F417892

General Info

Members Datasets Scaffolds Average Seq Length
349 208 698 141

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10030742|Ga0157370_100307422
Length 144
Sequence MRAVVQRVTSASVSVGGEVVGRIDAGLLALVAVTHTDTATHAVKLARKIAELRILRDGGRDEASAVALGAPVLVVSQFTLYGETGRGRRPSWQAAAPGEVAEPLVTAVVRELRQLGLPVETGTFGAMMAVSSVNDGPFTLLLDV

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
99 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 2643221613 Oerskovia sp. Root22 Isolate Unclassified
195 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
196 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
197 2643221711 Terrabacter sp. Root85 Isolate Unclassified
198 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
199 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
200 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
201 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
202 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
203 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
204 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
205 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
206 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
207 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
208 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.84
Metatranscriptomes 0.86
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.87
Nodule 0
Rhizoplane 20.63
Rhizosphere 69.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10030742 3300013104 Bacteria 5260
2 Ga0006562J51391_1133043 3300003578 Bacteria 1920
3 Ga0070683_100023914 3300005329 Bacteria 5470
4 Ga0070683_100515355 3300005329 Bacteria 1143
5 Ga0068868_100014435 3300005338 Bacteria 5822
6 Ga0070660_100587863 3300005339 Bacteria 930
7 Ga0070691_10076120 3300005341 Bacteria 1635
8 Ga0070675_100855763 3300005354 Bacteria 832
9 Ga0070709_10241840 3300005434 Bacteria 1296
10 Ga0070714_100599986 3300005435 Bacteria 1057
11 Ga0070710_10031774 3300005437 Bacteria 2853
12 Ga0070694_100685524 3300005444 Bacteria 832
13 Ga0070694_101154271 3300005444 Bacteria 648
14 Ga0070708_100485780 3300005445 Bacteria 1165
15 Ga0070707_100252874 3300005468 Bacteria 1715
16 Ga0070698_100548683 3300005471 Bacteria 1095
17 Ga0070679_100266581 3300005530 Bacteria 1667
18 Ga0070684_100134271 3300005535 Bacteria 2234
19 Ga0070684_100159862 3300005535 Bacteria 2043
20 Ga0070684_100429467 3300005535 Bacteria 1220
21 Ga0070693_100305039 3300005547 Bacteria 1074
22 Ga0070704_101028197 3300005549 Bacteria 746
23 Ga0070664_100564990 3300005564 Bacteria 1053
24 Ga0068857_100102153 3300005577 Bacteria 2573
25 Ga0068857_100436373 3300005577 Bacteria 1223
26 Ga0068857_100928185 3300005577 Bacteria 835
27 Ga0068856_100015936 3300005614 Bacteria 7267
28 Ga0070702_100352341 3300005615 Bacteria 1037
29 Ga0068852_102330360 3300005616 Bacteria 556
30 Ga0068863_100213209 3300005841 Bacteria 1859
31 Ga0068860_100251230 3300005843 Bacteria 1722
32 Ga0081455_10366711 3300005937 Bacteria 1011
33 Ga0075365_10423641 3300006038 Bacteria 940
34 Ga0075368_10001653 3300006042 Bacteria 7154
35 Ga0075364_10063607 3300006051 Bacteria 2422
36 Ga0070716_101038741 3300006173 Bacteria 650
37 Ga0070712_100280249 3300006175 Bacteria 1342
38 Ga0075362_10011847 3300006177 Bacteria 3445
39 Ga0075367_10259647 3300006178 Bacteria 1090
40 Ga0068871_100087276 3300006358 Bacteria 2593
