099826_10163502 3300006948 Bacteria 1258
29 Ga0105240_10031383 3300009093 Bacteria 6891
30 Ga0105240_10248324 3300009093 Bacteria 2059
31 Ga0105245_10607793 3300009098 Bacteria 1120
32 Ga0105241_10003448 3300009174 Bacteria 11768
33 Ga0105237_10038771 3300009545 Bacteria 4811
34 Ga0105238_10031695 3300009551 Bacteria 5380
35 Ga0105249_10386607 3300009553 Bacteria 1426
36 Ga0105239_10064486 3300010375 Bacteria 4021
37 Ga0157374_10050676 3300013296 Bacteria 3860
38 Ga0182008_10001100 3300014497 Bacteria 18633
39 Ga0182006_1016062 3300015261 Bacteria 3199
40 Ga0182007_10000291 3300015262 Bacteria 32565
41 Ga0182005_1037962 3300015265 Bacteria 1310
42 Ga0183367_1003 3300015688 Bacteria 814276
43 Ga0213873_10020549 3300021358 Bacteria 1544
44 Ga0213874_10000090 3300021377 Bacteria 14202
45 Ga0213876_10030979 3300021384 Bacteria 2823
46 Ga0213876_10058223 3300021384 Bacteria 2039
47 Ga0213876_10072336 3300021384 Bacteria 1821
48 Ga0213875_10014247 3300021388 Bacteria 3883
49 Ga0213875_10022333 3300021388 Bacteria 3027
50 Ga0213875_10022787 3300021388 Bacteria 2995
51 Ga0213875_10025859 3300021388 Bacteria 2794
52 Ga0224712_10010984 3300022467 Bacteria 2790
53 Ga0207426_1022010 3300025302 Bacteria 2194
54 Ga0207647_10008777 3300025904 Bacteria 7216
55 Ga0207654_10029721 3300025911 Bacteria 2995
56 Ga0207695_10058849 3300025913 Bacteria 3988
57 Ga0207695_10194929 3300025913 Bacteria 1942
58 Ga0207671_10000421 3300025914 Bacteria 58859
59 Ga0207657_10025031 3300025919 Bacteria 5514
60 Ga0207694_10004812 3300025924 Bacteria 10483
61 Ga0207664_10008995 3300025929 Bacteria 6992
62 Ga0207664_10009081 3300025929 Bacteria 6963
63 Ga0207664_10346129 3300025929 Bacteria 1315
64 Ga0207644_10008114 3300025931 Bacteria 6876
65 Ga0207690_10000021 3300025932 Bacteria 217710
66 Ga0207661_10101033 3300025944 Bacteria 2422
67 Ga0207712_10251191 3300025961 Bacteria 1429
68 Ga0207640_10046152 3300025981 Bacteria 2801
69 Ga0207640_10127983 3300025981 Bacteria 1831
70 Ga0207702_10035061 3300026078 Bacteria 4196
71 Ga0268266_10009761 3300028379 Bacteria 8442
72 Ga0268266_10011583 3300028379 Bacteria 7655
73 Ga0268264_10003883 3300028381 Bacteria 12815
74 Ga0307515_10054676 3300028794 Bacteria 5854
75 Ga0307511_10000237 3300030521 Bacteria 56458
76 Ga0307513_10080545 3300031456 Bacteria 3358
77 Ga0307509_10004368 3300031507 Bacteria 20471
78 Ga0307514_10002138 3300031649 Bacteria 21299
79 Ga0307514_10054699 3300031649 Bacteria 3072
80 Ga0307514_10223075 3300031649 Bacteria 1153
81 Ga0307516_10000711 3300031730 Bacteria 45216
82 Ga0307516_10023552 3300031730 Bacteria 6308
83 Ga0307413_10214413 3300031824 Bacteria 1401
84 Ga0307518_10069067 3300031838 Bacteria 2560
85 Ga0307409_100047154 3300031995 Bacteria 3268
86 Ga0395899_0008209 3300037312 Bacteria 8046
87 Ga0395898_0011079 3300037466 Bacteria 9388
88 Ga0395898_0092891 3300037466 Bacteria 2901
89 Ga0395898_0207553 3300037466 Bacteria 1869
90 Ga0436364_0186156 3300037853 Bacteria 1139
