F417878

General Info

Members Datasets Scaffolds Average Seq Length
349 230 698 420

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10000082|Ga0114129_1000008234
Length 490
Sequence VRETQNDQASAHLRRAGIAASLADKRRNQPRGGSVEINTGNTAWLLASSALVLLMTPGLAFFYGGLNRSKGVLNMMLMSFSCIGLVSVLWLVYGFSLAFGTNDNASVNDFIGSFTQYLGNKTFVEELWLGADAEGNAITGIPTYVVLAFQMMFAIITVALISGAISDRAKFGGWLLFAAGWFTLVYVPVAHWIWGGGFIFSDIHALDFAGGTAVHINAILGRRIGWPRDSFKPHNVPFVALGAGLLWFGWFGFNAGSEITTDGVTAIAFVNTQVATAAALMGWIVVEWLRDGKPTLVGASSGAVAGLVAITPCCGFIEPWAAVLVGLVAGAVCALAVSIKYRLGYDDSLDVVAVHFVGGWIGSLSIGLFASTAANSLIVDTLGASEGLFSGGGGTQLGRQALASGIVSIYSFGIALGIGLLIKYTVGFRAKADAEVDGIDVAEHAETAYDFSPASGGGRAAXXXAFALAGIGAQAAPPVPDGQEHAPVAG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
84 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
203 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2501939600 Micromonospora sp. L5 Isolate Unclassified
213 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
214 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
215 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
216 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
217 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
218 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
219 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
220 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
221 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
222 2858868258 Micromonospora sp. MH33 Isolate Unclassified
223 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
224 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
225 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
226 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
227 2902582711 Micromonospora sp. AP08 Isolate Unclassified
228 649633069 Micromonospora sp. L5 Isolate Unclassified
229 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
230 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 0.86
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 0.57
Rhizoplane 5.16
Rhizosphere 82.52
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10000082 3300009147 Bacteria 88174
2 JGI24738J21930_10003066 3300002075 Bacteria 4271
3 Ga0070658_10002468 3300005327 Bacteria 15449
4 Ga0070683_100078340 3300005329 Bacteria 3091
5 Ga0070682_100090440 3300005337 Bacteria 2001
6 Ga0070660_100154638 3300005339 Bacteria 1846
7 Ga0070661_100063531 3300005344 Bacteria 2712
8 Ga0070668_100003271 3300005347 Bacteria 11947
9 Ga0070668_100131238 3300005347 Bacteria 2011
10 Ga0070668_100151132 3300005347 Bacteria 1878
11 Ga0070709_10004986 3300005434 Bacteria 7172
12 Ga0070713_100047242 3300005436 Bacteria 3537
13 Ga0070694_100055245 3300005444 Bacteria 2693
14 Ga0070708_100081997 3300005445 Bacteria 2921
15 Ga0070706_100016959 3300005467 Bacteria 6728
16 Ga0070706_100137399 3300005467 Bacteria 2281
17 Ga0070707_100026792 3300005468 Bacteria 5476
18 Ga0070707_100092964 3300005468 Bacteria 2920
19 Ga0070698_100013403 3300005471 Bacteria 8676
20 Ga0070698_100103289 3300005471 Bacteria 2820
21 Ga0070699_100008150 3300005518 Bacteria 9094
