F417885

General Info

Members Datasets Scaffolds Average Seq Length
349 260 698 130

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10004920|Ga0105237_100049204
Length 141
Sequence VTNMPTPSQDRKISDPAMNPGDEPYFAAAAEGRLMLKTCAACHETHHYPRSLCPFCWSSNVTWIEANGSGVIYTFSITRRGAGAPYCIAYVTLDEGPTMLTNVVDVDLDSVRIGQRVQVVFRKSEGGVSIPMFTPTLAAQP

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
117 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
156 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
240 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
243 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
244 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
249 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
250 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
251 2619618881 Frankia sp. ACN1ag Isolate Unclassified
252 2619619003 Frankia sp. CpI1-P Isolate Nodule
253 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
254 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
255 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
256 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
257 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
258 8054920844 Frankia tisae Agncl-8 Isolate Nodule
259 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
260 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 1.72
Isolates 3.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.03
Nodule 1.72
Rhizoplane 4.3
Rhizosphere 77.08
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10004920 3300009545 Bacteria 15281
2 Ga0006562J51391_1119847 3300003578 Bacteria 1300
3 Ga0006562J51391_1119848 3300003578 Bacteria 1660
4 Ga0055532_1000109 3300003758 Bacteria 88155
5 Ga0055527_1000067 3300003760 Bacteria 88167
6 Ga0055535_1000111 3300003761 Bacteria 88167
7 Ga0055542_1001824 3300003762 Bacteria 8719
8 Ga0055529_1002926 3300003763 Bacteria 3041
9 Ga0065707_10021906 3300005295 Bacteria 1938
10 Ga0065707_10291157 3300005295 Bacteria 1025
11 Ga0070658_10006091 3300005327 Bacteria 9782
12 Ga0070676_10763522 3300005328 Bacteria 711
13 Ga0070670_100024111 3300005331 Bacteria 5234
14 Ga0070670_100457392 3300005331 Bacteria 1132
15 Ga0070670_101584522 3300005331 Bacteria 602
16 Ga0070677_10240312 3300005333 Bacteria 894
17 Ga0068869_101448922 3300005334 Bacteria 609
18 Ga0070666_10197432 3300005335 Bacteria 1415
19 Ga0070689_100010287 3300005340 Bacteria 6668
20 Ga0070689_100323391 3300005340 Bacteria 1288
21 Ga0070689_100331441 3300005340 Bacteria 1273
22 Ga0070689_101040463 3300005340 Bacteria 730
23 Ga0070668_100536462 3300005347 Bacteria 1017
24 Ga0070675_100020118 3300005354 Bacteria 5326
25 Ga0070675_100931578 3300005354 Bacteria 797
26 Ga0070671_100025560 3300005355 Bacteria 4846
27 Ga0070671_100734753 3300005355 Bacteria 857
28 Ga0070674_100149977 3300005356 Bacteria 1758
29 Ga0070673_100002173 3300005364 Bacteria 11883
30 Ga0070673_100214990 3300005364 Bacteria 1661
31 Ga0070688_100019317 3300005365 Bacteria 3946
32 Ga0070659_100723181 3300005366 Bacteria 862
33 Ga0070709_10902350 3300005434 Bacteria 699
34 Ga0070714_100765978 3300005435 Bacteria 933
35 Ga0070713_100731888 3300005436 Bacteria 945
36 Ga0070713_102120970 3300005436 Bacteria 545
37 Ga0070710_10715324 3300005437 Bacteria 708
38 Ga0070701_11215906 3300005438 Bacteria 535
39 Ga0070711_100483350 3300005439 Bacteria 1018
40 Ga0070711_100847249 3300005439 Bacteria 778