41 Ga0068865_101042205 3300006881 Bacteria 718
42 Ga0105244_10259137 3300009036 Bacteria 810
43 Ga0111539_12490956 3300009094 Bacteria 600
44 Ga0105245_10047443 3300009098 Bacteria 3840
45 Ga0105245_11781810 3300009098 Bacteria 668
46 Ga0105243_10239101 3300009148 Bacteria 1615
47 Ga0105243_10512531 3300009148 Bacteria 1139
48 Ga0105243_11614316 3300009148 Bacteria 675
49 Ga0105243_12145242 3300009148 Bacteria 595
50 Ga0105241_11914894 3300009174 Bacteria 581
51 Ga0105242_11329941 3300009176 Bacteria 743
52 Ga0105248_10178536 3300009177 Bacteria 2393
53 Ga0105238_10993988 3300009551 Bacteria 860
54 Ga0105238_11101886 3300009551 Bacteria 817
55 Ga0105238_12476508 3300009551 Bacteria 555
56 Ga0105239_10170708 3300010375 Bacteria 2432
57 Ga0105246_10154873 3300011119 Bacteria 1739
58 Ga0105246_10400808 3300011119 Bacteria 1139
59 Ga0105246_10416539 3300011119 Bacteria 1120
60 Ga0157370_10464445 3300013104 Bacteria 1163
61 Ga0157369_10130430 3300013105 Bacteria 2664
62 Ga0157369_11687436 3300013105 Bacteria 644
63 Ga0157374_10021805 3300013296 Bacteria 5707
64 Ga0163162_10107614 3300013306 Bacteria 2884
65 Ga0163162_11756535 3300013306 Bacteria 709
66 Ga0157372_11532825 3300013307 Bacteria 768
67 Ga0157372_11613044 3300013307 Bacteria 747
68 Ga0157375_10290228 3300013308 Bacteria 1799
69 Ga0157375_10371369 3300013308 Bacteria 1597
70 Ga0157375_10497528 3300013308 Bacteria 1383
71 Ga0157375_10622155 3300013308 Bacteria 1238
72 Ga0157375_10765599 3300013308 Bacteria 1116
73 Ga0157375_12247606 3300013308 Bacteria 650
74 Ga0163163_10039356 3300014325 Bacteria 4614
75 Ga0163163_10957065 3300014325 Bacteria 919
76 Ga0157379_10015038 3300014968 Bacteria 6788
77 Ga0157376_10007647 3300014969 Bacteria 7737
78 Ga0163161_10153649 3300017792 Bacteria 1751
79 Ga0163161_10286523 3300017792 Bacteria 1293
80 Ga0206356_10451184 3300020070 Bacteria 1004
81 Ga0206353_10289601 3300020082 Bacteria 1692
82 Ga0207692_10527435 3300025898 Bacteria 752
83 Ga0207699_10189481 3300025906 Bacteria 1387
84 Ga0207663_10304104 3300025916 Bacteria 1193
85 Ga0207652_10227235 3300025921 Bacteria 1682
86 Ga0207694_10547821 3300025924 Bacteria 971
87 Ga0207687_10263608 3300025927 Bacteria 1375
88 Ga0207700_10386745 3300025928 Bacteria 1224
89 Ga0207664_10023381 3300025929 Bacteria 4629
90 Ga0207690_10255331 3300025932 Bacteria 1356
91 Ga0207709_10169071 3300025935 Bacteria 1532
92 Ga0207665_10225042 3300025939 Bacteria 1377
93 Ga0207661_10067569 3300025944 Bacteria 2908
94 Ga0207679_10374391 3300025945 Bacteria 1247
95 Ga0207668_10996103 3300025972 Bacteria 749
96 Ga0207658_10366777 3300025986 Bacteria 1258
97 Ga0207677_10279745 3300026023 Bacteria 1369
98 Ga0207703_10106451 3300026035 Bacteria 2386
99 Ga0207702_10034589 3300026078 Bacteria 4225
100 Ga0207702_10331412 3300026078 Bacteria 1452
101 Ga0207641_11578258 3300026088 Bacteria 658
102 Ga0207698_10781119 3300026142 Bacteria 956
103 Ga0209813_10004807 3300027866 Bacteria 3245
104 Ga0268266_10387631 3300028379 Bacteria 1319
105 Ga0268264_10000280 3300028381 Bacteria 86361
106 Ga0307408_100771124 3300031548 Bacteria 870
107 Ga0307408_101783088 3300031548 Bacteria 588
108 Ga0307405_10103327 3300031731 Bacteria 1916
109 Ga0307405_10587788 3300031731 Bacteria 907
110 Ga0307405_10624756 3300031731 Bacteria 882
111 Ga0307410_10156095 3300031852 Bacteria 1704
112 Ga0307410_10337111 3300031852 Bacteria 1201
113 Ga0307410_11032824 3300031852 Bacteria 710