22 Ga0070699_100107978 3300005518 Bacteria 2442
23 Ga0070679_100040693 3300005530 Bacteria 4624
24 Ga0070686_100038353 3300005544 Bacteria 2978
25 Ga0070665_100027155 3300005548 Bacteria 5765
26 Ga0070704_100029468 3300005549 Bacteria 3665
27 Ga0068857_100180028 3300005577 Bacteria 1924
28 Ga0068857_100213074 3300005577 Bacteria 1763
29 Ga0068852_100276876 3300005616 Bacteria 1616
30 Ga0068859_100071570 3300005617 Bacteria 3503
31 Ga0068859_100300557 3300005617 Bacteria 1698
32 Ga0068864_100011149 3300005618 Bacteria 7430
33 Ga0068864_100052454 3300005618 Bacteria 3515
34 Ga0068861_100075356 3300005719 Bacteria 2626
35 Ga0068863_100008837 3300005841 Bacteria 9839
36 Ga0068863_100019495 3300005841 Bacteria 6489
37 Ga0068858_100032005 3300005842 Bacteria 4885
38 Ga0068860_100022214 3300005843 Bacteria 6141
39 Ga0068860_100279906 3300005843 Bacteria 1630
40 Ga0068862_100077048 3300005844 Bacteria 2887
41 Ga0081455_10011521 3300005937 Bacteria 8880
42 Ga0081455_10039799 3300005937 Bacteria 4151
43 Ga0081455_10091518 3300005937 Bacteria 2463
44 Ga0081540_1001016 3300005983 Bacteria 25169
45 Ga0081540_1005748 3300005983 Bacteria 9187
46 Ga0081540_1029641 3300005983 Bacteria 3044
47 Ga0081539_10007196 3300005985 Bacteria 10252
48 Ga0081539_10009561 3300005985 Bacteria 8073
49 Ga0070716_100002186 3300006173 Bacteria 9001
50 Ga0070712_100136651 3300006175 Bacteria 1865
51 Ga0075428_100000650 3300006844 Bacteria 35770
52 Ga0075428_100000717 3300006844 Bacteria 34354
53 Ga0075428_100021175 3300006844 Bacteria 7200
54 Ga0075428_100028984 3300006844 Bacteria 6126
55 Ga0075428_100095818 3300006844 Bacteria 3235
56 Ga0075428_100101055 3300006844 Bacteria 3144
57 Ga0075428_100318914 3300006844 Bacteria 1670
58 Ga0075430_100001505 3300006846 Bacteria 19030
59 Ga0075431_100001109 3300006847 Bacteria 24130
60 Ga0075431_100012151 3300006847 Bacteria 8686
61 Ga0075431_100083328 3300006847 Bacteria 3301
62 Ga0075431_100111227 3300006847 Bacteria 2827
63 Ga0075433_10055832 3300006852 Bacteria 3448
64 Ga0075434_100105546 3300006871 Bacteria 2827
65 Ga0075429_100008800 3300006880 Bacteria 8779
66 Ga0075429_100010207 3300006880 Bacteria 8132
67 Ga0068865_100087561 3300006881 Bacteria 2251
68 Ga0097620_100071570 3300006931 Bacteria 3503
69 Ga0097620_100300558 3300006931 Bacteria 1698
70 Ga0114129_10014688 3300009147 Bacteria 11158
71 Ga0114129_10054002 3300009147 Bacteria 5634
72 Ga0114129_10149799 3300009147 Bacteria 3193
73 Ga0114129_10254097 3300009147 Bacteria 2358
74 Ga0114129_10499040 3300009147 Bacteria 1590
75 Ga0105248_10023153 3300009177 Bacteria 6899
76 Ga0105248_10146395 3300009177 Bacteria 2665
77 Ga0105237_10254153 3300009545 Bacteria 1760
78 Ga0105238_10089857 3300009551 Bacteria 3059
79 Ga0157369_10217259 3300013105 Bacteria 2002
80 Ga0157378_10168405 3300013297 Bacteria 2053
81 Ga0157372_10032424 3300013307 Bacteria 5729
82 Ga0157375_10071836 3300013308 Bacteria 3475
83 Ga0163163_10005779 3300014325 Bacteria 10749
84 Ga0163163_10197867 3300014325 Bacteria 2058
85 Ga0157379_10084927 3300014968 Bacteria 2837
86 Ga0157376_10006876 3300014969 Bacteria 8055