41 Ga0070700_100172459 3300005441 Bacteria 1499
42 Ga0070708_100535494 3300005445 Bacteria 1105
43 Ga0070678_100024537 3300005456 Bacteria 4040
44 Ga0070678_100025730 3300005456 Bacteria 3966
45 Ga0070681_10303786 3300005458 Bacteria 1505
46 Ga0070685_10821248 3300005466 Bacteria 687
47 Ga0070707_100033928 3300005468 Bacteria 4867
48 Ga0070665_100163479 3300005548 Bacteria 2228
49 Ga0070704_100017650 3300005549 Bacteria 4543
50 Ga0068856_101660041 3300005614 Bacteria 652
51 Ga0070702_101017769 3300005615 Bacteria 657
52 Ga0068859_100204657 3300005617 Bacteria 2059
53 Ga0068859_100393498 3300005617 Bacteria 1481
54 Ga0068859_100492741 3300005617 Bacteria 1321
55 Ga0068859_100499348 3300005617 Bacteria 1312
56 Ga0068859_102793352 3300005617 Bacteria 536
57 Ga0068864_100630015 3300005618 Bacteria 1043
58 Ga0068861_101329234 3300005719 Bacteria 700
59 Ga0068861_101476271 3300005719 Bacteria 666
60 Ga0068870_10888177 3300005840 Bacteria 629
61 Ga0068858_101479180 3300005842 Bacteria 670
62 Ga0068858_101710158 3300005842 Bacteria 621
63 Ga0068860_100342662 3300005843 Bacteria 1470
64 Ga0068862_100022910 3300005844 Bacteria 5228
65 Ga0068862_100391851 3300005844 Bacteria 1298
66 Ga0081455_10000714 3300005937 Bacteria 43138
67 Ga0070717_10130845 3300006028 Bacteria 2158
68 Ga0070717_10189053 3300006028 Bacteria 1798
69 Ga0075365_10364759 3300006038 Bacteria 1018
70 Ga0075363_100653379 3300006048 Bacteria 633
71 Ga0075364_10072125 3300006051 Bacteria 2275
72 Ga0075364_10828157 3300006051 Bacteria 631
73 Ga0075432_10072549 3300006058 Bacteria 1238
74 Ga0070716_100460794 3300006173 Bacteria 929
75 Ga0070712_101406908 3300006175 Bacteria 609
76 Ga0075362_10439384 3300006177 Bacteria 662
77 Ga0075367_10882280 3300006178 Bacteria 570
78 Ga0075369_10389489 3300006186 Bacteria 656
79 Ga0075366_10025381 3300006195 Bacteria 3461
80 Ga0075366_10033689 3300006195 Bacteria 3018
81 Ga0097621_101460609 3300006237 Bacteria 648
82 Ga0075370_10000099 3300006353 Bacteria 27215
83 Ga0075370_10110558 3300006353 Bacteria 1596
84 Ga0075433_11799718 3300006852 Bacteria 526
85 Ga0075436_100723257 3300006914 Bacteria 738
86 Ga0097620_100204655 3300006931 Bacteria 2059
87 Ga0097620_100393505 3300006931 Bacteria 1481
88 Ga0097620_100492671 3300006931 Bacteria 1321
89 Ga0097620_100499343 3300006931 Bacteria 1312
90 Ga0097620_102794562 3300006931 Bacteria 536
91 Ga0099826_10064032 3300006948 Bacteria 2372
92 Ga0105240_12426000 3300009093 Bacteria 543
93 Ga0105247_11394629 3300009101 Bacteria 567
94 Ga0114129_10068372 3300009147 Bacteria 4953
95 Ga0114129_11178313 3300009147 Bacteria 955
96 Ga0114129_11295355 3300009147 Bacteria 903
97 Ga0114129_11580447 3300009147 Bacteria 803
98 Ga0105248_10548573 3300009177 Bacteria 1304
99 Ga0105248_10619422 3300009177 Bacteria 1221
100 Ga0105248_11728932 3300009177 Bacteria 709
101 Ga0105249_10141392 3300009553 Bacteria 2308
102 Ga0105249_11003940 3300009553 Bacteria 903
103 Ga0105249_11059357 3300009553 Bacteria 880
104 Ga0105239_10930154 3300010375 Bacteria 998
105 Ga0105239_11782397 3300010375 Unclassified 713
106 Ga0163162_10923941 3300013306 Bacteria 985
107 Ga0163162_12209339 3300013306 Bacteria 632
108 Ga0157375_10923822 3300013308 Bacteria 1016
109 Ga0163163_10594306 3300014325 Bacteria 1170
110 Ga0163163_10770996 3300014325 Bacteria 1025
111 Ga0182008_10000835 3300014497 Bacteria 21479
112 Ga0182008_10264437 3300014497 Bacteria 890