114 Ga0307407_10009640 3300031903 Bacteria 4508
115 Ga0307412_10134914 3300031911 Bacteria 1799
116 Ga0307409_100011360 3300031995 Bacteria 5608
117 Ga0307409_100015481 3300031995 Bacteria 5007
118 Ga0307409_100660109 3300031995 Bacteria 1041
119 Ga0307409_100760987 3300031995 Bacteria 973
120 Ga0307409_100805658 3300031995 Bacteria 947
121 Ga0307416_100076388 3300032002 Bacteria 2807
122 Ga0307416_100189504 3300032002 Bacteria 1938
123 Ga0307416_101451663 3300032002 Bacteria 792
124 Ga0307411_10122429 3300032005 Bacteria 1885
125 Ga0307411_10324872 3300032005 Bacteria 1244
126 Ga0307415_101625799 3300032126 Bacteria 621
127 Ga0373931_0592028 3300035691 Bacteria 724
128 Ga0373947_1057379 3300035725 Bacteria 554
129 Ga0395899_0181739 3300037312 Bacteria 1476
130 Ga0395900_0043733 3300037418 Bacteria 4617
131 Ga0395898_0671018 3300037466 Bacteria 979
132 Ga0395905_0076412 3300037471 Bacteria 3139
133 Ga0395901_0139663 3300038443 Bacteria 2546
134 Ga0395901_0335600 3300038443 Bacteria 1562
135 Ga0395901_0434057 3300038443 Bacteria 1345
136 Ga0395901_0785158 3300038443 Bacteria 943
137 Ga0439439_0037758 3300041406 Bacteria 1246
138 Ga0439465_0248872 3300041413 Bacteria 657
139 Ga0439465_0275436 3300041413 Bacteria 626
140 Ga0451797_0618877 3300041453 Bacteria 698
141 Ga0451804_0149241 3300041463 Bacteria 637
142 Ga0451843_1362898 3300041509 Bacteria 2175
143 Ga0439449_0294182 3300042007 Bacteria 613
144 Ga0439457_088164 3300042014 Bacteria 717
145 Ga0450906_055145 3300042145 Bacteria 704
146 Ga0450909_019533 3300042185 Bacteria 1009
147 Ga0466965_0424084 3300044683 Bacteria 738
148 Ga0466966_0150647 3300044684 Bacteria 1419
149 Ga0466964_0130727 3300044706 Bacteria 1143
150 Ga0466968_0152335 3300044735 Bacteria 1063
151 Ga0466968_0216198 3300044735 Bacteria 902
152 Ga0466970_0044884 3300044765 Bacteria 2353
153 Ga0466960_0268633 3300044901 Bacteria 952
154 Ga0466958_0211331 3300045836 Bacteria 1236
155 Ga0466967_0131478 3300045976 Bacteria 2324
156 Ga0466967_0489999 3300045976 Bacteria 1205
157 Ga0466967_0808223 3300045976 Bacteria 931
158 Ga0466967_1513427 3300045976 Bacteria 668
159 Ga0495629_0571255 3300046459 Bacteria 758
160 Ga0495641_0161674 3300046461 Bacteria 1002
161 Ga0495580_0534813 3300046472 Bacteria 780
162 Ga0495639_0757476 3300046475 Bacteria 503
163 Ga0495645_0358841 3300046543 Bacteria 937
164 Ga0495667_0260327 3300046559 Bacteria 1103
165 Ga0495657_0078527 3300046675 Bacteria 2139
166 Ga0495657_0393111 3300046675 Bacteria 817
167 Ga0495657_0763922 3300046675 Bacteria 554
168 Ga0495623_0411399 3300046679 Bacteria 726
169 Ga0495600_0220657 3300046809 Bacteria 1213
170 Ga0495600_0295536 3300046809 Bacteria 1023
171 Ga0495600_0581184 3300046809 Bacteria 682
172 Ga0495581_0292595 3300047315 Bacteria 952
173 Ga0495581_0566452 3300047315 Bacteria 659
174 Ga0495674_0399429 3300047319 Bacteria 1110
175 Ga0495680_0206254 3300047322 Bacteria 1409
176 Ga0495684_1028542 3300047471 Bacteria 522
177 Ga0496100_0002424 3300048903 Bacteria 9453
178 Ga0496101_0023377 3300048904 Bacteria 4269
179 Ga0496101_0104161 3300048904 Bacteria 2128
180 Ga0496101_0181654 3300048904 Bacteria 1620
181 Ga0496101_0460295 3300048904 Bacteria 1004
182 Ga0496101_1138978 3300048904 Bacteria 612
183 Ga0496102_0006948 3300048905 Bacteria 9656
184 Ga0496102_0030291 3300048905 Bacteria 4843
185 Ga0496102_0063319 3300048905 Bacteria 3386