91 Ga0436364_0764228 3300037853 Bacteria 9736
92 Ga0436364_0779164 3300037853 Bacteria 24601
93 Ga0436364_1069326 3300037853 Bacteria 3844
94 Ga0436364_1079626 3300037853 Bacteria 3028
95 Ga0395901_0157393 3300038443 Bacteria 2386
96 Ga0395901_0302297 3300038443 Bacteria 1659
97 Ga0436365_0308855 3300039437 Bacteria 18122
98 Ga0436365_0700666 3300039437 Bacteria 7478
99 Ga0436365_0910611 3300039437 Bacteria 2777
100 Ga0436365_1093652 3300039437 Bacteria 18228
101 Ga0436365_1162559 3300039437 Bacteria 1744
102 Ga0436365_1168763 3300039437 Bacteria 90017
103 Ga0436360_0047644 3300039438 Bacteria 1401
104 Ga0436361_0773940 3300039447 Bacteria 2310
105 Ga0436363_0654155 3300039450 Bacteria 35800
106 Ga0436363_1386217 3300039450 Bacteria 3272
107 Ga0436363_1572750 3300039450 Bacteria 3865
108 Ga0436362_0046403 3300039453 Bacteria 1596
109 Ga0439436_0004953 3300041404 Bacteria 4081
110 Ga0439436_0007734 3300041404 Bacteria 3305
111 Ga0439439_0034690 3300041406 Bacteria 1294
112 Ga0451853_1638035 3300041512 Bacteria 3163
113 Ga0439448_0001374 3300042005 Bacteria 6261
114 Ga0439432_025857 3300042006 Bacteria 1923
115 Ga0439449_0004259 3300042007 Bacteria 5533
116 Ga0439449_0006554 3300042007 Bacteria 4448
117 Ga0439457_000009 3300042014 Bacteria 41871
118 Ga0439457_004959 3300042014 Bacteria 3404
119 Ga0450903_003624 3300042138 Bacteria 2666
120 Ga0466969_0007745 3300044656 Bacteria 5710
121 Ga0466969_0026459 3300044656 Bacteria 2975
122 Ga0466969_0072469 3300044656 Bacteria 1654
123 Ga0466972_0000835 3300044658 Bacteria 14773
124 Ga0466972_0035290 3300044658 Bacteria 2448
125 Ga0466972_0073094 3300044658 Bacteria 1634
126 Ga0466965_0054964 3300044683 Bacteria 1981
127 Ga0466965_0078047 3300044683 Bacteria 1672
128 Ga0466965_0092503 3300044683 Bacteria 1540
129 Ga0466966_0021872 3300044684 Bacteria 4198
130 Ga0466966_0027773 3300044684 Bacteria 3689
131 Ga0466966_0090660 3300044684 Bacteria 1898
132 Ga0466961_0018201 3300044693 Bacteria 4516
133 Ga0466961_0020677 3300044693 Bacteria 4235
134 Ga0466961_0025563 3300044693 Bacteria 3797
135 Ga0466961_0045530 3300044693 Bacteria 2807
136 Ga0466961_0099444 3300044693 Bacteria 1833
137 Ga0466961_0272773 3300044693 Bacteria 1036
138 Ga0466963_0000541 3300044694 Bacteria 17780
139 Ga0466963_0000682 3300044694 Bacteria 16496
140 Ga0466963_0059074 3300044694 Bacteria 2559
141 Ga0466963_0075631 3300044694 Bacteria 2273
142 Ga0466963_0077317 3300044694 Bacteria 2248
143 Ga0466963_0203958 3300044694 Bacteria 1383
144 Ga0466971_0000700 3300044719 Bacteria 13405
145 Ga0466971_0020744 3300044719 Bacteria 2920
146 Ga0466970_0000323 3300044765 Bacteria 23219
147 Ga0466970_0002529 3300044765 Bacteria 8823
148 Ga0466970_0017677 3300044765 Bacteria 3685
149 Ga0466957_0002908 3300044842 Bacteria 9282
150 Ga0466957_0056805 3300044842 Bacteria 2394
151 Ga0466957_0191601 3300044842 Bacteria 1340
152 Ga0466957_0265585 3300044842 Bacteria 1145