113 Ga0157379_10620388 3300014968 Bacteria 1011
114 Ga0157379_11627470 3300014968 Bacteria 631
115 Ga0157376_12319030 3300014969 Bacteria 576
116 Ga0182006_1000636 3300015261 Bacteria 24903
117 Ga0163161_10248685 3300017792 Bacteria 1385
118 Ga0213873_10084371 3300021358 Bacteria 894
119 Ga0213872_10216276 3300021361 Bacteria 817
120 Ga0228598_1001530 3300024227 Bacteria 5068
121 Ga0209672_100059 3300025228 Bacteria 209692
122 Ga0209147_100072 3300025229 Bacteria 209692
123 Ga0209258_100102 3300025242 Bacteria 209692
124 Ga0209148_1001680 3300025254 Bacteria 9909
125 Ga0209455_1000176 3300025272 Bacteria 107090
126 Ga0209051_1009543 3300025303 Bacteria 4991
127 Ga0207642_10305078 3300025899 Bacteria 924
128 Ga0207699_10832791 3300025906 Bacteria 679
129 Ga0207705_10003561 3300025909 Bacteria 11858
130 Ga0207671_10028362 3300025914 Bacteria 4182
131 Ga0207693_10111830 3300025915 Bacteria 2142
132 Ga0207646_10124179 3300025922 Bacteria 2320
133 Ga0207681_10363181 3300025923 Bacteria 1162
134 Ga0207694_11222941 3300025924 Bacteria 635
135 Ga0207650_11331018 3300025925 Bacteria 611
136 Ga0207659_10260799 3300025926 Bacteria 1410
137 Ga0207700_10043275 3300025928 Bacteria 3307
138 Ga0207644_10012897 3300025931 Bacteria 5556
139 Ga0207690_11420802 3300025932 Bacteria 580
140 Ga0207670_11721316 3300025936 Bacteria 533
141 Ga0207669_10309604 3300025937 Bacteria 1204
142 Ga0207691_10040084 3300025940 Bacteria 4330
143 Ga0207691_10811966 3300025940 Bacteria 786
144 Ga0207711_10616629 3300025941 Bacteria 1012
145 Ga0207711_11319593 3300025941 Bacteria 664
146 Ga0207689_10804717 3300025942 Bacteria 793
147 Ga0207667_10950811 3300025949 Bacteria 849
148 Ga0207651_10006149 3300025960 Bacteria 6245
149 Ga0207651_10682807 3300025960 Bacteria 903
150 Ga0207712_10354118 3300025961 Bacteria 1221
151 Ga0207658_11440949 3300025986 Bacteria 630
152 Ga0207677_11995190 3300026023 Bacteria 539
153 Ga0207703_12318052 3300026035 Bacteria 512
154 Ga0207708_10072369 3300026075 Bacteria 2641
155 Ga0207702_11246485 3300026078 Bacteria 738
156 Ga0207648_10278555 3300026089 Bacteria 1495
157 Ga0207675_100323990 3300026118 Bacteria 1505
158 Ga0207683_10076816 3300026121 Bacteria 2957
159 Ga0209282_1253643 3300027666 Bacteria 775
160 Ga0265357_1000836 3300028023 Bacteria 2039
161 Ga0268265_10094197 3300028380 Bacteria 2401
162 Ga0268265_11014544 3300028380 Bacteria 820
163 Ga0268265_11285513 3300028380 Bacteria 731
164 Ga0268264_10998271 3300028381 Bacteria 843
165 Ga0268264_12249091 3300028381 Bacteria 553
166 Ga0265319_1142746 3300028563 Bacteria 743
167 Ga0265318_10060641 3300028577 Bacteria 1409
168 Ga0265338_10991553 3300028800 Unclassified 569
169 Ga0265338_11227164 3300028800 Unclassified 502
170 Ga0307511_10003838 3300030521 Bacteria 15372
171 Ga0265763_1000860 3300030763 Bacteria 2023
172 Ga0265770_1063864 3300030878 Bacteria 690
173 Ga0265760_10064483 3300031090 Bacteria 1117
174 Ga0265760_10170718 3300031090 Bacteria 722
175 Ga0265320_10042840 3300031240 Bacteria 2242
176 Ga0265329_10252782 3300031242 Bacteria 588
177 Ga0265339_10224045 3300031249 Bacteria 918
178 Ga0265331_10035280 3300031250 Bacteria 2462
179 Ga0265327_10000049 3300031251 Bacteria 268046
180 Ga0265316_10061440 3300031344 Bacteria 2918
181 Ga0265316_10336694 3300031344 Bacteria 1094
182 Ga0265313_10100238 3300031595 Bacteria 1286
183 Ga0265313_10345718 3300031595 Bacteria 590
184 Ga0265342_10033566 3300031712 Bacteria 3154