186 Ga0496102_0119282 3300048905 Bacteria 2463
187 Ga0496102_0176728 3300048905 Bacteria 2010
188 Ga0496102_0357096 3300048905 Bacteria 1376
189 Ga0496102_0394289 3300048905 Bacteria 1302
190 Ga0496102_0606239 3300048905 Bacteria 1018
191 Ga0496103_0012978 3300048906 Bacteria 4941
192 Ga0496103_0134622 3300048906 Bacteria 1579
193 Ga0496103_0148691 3300048906 Bacteria 1500
194 Ga0496104_0004961 3300048907 Bacteria 11616
195 Ga0496104_0130335 3300048907 Bacteria 2415
196 Ga0496104_0180762 3300048907 Bacteria 2020
197 Ga0496104_0818254 3300048907 Bacteria 837
198 Ga0496105_0008841 3300048908 Bacteria 7846
199 Ga0496105_0047814 3300048908 Bacteria 3530
200 Ga0496105_0062679 3300048908 Bacteria 3069
201 Ga0496105_0078872 3300048908 Bacteria 2719
202 Ga0496105_0331918 3300048908 Bacteria 1217
203 Ga0496105_0427884 3300048908 Bacteria 1047
204 Ga0496105_0662165 3300048908 Bacteria 805
205 Ga0496105_0823785 3300048908 Bacteria 704
206 Ga0496106_0531157 3300048909 Bacteria 944
207 Ga0496106_0846610 3300048909 Bacteria 724
208 Ga0496107_0056961 3300048910 Bacteria 2825
209 Ga0496107_0300967 3300048910 Bacteria 1194
210 Ga0496108_0211552 3300048911 Bacteria 1683
211 Ga0496108_0325358 3300048911 Bacteria 1340
212 Ga0496108_0662315 3300048911 Bacteria 907
213 Ga0496108_1448018 3300048911 Bacteria 573
214 Ga0496109_0155033 3300048912 Bacteria 2145
215 Ga0496109_1276580 3300048912 Bacteria 670
216 Ga0496110_0023757 3300048913 Bacteria 5217
217 Ga0496110_0076499 3300048913 Bacteria 2976
218 Ga0496110_0494019 3300048913 Bacteria 1114
219 Ga0496110_0656872 3300048913 Bacteria 949
220 Ga0496110_0831052 3300048913 Bacteria 829
221 Ga0496110_1102765 3300048913 Bacteria 702
222 Ga0496110_1636864 3300048913 Bacteria 554
223 Ga0496111_0094713 3300048914 Bacteria 2190
224 Ga0496111_0110750 3300048914 Bacteria 2022
225 Ga0496112_0225816 3300048915 Bacteria 1828
226 Ga0496112_0270633 3300048915 Bacteria 1647
227 Ga0496112_0579938 3300048915 Bacteria 1054
228 Ga0496112_0624922 3300048915 Bacteria 1008
229 Ga0496113_0022125 3300048916 Bacteria 4492
230 Ga0496113_0026699 3300048916 Bacteria 4132
231 Ga0496113_0080245 3300048916 Bacteria 2499
232 Ga0496113_0146260 3300048916 Bacteria 1862
233 Ga0496113_0485670 3300048916 Bacteria 992
234 Ga0496114_0011307 3300048917 Bacteria 7129
235 Ga0496114_0052185 3300048917 Bacteria 3406
236 Ga0496114_0239047 3300048917 Bacteria 1597
237 Ga0496114_0285227 3300048917 Bacteria 1456
238 Ga0496114_0331340 3300048917 Bacteria 1346
239 Ga0496114_0436216 3300048917 Bacteria 1160
240 Ga0496114_0449106 3300048917 Bacteria 1142
241 Ga0496114_0450201 3300048917 Bacteria 1140
242 Ga0496114_1152055 3300048917 Bacteria 661
243 Ga0496114_1267905 3300048917 Bacteria 624
244 Ga0496115_0126945 3300048918 Bacteria 2102
245 Ga0496115_0427590 3300048918 Bacteria 1072
246 Ga0496115_1388058 3300048918 Bacteria 519
247 Ga0496117_0215906 3300048920 Bacteria 1071
248 Ga0496118_0061396 3300048921 Bacteria 2783
249 Ga0496118_0080713 3300048921 Bacteria 2288
250 Ga0496119_0458506 3300048922 Bacteria 599
251 Ga0496122_0000098 3300048925 Bacteria 198547
252 Ga0496123_0000341 3300048926 Bacteria 87840
253 Ga0496124_0000545 3300048927 Bacteria 63669
254 Ga0496125_0000224 3300048928 Bacteria 115811
255 Ga0501031_0004909 3300049568 Bacteria 8690
256 Ga0501031_0101316 3300049568 Bacteria 1879
257 Ga0501031_0207152 3300049568 Bacteria 1279