153 Ga0466960_0009162 3300044901 Bacteria 4073
154 Ga0466960_0067850 3300044901 Bacteria 1768
155 Ga0466960_0261741 3300044901 Bacteria 964
156 Ga0466959_0004100 3300045049 Bacteria 9704
157 Ga0466959_0018927 3300045049 Bacteria 5060
158 Ga0466959_0022322 3300045049 Bacteria 4678
159 Ga0466959_0038517 3300045049 Bacteria 3533
160 Ga0466959_0105803 3300045049 Bacteria 2012
161 Ga0466958_0041779 3300045836 Bacteria 2759
162 Ga0466958_0066264 3300045836 Bacteria 2205
163 Ga0466958_0120685 3300045836 Bacteria 1641
164 Ga0466958_0159133 3300045836 Bacteria 1426
165 Ga0466967_0001305 3300045976 Bacteria 14233
166 Ga0466967_0042297 3300045976 Bacteria 3936
167 Ga0466967_0056147 3300045976 Bacteria 3471
168 Ga0466967_0128232 3300045976 Bacteria 2352
169 Ga0466967_0542250 3300045976 Bacteria 1144
170 Ga0495605_0074054 3300046474 Bacteria 1603
171 Ga0495584_0088650 3300046491 Bacteria 1560
172 Ga0495585_0035667 3300046492 Bacteria 2809
173 Ga0495585_0062514 3300046492 Bacteria 2045
174 Ga0495607_0080770 3300046501 Bacteria 1787
175 Ga0495583_0045530 3300046506 Bacteria 2028
176 Ga0495606_0032311 3300046507 Bacteria 3627
177 Ga0495610_0037398 3300046512 Bacteria 2471
178 Ga0495616_0047697 3300046513 Bacteria 2156
179 Ga0495620_0003000 3300046515 Bacteria 9705
180 Ga0495631_0011513 3300046518 Bacteria 4348
181 Ga0495643_0009686 3300046522 Bacteria 5964
182 Ga0495648_0028855 3300046524 Bacteria 3690
183 Ga0495648_0031905 3300046524 Bacteria 3465
184 Ga0495666_0082678 3300046526 Bacteria 1518
185 Ga0495587_0117027 3300046536 Bacteria 1528
186 Ga0495597_0049163 3300046542 Bacteria 1864
187 Ga0495633_0073156 3300046558 Bacteria 1598
188 Ga0495668_0020078 3300046616 Bacteria 3843
189 Ga0495668_0034185 3300046616 Bacteria 2853
190 Ga0495625_0007642 3300046660 Bacteria 9375
191 Ga0495625_0057626 3300046660 Bacteria 2762
192 Ga0495625_0110729 3300046660 Bacteria 1877
193 Ga0495657_0029976 3300046675 Bacteria 3812
194 Ga0495599_0153630 3300046678 Bacteria 1424
195 Ga0495613_0013204 3300046689 Bacteria 6137
196 Ga0495624_0010413 3300046690 Bacteria 6410
197 Ga0495649_0012648 3300046694 Bacteria 4898
198 Ga0495589_0016892 3300046794 Bacteria 3747
199 Ga0495589_0035648 3300046794 Bacteria 2494
200 Ga0495589_0080474 3300046794 Bacteria 1585
201 Ga0495676_0013529 3300047321 Bacteria 7333
202 Ga0495676_0052602 3300047321 Bacteria 3249
203 Ga0495683_0026168 3300047323 Bacteria 2986
204 Ga0495683_0056217 3300047323 Bacteria 1958
205 Ga0495683_0076576 3300047323 Bacteria 1636
206 Ga0495687_002005 3300047443 Bacteria 17256
207 Ga0495687_006413 3300047443 Bacteria 7216
208 Ga0495685_004141 3300047447 Bacteria 4666
209 Ga0495685_030442 3300047447 Bacteria 1855
210 Ga0495602_0404625 3300048088 Bacteria 973
211 Ga0495626_0025989 3300048091 Bacteria 2858
212 Ga0496102_0117285 3300048905 Bacteria 2484
213 Ga0496103_0021754 3300048906 Bacteria 3860
214 Ga0496106_0025984 3300048909 Bacteria 4357
215 Ga0496124_0030869 3300048927 Bacteria 4748