185 Ga0316576_10165552 3300031727 Bacteria 1668
186 Ga0316578_10016035 3300031728 Bacteria 4046
187 Ga0307507_10101190 3300033179 Bacteria 2411
188 Ga0373936_0027640 3300035113 Bacteria 2225
189 Ga0373939_0225295 3300035114 Bacteria 720
190 Ga0373953_0279816 3300035117 Bacteria 727
191 Ga0373957_0119708 3300035120 Bacteria 1065
192 Ga0373960_0458002 3300035121 Bacteria 501
193 Ga0373943_0157662 3300035170 Bacteria 1234
194 Ga0316574_0000608 3300035398 Bacteria 14892
195 Ga0373931_0327194 3300035691 Bacteria 954
196 Ga0373935_0084233 3300035692 Bacteria 2071
197 Ga0373933_0008646 3300035724 Bacteria 5554
198 Ga0373933_0681725 3300035724 Bacteria 676
199 Ga0316584_0004568 3300036712 Bacteria 9175
200 Ga0373925_0079228 3300037068 Bacteria 2496
201 Ga0436365_0762843 3300039437 Bacteria 2409
202 Ga0436365_1357459 3300039437 Bacteria 978
203 Ga0436360_0097826 3300039438 Bacteria 1360
204 Ga0436360_0306231 3300039438 Bacteria 1885
205 Ga0436360_0367723 3300039438 Bacteria 751
206 Ga0436360_0538192 3300039438 Bacteria 3152
207 Ga0436360_0586267 3300039438 Bacteria 506
208 Ga0436360_0653504 3300039438 Bacteria 7773
209 Ga0436361_0542742 3300039447 Bacteria 2455
210 Ga0436363_0112385 3300039450 Bacteria 1694
211 Ga0436363_0714144 3300039450 Bacteria 859
212 Ga0436363_0901956 3300039450 Bacteria 1033
213 Ga0436363_1078302 3300039450 Bacteria 781
214 Ga0436363_1632667 3300039450 Unclassified 535
215 Ga0436362_0102083 3300039453 Bacteria 1632
216 Ga0436362_0378424 3300039453 Bacteria 1189
217 Ga0439461_0111142 3300041410 Bacteria 676
218 Ga0451800_0182670 3300041459 Bacteria 540
219 Ga0439441_054286 3300042001 Bacteria 832
220 Ga0439435_0180407 3300042436 Bacteria 689
221 Ga0451577_1303310 3300042876 Unclassified 646
222 Ga0466966_0080744 3300044684 Bacteria 2025
223 Ga0466963_0721532 3300044694 Bacteria 703
224 Ga0466957_0669955 3300044842 Bacteria 730
225 Ga0466967_1237067 3300045976 Bacteria 744
226 Ga0495592_0227211 3300046454 Bacteria 1244
227 Ga0495651_0038965 3300046462 Bacteria 3700
228 Ga0495653_0004302 3300046463 Bacteria 11524
229 Ga0495653_0154386 3300046463 Bacteria 1601
230 Ga0495580_0388315 3300046472 Bacteria 942
231 Ga0495582_0123726 3300046473 Bacteria 1459
232 Ga0495605_0192384 3300046474 Bacteria 892
233 Ga0495639_0359241 3300046475 Bacteria 732
234 Ga0495662_0078016 3300046476 Bacteria 1609
235 Ga0495664_0190706 3300046477 Bacteria 1242
236 Ga0495583_0212221 3300046506 Bacteria 784
237 Ga0495606_0001878 3300046507 Bacteria 26325
238 Ga0495618_0122914 3300046514 Bacteria 1662
239 Ga0495618_0720957 3300046514 Bacteria 585
240 Ga0495628_0052732 3300046516 Bacteria 3212
241 Ga0495630_0290570 3300046517 Bacteria 1249
242 Ga0495666_0097899 3300046526 Bacteria 1383
243 Ga0495652_0325204 3300046529 Bacteria 1109
244 Ga0495654_0100060 3300046530 Bacteria 1335
245 Ga0495640_0104218 3300046533 Bacteria 1859
246 Ga0495587_0000355 3300046536 Bacteria 32860
247 Ga0495587_0078281 3300046536 Bacteria 1918
248 Ga0495645_0068240 3300046543 Bacteria 2567
249 Ga0495645_0089989 3300046543 Bacteria 2194
250 Ga0495645_0486667 3300046543 Bacteria 773
251 Ga0495656_0029576 3300046615 Bacteria 2206
252 Ga0495625_0405046 3300046660 Bacteria 851
253 Ga0495635_0205673 3300046663 Bacteria 1334
254 Ga0495659_0246164 3300046664 Bacteria 744
255 Ga0495657_0255773 3300046675 Bacteria 1053
256 Ga0495599_0046855 3300046678 Bacteria 2710