258 Ga0501033_0027970 3300049570 Bacteria 4238
259 Ga0501034_0044621 3300049571 Bacteria 4482
260 Ga0501034_0459560 3300049571 Bacteria 1190
261 Ga0501036_0014161 3300049572 Bacteria 6633
262 Ga0501036_1277210 3300049572 Bacteria 597
263 Ga0501037_0014570 3300049573 Bacteria 5785
264 Ga0501038_0002173 3300049574 Bacteria 18217
265 Ga0501038_0009539 3300049574 Bacteria 8904
266 Ga0501038_0398410 3300049574 Bacteria 1065
267 Ga0501038_0748452 3300049574 Bacteria 729
268 Ga0501039_0040149 3300049575 Bacteria 3613
269 Ga0501039_0292815 3300049575 Bacteria 1280
270 Ga0501039_1421035 3300049575 Bacteria 534
271 Ga0501040_0017639 3300049576 Bacteria 4738
272 Ga0501040_0293651 3300049576 Bacteria 1162
273 Ga0501041_0007470 3300049577 Bacteria 6416
274 Ga0501041_0096058 3300049577 Bacteria 1832
275 Ga0501042_0024546 3300049578 Bacteria 4230
276 Ga0501042_0287265 3300049578 Bacteria 1188
277 Ga0501042_0670608 3300049578 Bacteria 754
278 Ga0501043_0058409 3300049579 Bacteria 3028
279 Ga0501043_0132819 3300049579 Bacteria 1951
280 Ga0501043_0827180 3300049579 Bacteria 668
281 Ga0501046_0042857 3300049580 Bacteria 3606
282 Ga0501047_0058158 3300049581 Bacteria 3735
283 Ga0501048_0014629 3300049582 Bacteria 5807
284 Ga0501067_0146819 3300049583 Bacteria 1314
285 Ga0501067_0517632 3300049583 Bacteria 668
286 Ga0501068_0107285 3300049584 Bacteria 1734
287 Ga0501068_0342152 3300049584 Bacteria 961
288 Ga0501069_0534903 3300049585 Bacteria 700
289 Ga0501070_0214064 3300049586 Bacteria 1581
290 Ga0501071_0024854 3300049587 Bacteria 4191
291 Ga0501071_0308915 3300049587 Bacteria 1200
292 Ga0501072_0018130 3300049588 Bacteria 5413
293 Ga0501073_0062788 3300049589 Bacteria 2591
294 Ga0501073_0389278 3300049589 Bacteria 963
295 Ga0501074_0065917 3300049590 Bacteria 2605
296 Ga0501074_0967671 3300049590 Bacteria 599
297 Ga0501075_0009998 3300049591 Bacteria 6652
298 Ga0501076_0002267 3300049592 Bacteria 13155
299 Ga0501077_0043332 3300049593 Bacteria 2860
300 Ga0501079_0012248 3300049741 Bacteria 6545
301 Ga0501079_1655204 3300049741 Bacteria 503
302 Ga0501080_0203838 3300049742 Bacteria 1815
303 Ga0501081_0023859 3300049743 Bacteria 4103
304 Ga0501081_1285586 3300049743 Bacteria 555
305 Ga0501083_0069108 3300049744 Bacteria 2350
306 Ga0501035_0023049 3300049822 Bacteria 5714
307 Ga0501035_0192811 3300049822 Bacteria 1751
308 Ga0501035_0215887 3300049822 Bacteria 1640
309 Ga0501035_1543019 3300049822 Bacteria 505
310 Ga0501044_0010781 3300049823 Bacteria 9918
311 Ga0501044_0126399 3300049823 Bacteria 2554
312 Ga0501045_0028290 3300049824 Bacteria 4042
313 nmdc:mga03683_249725_c1 3300050489 Bacteria 824
314 nmdc:mga03n38_223355_c1 3300050490 Bacteria 984
315 nmdc:mga03n38_8252_c1 3300050490 Bacteria 3729
316 nmdc:mga00v17_474694_c1 3300050491 Bacteria 811
317 nmdc:mga0yw44_133477_c1 3300050492 Bacteria 1609
318 nmdc:mga0yw44_23389_c1 3300050492 Bacteria 3481
319 nmdc:mga06z11_13868_c1 3300050494 Bacteria 3553
320 nmdc:mga06z11_654661_c1 3300050494 Bacteria 639
321 nmdc:mga06z11_697413_c1 3300050494 Bacteria 618
322 nmdc:mga04h51_13095_c1 3300050495 Bacteria 2343
323 nmdc:mga07m45_11426_c1 3300050496 Bacteria 4664
324 Ga0495612_0047087 3300053078 Bacteria 1767
325 Ga0495619_0009330 3300053085 Bacteria 6193
326 Ga0495619_0189084 3300053085 Bacteria 1425
327 Ga0501084_0013964 3300054114 Bacteria 6648
328 Ga0501084_0765728 3300054114 Bacteria 813