216 Ga0496126_0000104 3300048929 Bacteria 200735
217 Ga0495678_030388 3300049459 Bacteria 2261
218 Ga0501031_0039034 3300049568 Bacteria 3098
219 Ga0501032_0001163 3300049569 Bacteria 21103
220 Ga0501032_0272973 3300049569 Bacteria 1095
221 Ga0501033_0000856 3300049570 Bacteria 27837
222 Ga0501033_0014169 3300049570 Bacteria 6062
223 Ga0501033_0020614 3300049570 Bacteria 4981
224 Ga0501033_0025736 3300049570 Bacteria 4432
225 Ga0501034_0018205 3300049571 Bacteria 7206
226 Ga0501034_0027252 3300049571 Bacteria 5813
227 Ga0501034_0032818 3300049571 Bacteria 5272
228 Ga0501034_0041735 3300049571 Bacteria 4642
229 Ga0501034_0271300 3300049571 Bacteria 1637
230 Ga0501036_0009877 3300049572 Bacteria 7857
231 Ga0501036_0054373 3300049572 Bacteria 3391
232 Ga0501037_0009603 3300049573 Bacteria 7101
233 Ga0501037_0010578 3300049573 Bacteria 6777
234 Ga0501037_0014777 3300049573 Bacteria 5743
235 Ga0501037_0107527 3300049573 Bacteria 2010
236 Ga0501038_0007364 3300049574 Bacteria 10152
237 Ga0501038_0024790 3300049574 Bacteria 5347
238 Ga0501038_0027158 3300049574 Bacteria 5095
239 Ga0501039_0009270 3300049575 Bacteria 7497
240 Ga0501039_0081733 3300049575 Bacteria 2515
241 Ga0501039_0214478 3300049575 Bacteria 1514
242 Ga0501040_0240495 3300049576 Bacteria 1290
243 Ga0501042_0003438 3300049578 Bacteria 9948
244 Ga0501043_0009315 3300049579 Bacteria 7715
245 Ga0501043_0017990 3300049579 Bacteria 5543
246 Ga0501043_0118241 3300049579 Bacteria 2079
247 Ga0501046_0096691 3300049580 Bacteria 2268
248 Ga0501047_0017850 3300049581 Bacteria 6797
249 Ga0501047_0041981 3300049581 Bacteria 4420
250 Ga0501047_0057128 3300049581 Bacteria 3774
251 Ga0501047_0072522 3300049581 Bacteria 3314
252 Ga0501047_0089738 3300049581 Bacteria 2951
253 Ga0501048_0005200 3300049582 Bacteria 9915
254 Ga0501048_0127268 3300049582 Bacteria 1801
255 Ga0501070_0000250 3300049586 Bacteria 50587
256 Ga0501070_0047909 3300049586 Bacteria 3551
257 Ga0501070_0244483 3300049586 Bacteria 1468
258 Ga0501071_0304924 3300049587 Bacteria 1208
259 Ga0501072_0210144 3300049588 Bacteria 1551
260 Ga0501074_0018771 3300049590 Bacteria 5024
261 Ga0501083_0108967 3300049744 Bacteria 1821
262 Ga0501035_0002219 3300049822 Bacteria 19280
263 Ga0501035_0020015 3300049822 Bacteria 6148
264 Ga0501035_0025039 3300049822 Bacteria 5472
265 Ga0501035_0027125 3300049822 Bacteria 5237
266 Ga0501035_0086491 3300049822 Bacteria 2762
267 Ga0501035_0137176 3300049822 Bacteria 2129
268 Ga0501035_0213902 3300049822 Bacteria 1648
269 Ga0501044_0005693 3300049823 Bacteria 13811
270 Ga0501044_0026973 3300049823 Bacteria 6077
271 Ga0501044_0072747 3300049823 Bacteria 3495
272 Ga0501044_0083303 3300049823 Bacteria 3234
273 Ga0501044_0092161 3300049823 Bacteria 3056
274 Ga0501044_0231311 3300049823 Bacteria 1796
275 Ga0501044_0420231 3300049823 Bacteria 1247
276 nmdc:mga03n38_17924_c1 3300050490 Bacteria 2783
277 Ga0500600_0041704 3300053149 Bacteria 2647