257 Ga0495623_0218217 3300046679 Bacteria 1088
258 Ga0495646_0645433 3300046680 Bacteria 535
259 Ga0495647_0255038 3300046681 Bacteria 782
260 Ga0495658_0153447 3300046683 Bacteria 1416
261 Ga0495613_0019721 3300046689 Bacteria 5026
262 Ga0495624_0101688 3300046690 Bacteria 1770
263 Ga0495671_0000180 3300046692 Bacteria 56267
264 Ga0495600_0011402 3300046809 Bacteria 5536
265 Ga0495581_0313173 3300047315 Bacteria 917
266 Ga0495604_0042988 3300047317 Bacteria 3539
267 Ga0495604_0453803 3300047317 Bacteria 837
268 Ga0495674_0000241 3300047319 Bacteria 46316
269 Ga0495674_0860249 3300047319 Bacteria 702
270 Ga0495672_0019839 3300047320 Bacteria 4422
271 Ga0495676_0441283 3300047321 Bacteria 859
272 Ga0495680_0139026 3300047322 Bacteria 1778
273 Ga0495683_0002146 3300047323 Bacteria 12138
274 Ga0495675_0020518 3300047444 Bacteria 4204
275 Ga0495675_0067789 3300047444 Bacteria 2255
276 Ga0495593_0064466 3300047673 Bacteria 1913
277 Ga0495602_0000766 3300048088 Bacteria 30602
278 Ga0495602_0028300 3300048088 Bacteria 5366
279 Ga0495602_0393424 3300048088 Bacteria 990
280 Ga0496100_0196575 3300048903 Bacteria 1467
281 Ga0496101_0293191 3300048904 Bacteria 1273
282 Ga0496102_0037443 3300048905 Bacteria 4376
283 Ga0496102_0917767 3300048905 Bacteria 797
284 Ga0496104_0109826 3300048907 Bacteria 2643
285 Ga0496106_0073150 3300048909 Bacteria 2622
286 Ga0496108_0210205 3300048911 Bacteria 1689
287 Ga0496109_0080888 3300048912 Bacteria 2994
288 Ga0496111_0429950 3300048914 Bacteria 975
289 Ga0496112_0055444 3300048915 Bacteria 3897
290 Ga0496112_0091489 3300048915 Bacteria 3011
291 Ga0496112_1099499 3300048915 Bacteria 713
292 Ga0496114_0938873 3300048917 Bacteria 747
293 Ga0496115_0089512 3300048918 Bacteria 2514
294 Ga0496125_0011982 3300048928 Bacteria 8635
295 Ga0501034_0000891 3300049571 Bacteria 43738
296 Ga0501037_0119786 3300049573 Bacteria 1893
297 Ga0501046_0055859 3300049580 Bacteria 3101
298 Ga0501070_0511354 3300049586 Bacteria 964
299 Ga0501070_1429253 3300049586 Bacteria 525
300 Ga0501073_0524948 3300049589 Bacteria 818
301 Ga0501080_0497061 3300049742 Bacteria 1090
302 Ga0501035_1221467 3300049822 Bacteria 582
303 Ga0501044_0058411 3300049823 Bacteria 3956
304 Ga0501044_0372545 3300049823 Bacteria 1344
305 Ga0501044_0594012 3300049823 Bacteria 1001
306 nmdc:mga03683_300783_c1 3300050489 Bacteria 752
307 nmdc:mga00v17_569392_c1 3300050491 Bacteria 732
308 nmdc:mga00v17_622980_c1 3300050491 Bacteria 695
309 nmdc:mga0k408_289492_c1 3300050493 Bacteria 978
310 nmdc:mga0k408_82520_c1 3300050493 Bacteria 1884
311 nmdc:mga07m45_146787_c1 3300050496 Bacteria 1367
312 nmdc:mga07m45_230460_c1 3300050496 Bacteria 1078
313 nmdc:mga07m45_25990_c1 3300050496 Bacteria 3216
314 nmdc:mga07m45_481845_c1 3300050496 Bacteria 719
315 nmdc:mga05p37_120295_c1 3300050507 Bacteria 3226
316 nmdc:mga05p37_1807250_c1 3300050507 Bacteria 589
317 nmdc:mga05p37_55887_c1 3300050507 Bacteria 4859
318 nmdc:mga08x19_692184_c1 3300050514 Bacteria 723
319 nmdc:mga0sz30_39511_c1 3300050516 Bacteria 1980
320 Ga0495601_0211665 3300053077 Bacteria 1266
321 Ga0495601_0929928 3300053077 Bacteria 548
322 Ga0495612_0316532 3300053078 Bacteria 701
323 Ga0495595_0096427 3300053084 Bacteria 1423
324 Ga0495619_0136632 3300053085 Bacteria 1686
325 Ga0495619_0171668 3300053085 Bacteria 1499
326 Ga0500644_0011525 3300053088 Bacteria 2418
327 Ga0500583_0111529 3300053092 Bacteria 1347
328 Ga0500595_050491 3300053119 Bacteria 1292