329 Ga0501084_1634928 3300054114 Bacteria 538
330 Ga0501082_0009303 3300060353 Bacteria 8469
331 Ga0501082_0015559 3300060353 Bacteria 6550
332 Ga0466962_0183874 3300061719 Bacteria 1019
333 Ga0530510_0006626 3300061734 Bacteria 8076
334 Ga0530510_0126781 3300061734 Bacteria 1877
335 2644080939 2643221613 Bacteria 4622396
336 2644505458 2643221690 Bacteria 4654705
337 2644524743 2643221694 Bacteria 4392972
338 2644607759 2643221711 Bacteria 4865335
339 2644668831 2643221722 Bacteria 4247614
340 2729909306 2728369276 Bacteria 5610032
341 2808871881 2808606365 Bacteria 4301966
342 2812363835 2811994880 Bacteria 4147780
343 2812373240 2811994882 Bacteria 4688362
344 2819426039 2818991318 Bacteria 5266538
345 2819665098 2818991458 Bacteria 4794049
346 2819692813 2818991462 Bacteria 4320267
347 2819727212 2818991469 Bacteria 4644110
348 2887447372 2887443736 Bacteria 4426037
349 2935892435 2935890801 Bacteria 4593001
350 Ga0157370_10030742
351 Ga0006562J51391_1133043
352 Ga0070683_100023914
353 Ga0070683_100515355
354 Ga0068868_100014435
355 Ga0070660_100587863
356 Ga0070691_10076120
357 Ga0070675_100855763
358 Ga0070709_10241840
359 Ga0070714_100599986
360 Ga0070710_10031774
361 Ga0070694_100685524
362 Ga0070694_101154271
363 Ga0070708_100485780
364 Ga0070707_100252874
365 Ga0070698_100548683
366 Ga0070679_100266581
367 Ga0070684_100134271
368 Ga0070684_100159862
369 Ga0070684_100429467
370 Ga0070693_100305039
371 Ga0070704_101028197
372 Ga0070664_100564990
373 Ga0068857_100102153
374 Ga0068857_100436373
375 Ga0068857_100928185
376 Ga0068856_100015936
377 Ga0070702_100352341
378 Ga0068852_102330360
379 Ga0068863_100213209
380 Ga0068860_100251230
381 Ga0081455_10366711
382 Ga0075365_10423641
383 Ga0075368_10001653
384 Ga0075364_10063607
385 Ga0070716_101038741
386 Ga0070712_100280249
387 Ga0075362_10011847
388 Ga0075367_10259647
389 Ga0068871_100087276
390 Ga0068865_101042205
391 Ga0105244_10259137
392 Ga0111539_12490956
393 Ga0105245_10047443
394 Ga0105245_11781810
395 Ga0105243_10239101
396 Ga0105243_10512531
397 Ga0105243_11614316
398 Ga0105243_12145242
399 Ga0105241_11914894
400 Ga0105242_11329941
401 Ga0105248_10178536
402 Ga0105238_10993988
403 Ga0105238_11101886
404 Ga0105238_12476508
405 Ga0105239_10170708
406 Ga0105246_10154873
407 Ga0105246_10400808
408 Ga0105246_10416539
409 Ga0157370_10464445
410 Ga0157369_10130430
411 Ga0157369_11687436
412 Ga0157374_10021805
413 Ga0163162_10107614
414 Ga0163162_11756535
415 Ga0157372_11532825
416 Ga0157372_11613044
417 Ga0157375_10290228
418 Ga0157375_10371369
419 Ga0157375_10497528
420 Ga0157375_10622155
421 Ga0157375_10765599
422 Ga0157375_12247606
423 Ga0163163_10039356
424 Ga0163163_10957065
425 Ga0157379_10015038
426 Ga0157376_10007647
427 Ga0163161_10153649
428 Ga0163161_10286523
429 Ga0206356_10451184
430 Ga0206353_10289601
431 Ga0207692_10527435
432 Ga0207699_10189481
433 Ga0207663_10304104
434 Ga0207652_10227235
435 Ga0207694_10547821
436 Ga0207687_10263608
437 Ga0207700_10386745
438 Ga0207664_10023381
439 Ga0207690_10255331
440 Ga0207709_10169071
441 Ga0207665_10225042
442 Ga0207661_10067569
443 Ga0207679_10374391
444 Ga0207668_10996103
445 Ga0207658_10366777
446 Ga0207677_10279745
447 Ga0207703_10106451
448 Ga0207702_10034589
449 Ga0207702_10331412
450 Ga0207641_11578258
451 Ga0207698_10781119
452 Ga0209813_10004807
453 Ga0268266_10387631
454 Ga0268264_10000280
455 Ga0307408_100771124