278 Ga0501082_0485516 3300060353 Bacteria 1080
279 Ga0466962_0000943 3300061719 Bacteria 13183
280 Ga0466962_0136016 3300061719 Bacteria 1189
281 2547408900 2547132111 Bacteria 8013147
282 2585306037 2582581313 Bacteria 10042643
283 2616697902 2616644814 Bacteria 11555299
284 2643766095 2643221548 Bacteria 8053412
285 2643826526 2643221561 Bacteria 4984412
286 2644265100 2643221647 Bacteria 10741251
287 2644441782 2643221678 Bacteria 9540101
288 2644463552 2643221682 Bacteria 6743283
289 2644535563 2643221696 Bacteria 5431823
290 2644630823 2643221714 Bacteria 9015452
291 2760304165 2758568522 Bacteria 5953541
292 2760622589 2758568621 Bacteria 5967089
293 2784585998 2784132148 Bacteria 8627943
294 2785339239 2784746763 Bacteria 9783172
295 2785366201 2784746768 Bacteria 10036182
296 2786667170 2786546132 Bacteria 10419719
297 2793984774 2791355406 Bacteria 11364898
298 2804844723 2802429296 Bacteria 7227771
299 2808846801 2808606359 Bacteria 9866990
300 2808917433 2808606375 Bacteria 9466072
301 2809028084 2808606394 Bacteria 6248540
302 2809229499 2808606448 Bacteria 8656184
303 2811846264 2808606982 Bacteria 7791042
304 2812361590 2811994879 Bacteria 9313447
305 2812477183 2811994917 Bacteria 7761064
306 2852641697 2852635781 Bacteria 8251373
307 2862185764 2862178590 Bacteria 8583590
308 2862282341 2862281513 Bacteria 9621493
309 2862292913 2862290372 Bacteria 7471434
310 2862390829 2862382967 Bacteria 10317375
311 2862512836 2862507626 Bacteria 9425308
312 2863410883 2863404153 Bacteria 9672205
313 2867432521 2867428634 Bacteria 9590268
314 2873152543 2873151551 Bacteria 8625867
315 2877684313 2877676314 Bacteria 9512378
316 2912723407 2912715099 Bacteria 9460473
317 2912726818 2912723979 Bacteria 8557534
318 2919473823 2919468124 Bacteria 9133025
319 2946064575 2946064051 Bacteria 8957905
320 2946072994 2946072368 Bacteria 8999607
321 2947224518 2947224130 Bacteria 9938529
322 2954008626 2954002825 Bacteria 9173742
323 2954389653 2954380949 Bacteria 10050426
324 2954682257 2954673503 Bacteria 9685905
325 2954690666 2954682443 Bacteria 9862841
326 2954700495 2954691527 Bacteria 10720516
327 2954701733 2954701450 Bacteria 10834262
328 2954719169 2954711539 Bacteria 10867210
329 2954729140 2954721474 Bacteria 10456478
330 2954732670 2954731030 Bacteria 10243860
331 2954748040 2954740390 Bacteria 10229294
332 2954751549 2954749733 Bacteria 10366972
333 2954767165 2954759201 Bacteria 9358192
334 2990059905 2990059506 Bacteria 9321252
335 3006396778 3006393351 Bacteria 6615579
336 3006498635 3006493962 Bacteria 8825450
337 8008565018 8008558824 Bacteria 10610750
338 8008581436 8008574985 Bacteria 7815457
339 8023624548 8023623736 Bacteria 8593882
340 8025418386 8025413630 Bacteria 7014048
341 8025485780 8025478263 Bacteria 8209203
342 8047895098 8047893842 Bacteria 11723082
343 8048363952 8048356638 Bacteria 11044339
344 8048372124 8048369669 Bacteria 11666822
345 8048381058 8048379754 Bacteria 11877923