329 Ga0500618_017400 3300053125 Bacteria 1788
330 Ga0500628_204252 3300053129 Bacteria 571
331 Ga0500655_013761 3300053133 Bacteria 1478
332 Ga0500568_0007655 3300053139 Bacteria 5278
333 Ga0500568_0014104 3300053139 Bacteria 3621
334 Ga0500568_0063335 3300053139 Bacteria 1427
335 Ga0500604_0000353 3300053151 Bacteria 12688
336 Ga0501082_0126570 3300060353 Bacteria 2216
337 2511170841 2510917026 Bacteria 7046020
338 2515687810 2515154123 Bacteria 6387382
339 2579856021 2579778521 Bacteria 7624758
340 2619856984 2619618881 Bacteria 7521104
341 2620352683 2619619003 Bacteria 7619552
342 2858698860 2858688981 Bacteria 8184122
343 2881928877 2881927736 Bacteria 3993927
344 2900639817 2900634093 Bacteria 10263517
345 2929146641 2929144301 Bacteria 6622272
346 2945966363 2945961074 Bacteria 7342064
347 8054922412 8054920844 Bacteria 7068637
348 8055225993 8055225921 Bacteria 3341787
349 8055307948 8055301274 Bacteria 8587385
350 Ga0105237_10004920
351 Ga0006562J51391_1119847
352 Ga0006562J51391_1119848
353 Ga0055532_1000109
354 Ga0055527_1000067
355 Ga0055535_1000111
356 Ga0055542_1001824
357 Ga0055529_1002926
358 Ga0065707_10021906
359 Ga0065707_10291157
360 Ga0070658_10006091
361 Ga0070676_10763522
362 Ga0070670_100024111
363 Ga0070670_100457392
364 Ga0070670_101584522
365 Ga0070677_10240312
366 Ga0068869_101448922
367 Ga0070666_10197432
368 Ga0070689_100010287
369 Ga0070689_100323391
370 Ga0070689_100331441
371 Ga0070689_101040463
372 Ga0070668_100536462
373 Ga0070675_100020118
374 Ga0070675_100931578
375 Ga0070671_100025560
376 Ga0070671_100734753
377 Ga0070674_100149977
378 Ga0070673_100002173
379 Ga0070673_100214990
380 Ga0070688_100019317
381 Ga0070659_100723181
382 Ga0070709_10902350
383 Ga0070714_100765978
384 Ga0070713_100731888
385 Ga0070713_102120970
386 Ga0070710_10715324
387 Ga0070701_11215906
388 Ga0070711_100483350
389 Ga0070711_100847249
390 Ga0070700_100172459
391 Ga0070708_100535494
392 Ga0070678_100024537
393 Ga0070678_100025730
394 Ga0070681_10303786
395 Ga0070685_10821248
396 Ga0070707_100033928
397 Ga0070665_100163479
398 Ga0070704_100017650
399 Ga0068856_101660041
400 Ga0070702_101017769
401 Ga0068859_100204657
402 Ga0068859_100393498
403 Ga0068859_100492741
404 Ga0068859_100499348
405 Ga0068859_102793352
406 Ga0068864_100630015
407 Ga0068861_101329234
408 Ga0068861_101476271
409 Ga0068870_10888177
410 Ga0068858_101479180
411 Ga0068858_101710158
412 Ga0068860_100342662
413 Ga0068862_100022910
414 Ga0068862_100391851
415 Ga0081455_10000714
416 Ga0070717_10130845
417 Ga0070717_10189053
418 Ga0075365_10364759
419 Ga0075363_100653379
420 Ga0075364_10072125
421 Ga0075364_10828157
422 Ga0075432_10072549
423 Ga0070716_100460794
424 Ga0070712_101406908
425 Ga0075362_10439384
426 Ga0075367_10882280
427 Ga0075369_10389489
428 Ga0075366_10025381
429 Ga0075366_10033689
430 Ga0097621_101460609
431 Ga0075370_10000099
432 Ga0075370_10110558
433 Ga0075433_11799718
434 Ga0075436_100723257
435 Ga0097620_100204655
436 Ga0097620_100393505
437 Ga0097620_100492671
438 Ga0097620_100499343
439 Ga0097620_102794562
440 Ga0099826_10064032
441 Ga0105240_12426000
442 Ga0105247_11394629
443 Ga0114129_10068372
444 Ga0114129_11178313
445 Ga0114129_11295355
446 Ga0114129_11580447
447 Ga0105248_10548573
448 Ga0105248_10619422
449 Ga0105248_11728932
450 Ga0105249_10141392
451 Ga0105249_11003940
452 Ga0105249_11059357
453 Ga0105239_10930154