456 Ga0307408_101783088
457 Ga0307405_10103327
458 Ga0307405_10587788
459 Ga0307405_10624756
460 Ga0307410_10156095
461 Ga0307410_10337111
462 Ga0307410_11032824
463 Ga0307407_10009640
464 Ga0307412_10134914
465 Ga0307409_100011360
466 Ga0307409_100015481
467 Ga0307409_100660109
468 Ga0307409_100760987
469 Ga0307409_100805658
470 Ga0307416_100076388
471 Ga0307416_100189504
472 Ga0307416_101451663
473 Ga0307411_10122429
474 Ga0307411_10324872
475 Ga0307415_101625799
476 Ga0373931_0592028
477 Ga0373947_1057379
478 Ga0395899_0181739
479 Ga0395900_0043733
480 Ga0395898_0671018
481 Ga0395905_0076412
482 Ga0395901_0139663
483 Ga0395901_0335600
484 Ga0395901_0434057
485 Ga0395901_0785158
486 Ga0439439_0037758
487 Ga0439465_0248872
488 Ga0439465_0275436
489 Ga0451797_0618877
490 Ga0451804_0149241
491 Ga0451843_1362898
492 Ga0439449_0294182
493 Ga0439457_088164
494 Ga0450906_055145
495 Ga0450909_019533
496 Ga0466965_0424084
497 Ga0466966_0150647
498 Ga0466964_0130727
499 Ga0466968_0152335
500 Ga0466968_0216198
501 Ga0466970_0044884
502 Ga0466960_0268633
503 Ga0466958_0211331
504 Ga0466967_0131478
505 Ga0466967_0489999
506 Ga0466967_0808223
507 Ga0466967_1513427
508 Ga0495629_0571255
509 Ga0495641_0161674
510 Ga0495580_0534813
511 Ga0495639_0757476
512 Ga0495645_0358841
513 Ga0495667_0260327
514 Ga0495657_0078527
515 Ga0495657_0393111
516 Ga0495657_0763922
517 Ga0495623_0411399
518 Ga0495600_0220657
519 Ga0495600_0295536
520 Ga0495600_0581184
521 Ga0495581_0292595
522 Ga0495581_0566452
523 Ga0495674_0399429
524 Ga0495680_0206254
525 Ga0495684_1028542
526 Ga0496100_0002424
527 Ga0496101_0023377
528 Ga0496101_0104161
529 Ga0496101_0181654
530 Ga0496101_0460295
531 Ga0496101_1138978
532 Ga0496102_0006948
533 Ga0496102_0030291
534 Ga0496102_0063319
535 Ga0496102_0119282
536 Ga0496102_0176728
537 Ga0496102_0357096
538 Ga0496102_0394289
539 Ga0496102_0606239
540 Ga0496103_0012978
541 Ga0496103_0134622
542 Ga0496103_0148691
543 Ga0496104_0004961
544 Ga0496104_0130335
545 Ga0496104_0180762
546 Ga0496104_0818254
547 Ga0496105_0008841
548 Ga0496105_0047814
549 Ga0496105_0062679
550 Ga0496105_0078872
551 Ga0496105_0331918
552 Ga0496105_0427884
553 Ga0496105_0662165
554 Ga0496105_0823785
555 Ga0496106_0531157
556 Ga0496106_0846610
557 Ga0496107_0056961
558 Ga0496107_0300967
559 Ga0496108_0211552
560 Ga0496108_0325358
561 Ga0496108_0662315
562 Ga0496108_1448018
563 Ga0496109_0155033
564 Ga0496109_1276580
565 Ga0496110_0023757
566 Ga0496110_0076499
567 Ga0496110_0494019
568 Ga0496110_0656872
569 Ga0496110_0831052
570 Ga0496110_1102765
571 Ga0496110_1636864
572 Ga0496111_0094713
573 Ga0496111_0110750
574 Ga0496112_0225816
575 Ga0496112_0270633
576 Ga0496112_0579938
577 Ga0496112_0624922
578 Ga0496113_0022125
579 Ga0496113_0026699
580 Ga0496113_0080245
581 Ga0496113_0146260
582 Ga0496113_0485670
583 Ga0496114_0011307
584 Ga0496114_0052185
585 Ga0496114_0239047
586 Ga0496114_0285227
587 Ga0496114_0331340
588 Ga0496114_0436216
589 Ga0496114_0449106
590 Ga0496114_0450201
591 Ga0496114_1152055
592 Ga0496114_1267905
593 Ga0496115_0126945
594 Ga0496115_0427590
595 Ga0496115_1388058
596 Ga0496117_0215906
597 Ga0496118_0061396
598 Ga0496118_0080713
599 Ga0496119_0458506
600 Ga0496122_0000098
601 Ga0496123_0000341
602 Ga0496124_0000545
603 Ga0496125_0000224
604 Ga0501031_0004909
605 Ga0501031_0101316
606 Ga0501031_0207152
607 Ga0501033_0027970
608 Ga0501034_0044621