346 8054161966 8054160619 Bacteria 7783213
347 8056449366 8056447290 Bacteria 7680491
348 8056584074 8056579771 Bacteria 5840325
349 8056834988 8056829672 Bacteria 9045328
350 Ga0157372_10045768
351 JGI24737J22298_10002106
352 Ga0006562J51391_1095764
353 Ga0006562J51391_1095766
354 Ga0070683_100055527
355 Ga0070682_100234361
356 Ga0070691_10043262
357 Ga0070671_100006749
358 Ga0070674_100347751
359 Ga0070659_100000286
360 Ga0070659_100052110
361 Ga0070714_100010363
362 Ga0070714_100026133
363 Ga0070714_100236710
364 Ga0070684_100180955
365 Ga0070684_100447464
366 Ga0070665_100001370
367 Ga0070665_100001588
368 Ga0068855_100024671
369 Ga0068854_100208212
370 Ga0068856_100062910
371 Ga0068863_100018805
372 Ga0070717_10000049
373 Ga0070717_10013187
374 Ga0070717_10020241
375 Ga0075363_100006715
376 Ga0075367_10000753
377 Ga0099826_10163502
378 Ga0105240_10031383
379 Ga0105240_10248324
380 Ga0105245_10607793
381 Ga0105241_10003448
382 Ga0105237_10038771
383 Ga0105238_10031695
384 Ga0105249_10386607
385 Ga0105239_10064486
386 Ga0157374_10050676
387 Ga0182008_10001100
388 Ga0182006_1016062
389 Ga0182007_10000291
390 Ga0182005_1037962
391 Ga0183367_1003
392 Ga0213873_10020549
393 Ga0213874_10000090
394 Ga0213876_10030979
395 Ga0213876_10058223
396 Ga0213876_10072336
397 Ga0213875_10014247
398 Ga0213875_10022333
399 Ga0213875_10022787
400 Ga0213875_10025859
401 Ga0224712_10010984
402 Ga0207426_1022010
403 Ga0207647_10008777
404 Ga0207654_10029721
405 Ga0207695_10058849
406 Ga0207695_10194929
407 Ga0207671_10000421
408 Ga0207657_10025031
409 Ga0207694_10004812
410 Ga0207664_10008995
411 Ga0207664_10009081
412 Ga0207664_10346129
413 Ga0207644_10008114
414 Ga0207690_10000021
415 Ga0207661_10101033
416 Ga0207712_10251191
417 Ga0207640_10046152
418 Ga0207640_10127983
419 Ga0207702_10035061
420 Ga0268266_10009761
421 Ga0268266_10011583
422 Ga0268264_10003883
423 Ga0307515_10054676
424 Ga0307511_10000237
425 Ga0307513_10080545
426 Ga0307509_10004368
427 Ga0307514_10002138
428 Ga0307514_10054699
429 Ga0307514_10223075
430 Ga0307516_10000711
431 Ga0307516_10023552
432 Ga0307413_10214413
433 Ga0307518_10069067
434 Ga0307409_100047154
435 Ga0395899_0008209
436 Ga0395898_0011079
437 Ga0395898_0092891
438 Ga0395898_0207553
439 Ga0436364_0186156
440 Ga0436364_0764228
441 Ga0436364_0779164
442 Ga0436364_1069326
443 Ga0436364_1079626
444 Ga0395901_0157393
445 Ga0395901_0302297
446 Ga0436365_0308855
447 Ga0436365_0700666
448 Ga0436365_0910611
449 Ga0436365_1093652
450 Ga0436365_1162559
451 Ga0436365_1168763
452 Ga0436360_0047644
453 Ga0436361_0773940
454 Ga0436363_0654155
455 Ga0436363_1386217
456 Ga0436363_1572750
457 Ga0436362_0046403
458 Ga0439436_0004953
459 Ga0439436_0007734
460 Ga0439439_0034690
461 Ga0451853_1638035
462 Ga0439448_0001374
463 Ga0439432_025857
464 Ga0439449_0004259
465 Ga0439449_0006554
466 Ga0439457_000009
467 Ga0439457_004959
468 Ga0450903_003624
469 Ga0466969_0007745