454 Ga0105239_11782397
455 Ga0163162_10923941
456 Ga0163162_12209339
457 Ga0157375_10923822
458 Ga0163163_10594306
459 Ga0163163_10770996
460 Ga0182008_10000835
461 Ga0182008_10264437
462 Ga0157379_10620388
463 Ga0157379_11627470
464 Ga0157376_12319030
465 Ga0182006_1000636
466 Ga0163161_10248685
467 Ga0213873_10084371
468 Ga0213872_10216276
469 Ga0228598_1001530
470 Ga0209672_100059
471 Ga0209147_100072
472 Ga0209258_100102
473 Ga0209148_1001680
474 Ga0209455_1000176
475 Ga0209051_1009543
476 Ga0207642_10305078
477 Ga0207699_10832791
478 Ga0207705_10003561
479 Ga0207671_10028362
480 Ga0207693_10111830
481 Ga0207646_10124179
482 Ga0207681_10363181
483 Ga0207694_11222941
484 Ga0207650_11331018
485 Ga0207659_10260799
486 Ga0207700_10043275
487 Ga0207644_10012897
488 Ga0207690_11420802
489 Ga0207670_11721316
490 Ga0207669_10309604
491 Ga0207691_10040084
492 Ga0207691_10811966
493 Ga0207711_10616629
494 Ga0207711_11319593
495 Ga0207689_10804717
496 Ga0207667_10950811
497 Ga0207651_10006149
498 Ga0207651_10682807
499 Ga0207712_10354118
500 Ga0207658_11440949
501 Ga0207677_11995190
502 Ga0207703_12318052
503 Ga0207708_10072369
504 Ga0207702_11246485
505 Ga0207648_10278555
506 Ga0207675_100323990
507 Ga0207683_10076816
508 Ga0209282_1253643
509 Ga0265357_1000836
510 Ga0268265_10094197
511 Ga0268265_11014544
512 Ga0268265_11285513
513 Ga0268264_10998271
514 Ga0268264_12249091
515 Ga0265319_1142746
516 Ga0265318_10060641
517 Ga0265338_10991553
518 Ga0265338_11227164
519 Ga0307511_10003838
520 Ga0265763_1000860
521 Ga0265770_1063864
522 Ga0265760_10064483
523 Ga0265760_10170718
524 Ga0265320_10042840
525 Ga0265329_10252782
526 Ga0265339_10224045
527 Ga0265331_10035280
528 Ga0265327_10000049
529 Ga0265316_10061440
530 Ga0265316_10336694
531 Ga0265313_10100238
532 Ga0265313_10345718
533 Ga0265342_10033566
534 Ga0316576_10165552
535 Ga0316578_10016035
536 Ga0307507_10101190
537 Ga0373936_0027640
538 Ga0373939_0225295
539 Ga0373953_0279816
540 Ga0373957_0119708
541 Ga0373960_0458002
542 Ga0373943_0157662
543 Ga0316574_0000608
544 Ga0373931_0327194
545 Ga0373935_0084233
546 Ga0373933_0008646
547 Ga0373933_0681725
548 Ga0316584_0004568
549 Ga0373925_0079228
550 Ga0436365_0762843
551 Ga0436365_1357459
552 Ga0436360_0097826
553 Ga0436360_0306231
554 Ga0436360_0367723
555 Ga0436360_0538192
556 Ga0436360_0586267
557 Ga0436360_0653504
558 Ga0436361_0542742
559 Ga0436363_0112385
560 Ga0436363_0714144
561 Ga0436363_0901956
562 Ga0436363_1078302
563 Ga0436363_1632667
564 Ga0436362_0102083
565 Ga0436362_0378424
566 Ga0439461_0111142
567 Ga0451800_0182670
568 Ga0439441_054286
569 Ga0439435_0180407
570 Ga0451577_1303310
571 Ga0466966_0080744
572 Ga0466963_0721532
573 Ga0466957_0669955
574 Ga0466967_1237067
575 Ga0495592_0227211
576 Ga0495651_0038965
577 Ga0495653_0004302
578 Ga0495653_0154386
579 Ga0495580_0388315
580 Ga0495582_0123726
581 Ga0495605_0192384
582 Ga0495639_0359241
583 Ga0495662_0078016
584 Ga0495664_0190706
585 Ga0495583_0212221
586 Ga0495606_0001878
587 Ga0495618_0122914
588 Ga0495618_0720957
589 Ga0495628_0052732
590 Ga0495630_0290570
591 Ga0495666_0097899
592 Ga0495652_0325204
593 Ga0495654_0100060
594 Ga0495640_0104218
595 Ga0495587_0000355
596 Ga0495587_0078281
597 Ga0495645_0068240
598 Ga0495645_0089989
599 Ga0495645_0486667
600 Ga0495656_0029576
601 Ga0495625_0405046
602 Ga0495635_0205673
603 Ga0495659_0246164
604 Ga0495657_0255773
605 Ga0495599_0046855