87 Ga0157376_10216847 3300014969 Bacteria 1770
88 Ga0206356_10738473 3300020070 Bacteria 2399
89 Ga0207699_10005527 3300025906 Bacteria 6060
90 Ga0207684_10037795 3300025910 Bacteria 4096
91 Ga0207707_10014387 3300025912 Bacteria 6892
92 Ga0207693_10037709 3300025915 Bacteria 3809
93 Ga0207693_10067853 3300025915 Bacteria 2792
94 Ga0207663_10036369 3300025916 Bacteria 2962
95 Ga0207660_10042355 3300025917 Bacteria 3195
96 Ga0207652_10056899 3300025921 Bacteria 3367
97 Ga0207646_10044710 3300025922 Bacteria 3975
98 Ga0207646_10056002 3300025922 Bacteria 3525
99 Ga0207700_10000001 3300025928 Bacteria 1122509
100 Ga0207700_10100348 3300025928 Bacteria 2307
101 Ga0207664_10061361 3300025929 Bacteria 2999
102 Ga0207665_10011043 3300025939 Bacteria 5927
103 Ga0207711_10009684 3300025941 Bacteria 8027
104 Ga0207661_10001620 3300025944 Bacteria 15317
105 Ga0207668_10003375 3300025972 Bacteria 9357
106 Ga0207668_10028182 3300025972 Bacteria 3669
107 Ga0207668_10112923 3300025972 Bacteria 2042
108 Ga0207703_10092754 3300026035 Bacteria 2542
109 Ga0207641_10006045 3300026088 Bacteria 10256
110 Ga0207641_10041986 3300026088 Bacteria 3835
111 Ga0207648_10222947 3300026089 Bacteria 1676
112 Ga0207676_10050127 3300026095 Bacteria 3253
113 Ga0207674_10029816 3300026116 Bacteria 5740
114 Ga0207674_10050383 3300026116 Bacteria 4254
115 Ga0207674_10152172 3300026116 Bacteria 2270
116 Ga0207675_100128935 3300026118 Bacteria 2398
117 Ga0209998_10005918 3300027717 Bacteria 2544
118 Ga0265356_1000016 3300028017 Bacteria 27396
119 Ga0268266_10005114 3300028379 Bacteria 12359
120 Ga0268266_10116523 3300028379 Bacteria 2373
121 Ga0268266_10304460 3300028379 Bacteria 1488
122 Ga0268264_10009964 3300028381 Bacteria 7869
123 Ga0268264_10205345 3300028381 Bacteria 1805
124 Ga0265319_1029808 3300028563 Bacteria 1913
125 Ga0265318_10000062 3300028577 Bacteria 107081
126 Ga0307517_10044559 3300028786 Bacteria 4689
127 Ga0307515_10000045 3300028794 Bacteria 301029
128 Ga0307515_10080208 3300028794 Bacteria 4260
129 Ga0307515_10084772 3300028794 Bacteria 4064
130 Ga0307515_10092180 3300028794 Bacteria 3774
131 Ga0265338_10009542 3300028800 Bacteria 11548
132 Ga0265338_10012202 3300028800 Bacteria 9814
133 Ga0265338_10039444 3300028800 Bacteria 4453
134 Ga0307512_10016438 3300030522 Bacteria 6830
135 Ga0307512_10072901 3300030522 Bacteria 2535
136 Ga0265760_10004342 3300031090 Bacteria 4068
137 Ga0265332_10028455 3300031238 Bacteria 2446
138 Ga0265325_10010810 3300031241 Bacteria 5266
139 Ga0265316_10118302 3300031344 Bacteria 2002
140 Ga0307513_10002212 3300031456 Bacteria 27184
141 Ga0307513_10010848 3300031456 Bacteria 11381
142 Ga0307513_10017935 3300031456 Bacteria 8474
143 Ga0307513_10080749 3300031456 Bacteria 3353
144 Ga0307509_10014918 3300031507 Bacteria 9103
145 Ga0307408_100078352 3300031548 Bacteria 2463
146 Ga0307508_10009661 3300031616 Bacteria 8857
147 Ga0307508_10063244 3300031616 Bacteria 3266
148 Ga0265342_10098326 3300031712 Bacteria 1670
149 Ga0307516_10001714 3300031730 Bacteria 30119
150 Ga0307516_10027001 3300031730 Bacteria 5826
151 Ga0307516_10043898 3300031730 Bacteria 4427