470 Ga0466969_0026459
471 Ga0466969_0072469
472 Ga0466972_0000835
473 Ga0466972_0035290
474 Ga0466972_0073094
475 Ga0466965_0054964
476 Ga0466965_0078047
477 Ga0466965_0092503
478 Ga0466966_0021872
479 Ga0466966_0027773
480 Ga0466966_0090660
481 Ga0466961_0018201
482 Ga0466961_0020677
483 Ga0466961_0025563
484 Ga0466961_0045530
485 Ga0466961_0099444
486 Ga0466961_0272773
487 Ga0466963_0000541
488 Ga0466963_0000682
489 Ga0466963_0059074
490 Ga0466963_0075631
491 Ga0466963_0077317
492 Ga0466963_0203958
493 Ga0466971_0000700
494 Ga0466971_0020744
495 Ga0466970_0000323
496 Ga0466970_0002529
497 Ga0466970_0017677
498 Ga0466957_0002908
499 Ga0466957_0056805
500 Ga0466957_0191601
501 Ga0466957_0265585
502 Ga0466960_0009162
503 Ga0466960_0067850
504 Ga0466960_0261741
505 Ga0466959_0004100
506 Ga0466959_0018927
507 Ga0466959_0022322
508 Ga0466959_0038517
509 Ga0466959_0105803
510 Ga0466958_0041779
511 Ga0466958_0066264
512 Ga0466958_0120685
513 Ga0466958_0159133
514 Ga0466967_0001305
515 Ga0466967_0042297
516 Ga0466967_0056147
517 Ga0466967_0128232
518 Ga0466967_0542250
519 Ga0495605_0074054
520 Ga0495584_0088650
521 Ga0495585_0035667
522 Ga0495585_0062514
523 Ga0495607_0080770
524 Ga0495583_0045530
525 Ga0495606_0032311
526 Ga0495610_0037398
527 Ga0495616_0047697
528 Ga0495620_0003000
529 Ga0495631_0011513
530 Ga0495643_0009686
531 Ga0495648_0028855
532 Ga0495648_0031905
533 Ga0495666_0082678
534 Ga0495587_0117027
535 Ga0495597_0049163
536 Ga0495633_0073156
537 Ga0495668_0020078
538 Ga0495668_0034185
539 Ga0495625_0007642
540 Ga0495625_0057626
541 Ga0495625_0110729
542 Ga0495657_0029976
543 Ga0495599_0153630
544 Ga0495613_0013204
545 Ga0495624_0010413
546 Ga0495649_0012648
547 Ga0495589_0016892
548 Ga0495589_0035648
549 Ga0495589_0080474
550 Ga0495676_0013529
551 Ga0495676_0052602
552 Ga0495683_0026168
553 Ga0495683_0056217
554 Ga0495683_0076576
555 Ga0495687_002005
556 Ga0495687_006413
557 Ga0495685_004141
558 Ga0495685_030442
559 Ga0495602_0404625
560 Ga0495626_0025989
561 Ga0496102_0117285
562 Ga0496103_0021754
563 Ga0496106_0025984
564 Ga0496124_0030869
565 Ga0496126_0000104
566 Ga0495678_030388
567 Ga0501031_0039034
568 Ga0501032_0001163
569 Ga0501032_0272973
570 Ga0501033_0000856
571 Ga0501033_0014169
572 Ga0501033_0020614
573 Ga0501033_0025736
574 Ga0501034_0018205
575 Ga0501034_0027252
576 Ga0501034_0032818
577 Ga0501034_0041735
578 Ga0501034_0271300
579 Ga0501036_0009877
580 Ga0501036_0054373
581 Ga0501037_0009603
582 Ga0501037_0010578
583 Ga0501037_0014777
584 Ga0501037_0107527
585 Ga0501038_0007364
586 Ga0501038_0024790
587 Ga0501038_0027158
588 Ga0501039_0009270
589 Ga0501039_0081733
590 Ga0501039_0214478
591 Ga0501040_0240495
592 Ga0501042_0003438
593 Ga0501043_0009315
594 Ga0501043_0017990
595 Ga0501043_0118241
596 Ga0501046_0096691
597 Ga0501047_0017850
598 Ga0501047_0041981
599 Ga0501047_0057128
600 Ga0501047_0072522
601 Ga0501047_0089738
602 Ga0501048_0005200
603 Ga0501048_0127268