609 Ga0501034_0459560
610 Ga0501036_0014161
611 Ga0501036_1277210
612 Ga0501037_0014570
613 Ga0501038_0002173
614 Ga0501038_0009539
615 Ga0501038_0398410
616 Ga0501038_0748452
617 Ga0501039_0040149
618 Ga0501039_0292815
619 Ga0501039_1421035
620 Ga0501040_0017639
621 Ga0501040_0293651
622 Ga0501041_0007470
623 Ga0501041_0096058
624 Ga0501042_0024546
625 Ga0501042_0287265
626 Ga0501042_0670608
627 Ga0501043_0058409
628 Ga0501043_0132819
629 Ga0501043_0827180
630 Ga0501046_0042857
631 Ga0501047_0058158
632 Ga0501048_0014629
633 Ga0501067_0146819
634 Ga0501067_0517632
635 Ga0501068_0107285
636 Ga0501068_0342152
637 Ga0501069_0534903
638 Ga0501070_0214064
639 Ga0501071_0024854
640 Ga0501071_0308915
641 Ga0501072_0018130
642 Ga0501073_0062788
643 Ga0501073_0389278
644 Ga0501074_0065917
645 Ga0501074_0967671
646 Ga0501075_0009998
647 Ga0501076_0002267
648 Ga0501077_0043332
649 Ga0501079_0012248
650 Ga0501079_1655204
651 Ga0501080_0203838
652 Ga0501081_0023859
653 Ga0501081_1285586
654 Ga0501083_0069108
655 Ga0501035_0023049
656 Ga0501035_0192811
657 Ga0501035_0215887
658 Ga0501035_1543019
659 Ga0501044_0010781
660 Ga0501044_0126399
661 Ga0501045_0028290
662 nmdc:mga03683_249725_c1
663 nmdc:mga03n38_223355_c1
664 nmdc:mga03n38_8252_c1
665 nmdc:mga00v17_474694_c1
666 nmdc:mga0yw44_133477_c1
667 nmdc:mga0yw44_23389_c1
668 nmdc:mga06z11_13868_c1
669 nmdc:mga06z11_654661_c1
670 nmdc:mga06z11_697413_c1
671 nmdc:mga04h51_13095_c1
672 nmdc:mga07m45_11426_c1
673 Ga0495612_0047087
674 Ga0495619_0009330
675 Ga0495619_0189084
676 Ga0501084_0013964
677 Ga0501084_0765728
678 Ga0501084_1634928
679 Ga0501082_0009303
680 Ga0501082_0015559
681 Ga0466962_0183874
682 Ga0530510_0006626
683 Ga0530510_0126781
684 2644080939
685 2644505458
686 2644524743
687 2644607759
688 2644668831
689 2729909306
690 2808871881
691 2812363835
692 2812373240
693 2819426039
694 2819665098
695 2819692813
696 2819727212
697 2887447372
698 2935892435

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

2

143

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9647 1 141
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9581 1 141
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9562 1 141
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9534 1 140
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9496 1 141
ID Description Score Start End Superfamily
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9734 1 141 3.50.80.10
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9666 1 141 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9562 1 141 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9534 1 140 3.50.80.10
af_Q5AEI9_1_136_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9497 31 140 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A7Y5TC37-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9885 1 140 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A852Z478-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9881 1 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A3G6J6L1-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9875 2 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A6I4MPF9-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9872 1 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A2U1ZXX3-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9864 1 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Map