606 Ga0495623_0218217
607 Ga0495646_0645433
608 Ga0495647_0255038
609 Ga0495658_0153447
610 Ga0495613_0019721
611 Ga0495624_0101688
612 Ga0495671_0000180
613 Ga0495600_0011402
614 Ga0495581_0313173
615 Ga0495604_0042988
616 Ga0495604_0453803
617 Ga0495674_0000241
618 Ga0495674_0860249
619 Ga0495672_0019839
620 Ga0495676_0441283
621 Ga0495680_0139026
622 Ga0495683_0002146
623 Ga0495675_0020518
624 Ga0495675_0067789
625 Ga0495593_0064466
626 Ga0495602_0000766
627 Ga0495602_0028300
628 Ga0495602_0393424
629 Ga0496100_0196575
630 Ga0496101_0293191
631 Ga0496102_0037443
632 Ga0496102_0917767
633 Ga0496104_0109826
634 Ga0496106_0073150
635 Ga0496108_0210205
636 Ga0496109_0080888
637 Ga0496111_0429950
638 Ga0496112_0055444
639 Ga0496112_0091489
640 Ga0496112_1099499
641 Ga0496114_0938873
642 Ga0496115_0089512
643 Ga0496125_0011982
644 Ga0501034_0000891
645 Ga0501037_0119786
646 Ga0501046_0055859
647 Ga0501070_0511354
648 Ga0501070_1429253
649 Ga0501073_0524948
650 Ga0501080_0497061
651 Ga0501035_1221467
652 Ga0501044_0058411
653 Ga0501044_0372545
654 Ga0501044_0594012
655 nmdc:mga03683_300783_c1
656 nmdc:mga00v17_569392_c1
657 nmdc:mga00v17_622980_c1
658 nmdc:mga0k408_289492_c1
659 nmdc:mga0k408_82520_c1
660 nmdc:mga07m45_146787_c1
661 nmdc:mga07m45_230460_c1
662 nmdc:mga07m45_25990_c1
663 nmdc:mga07m45_481845_c1
664 nmdc:mga05p37_120295_c1
665 nmdc:mga05p37_1807250_c1
666 nmdc:mga05p37_55887_c1
667 nmdc:mga08x19_692184_c1
668 nmdc:mga0sz30_39511_c1
669 Ga0495601_0211665
670 Ga0495601_0929928
671 Ga0495612_0316532
672 Ga0495595_0096427
673 Ga0495619_0136632
674 Ga0495619_0171668
675 Ga0500644_0011525
676 Ga0500583_0111529
677 Ga0500595_050491
678 Ga0500618_017400
679 Ga0500628_204252
680 Ga0500655_013761
681 Ga0500568_0007655
682 Ga0500568_0014104
683 Ga0500568_0063335
684 Ga0500604_0000353
685 Ga0501082_0126570
686 2511170841
687 2515687810
688 2579856021
689 2619856984
690 2620352683
691 2858698860
692 2881928877
693 2900639817
694 2929146641
695 2945966363
696 8054922412
697 8055225993
698 8055307948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

63

122

0.98

PF12172

DUF35_N

Rubredoxin-like zinc ribbon domain (DUF35_N)

26

62

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.927 20 134
6ok1-assembly1.cif.gz_D ltp2-chsh2(duf35) aldolase 0.9022 12 132
8hku-assembly1.cif.gz_L40E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.893 33 61
8ofb-assembly1.cif.gz_A crystal structure of t. maritima reverse gyrase with a minimal latch, hexagonal form 0.8772 33 62
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.8749 20 134
ID Description Score Start End Superfamily
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.8093 16 62 6.10.30.10
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7962 67 99 2.30.30.30
5j3bB01 Mainly Beta;Roll;SH3 type barrels.; 0.724 65 104 2.30.30.30
2yvmA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7204 64 100 3.90.79.10
af_A0A2R8Q6D0_2_337_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7064 114 135 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7H4PUS4-F1-model_v4 Zn-ribbon domain-containing OB-fold protein 0.9777 1 134
AF-A0A6P1IYQ2-F1-model_v4 DNA-binding protein 0.9721 17 135
AF-A0A807E4E2-F1-model_v4 deleted 0.9718 17 134
AF-A0A4Q3T9D0-F1-model_v4 Zn-ribbon domain-containing OB-fold protein 0.9713 26 133
AF-F8GUX4-F1-model_v4 DUF35 domain-containing protein 0.9683 34 133

Map