604 Ga0501070_0000250
605 Ga0501070_0047909
606 Ga0501070_0244483
607 Ga0501071_0304924
608 Ga0501072_0210144
609 Ga0501074_0018771
610 Ga0501083_0108967
611 Ga0501035_0002219
612 Ga0501035_0020015
613 Ga0501035_0025039
614 Ga0501035_0027125
615 Ga0501035_0086491
616 Ga0501035_0137176
617 Ga0501035_0213902
618 Ga0501044_0005693
619 Ga0501044_0026973
620 Ga0501044_0072747
621 Ga0501044_0083303
622 Ga0501044_0092161
623 Ga0501044_0231311
624 Ga0501044_0420231
625 nmdc:mga03n38_17924_c1
626 Ga0500600_0041704
627 Ga0501082_0485516
628 Ga0466962_0000943
629 Ga0466962_0136016
630 2547408900
631 2585306037
632 2616697902
633 2643766095
634 2643826526
635 2644265100
636 2644441782
637 2644463552
638 2644535563
639 2644630823
640 2760304165
641 2760622589
642 2784585998
643 2785339239
644 2785366201
645 2786667170
646 2793984774
647 2804844723
648 2808846801
649 2808917433
650 2809028084
651 2809229499
652 2811846264
653 2812361590
654 2812477183
655 2852641697
656 2862185764
657 2862282341
658 2862292913
659 2862390829
660 2862512836
661 2863410883
662 2867432521
663 2873152543
664 2877684313
665 2912723407
666 2912726818
667 2919473823
668 2946064575
669 2946072994
670 2947224518
671 2954008626
672 2954389653
673 2954682257
674 2954690666
675 2954700495
676 2954701733
677 2954719169
678 2954729140
679 2954732670
680 2954748040
681 2954751549
682 2954767165
683 2990059905
684 3006396778
685 3006498635
686 8008565018
687 8008581436
688 8023624548
689 8025418386
690 8025485780
691 8047895098
692 8048363952
693 8048372124
694 8048381058
695 8054161966
696 8056449366
697 8056584074
698 8056834988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

36

330

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9187 1 319
3c8n-assembly1.cif.gz_A crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9155 2 319
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9052 1 319
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.904 2 319
3c8n-assembly1.cif.gz_A crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8993 2 319
ID Description Score Start End Superfamily
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8877 2 319 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8861 2 319 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8787 1 319 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8722 2 319 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8705 2 319 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A3R8TDK4-F1-model_v4 LLM class F420-dependent oxidoreductase 0.981 1 323 GO:0016705
AF-S4MRS8-F1-model_v4 Putative F420-dependent glucose-6-phosphate dehydrogenase 0.9809 1 323 GO:0016705
AF-S4MRS8-F1-model_v4 Putative F420-dependent glucose-6-phosphate dehydrogenase 0.9779 1 323 GO:0016705
AF-A0A7J0CGB2-F1-model_v4 Luciferase-like domain-containing protein 0.9759 127 320 GO:0016705
AF-A0A6V8K989-F1-model_v4 Luciferase-like domain-containing protein 0.9705 153 319 GO:0016705

Map