152 Ga0307516_10202624 3300031730 Bacteria 1703
153 Ga0307516_10238501 3300031730 Bacteria 1518
154 Ga0307413_10005154 3300031824 Bacteria 5793
155 Ga0307410_10003872 3300031852 Bacteria 7613
156 Ga0307406_10004191 3300031901 Bacteria 7847
157 Ga0307406_10053999 3300031901 Bacteria 2562
158 Ga0307407_10022983 3300031903 Bacteria 3246
159 Ga0307409_100001007 3300031995 Bacteria 13200
160 Ga0307415_100000190 3300032126 Bacteria 27293
161 Ga0307415_100043669 3300032126 Bacteria 2992
162 Ga0307415_100074058 3300032126 Bacteria 2405
163 Ga0316583_10013705 3300032133 Unclassified 2926
164 Ga0316588_1009901 3300033528 Bacteria 1997
165 Ga0373944_0024704 3300035089 Bacteria 1764
166 Ga0373953_0031311 3300035117 Bacteria 2068
167 Ga0373956_0041454 3300035119 Bacteria 2044
168 Ga0373943_0002025 3300035170 Bacteria 9189
169 Ga0373943_0080020 3300035170 Bacteria 1674
170 Ga0373946_0035460 3300035171 Bacteria 2019
171 Ga0373955_0075603 3300035172 Bacteria 1893
172 Ga0373942_0001416 3300035207 Bacteria 6191
173 Ga0373962_0021659 3300035242 Bacteria 1697
174 Ga0373935_0015445 3300035692 Bacteria 4616
175 Ga0373927_0212969 3300035695 Bacteria 1269
176 Ga0373947_0032744 3300035725 Bacteria 3065
177 Ga0373937_0002272 3300036401 Bacteria 16046
178 Ga0373937_0013083 3300036401 Bacteria 7308
179 Ga0373937_0038905 3300036401 Bacteria 4333
180 Ga0373937_0050770 3300036401 Bacteria 3800
181 Ga0373937_0229033 3300036401 Bacteria 1750
182 Ga0373925_0001359 3300037068 Bacteria 21326
183 Ga0395899_0011517 3300037312 Bacteria 6770
184 Ga0395900_0027086 3300037418 Bacteria 5868
185 Ga0395898_0048540 3300037466 Bacteria 4162
186 Ga0395905_0030641 3300037471 Bacteria 5066
187 Ga0436364_0973373 3300037853 Bacteria 1827
188 Ga0395901_0216789 3300038443 Bacteria 2001
189 Ga0400489_76700 3300039093 Bacteria 3574
190 Ga0451853_0018382 3300041512 Bacteria 4220
191 Ga0439460_0026712 3300042461 Bacteria 1617
192 Ga0439440_0021380 3300042993 Bacteria 1457
193 Ga0466966_0022887 3300044684 Bacteria 4094
194 Ga0466961_0003317 3300044693 Bacteria 10040
195 Ga0466963_0186567 3300044694 Bacteria 1448
196 Ga0466964_0014768 3300044706 Bacteria 2972
197 Ga0466968_0004184 3300044735 Bacteria 5380
198 Ga0466959_0001014 3300045049 Bacteria 16709
199 Ga0451576_0000079 3300045051 Bacteria 242987
200 Ga0451576_0003971 3300045051 Bacteria 19690
201 Ga0451576_0025373 3300045051 Bacteria 6384
202 Ga0451576_0065934 3300045051 Bacteria 3769
203 Ga0495629_0043340 3300046459 Bacteria 3159
204 Ga0495629_0079683 3300046459 Bacteria 2287
205 Ga0495651_0159609 3300046462 Bacteria 1617
206 Ga0495653_0051819 3300046463 Bacteria 3148
207 Ga0495580_0019310 3300046472 Bacteria 5064
208 Ga0495580_0044539 3300046472 Bacteria 3155
209 Ga0495580_0154629 3300046472 Bacteria 1589
210 Ga0495582_0001533 3300046473 Bacteria 13033
211 Ga0495582_0028521 3300046473 Bacteria 3063
212 Ga0495639_0059431 3300046475 Bacteria 1750
213 Ga0495606_0001817 3300046507 Bacteria 27123
214 Ga0495628_0001480 3300046516 Bacteria 21513
215 Ga0495628_0018499 3300046516 Bacteria 5770
216 Ga0495628_0032113 3300046516 Bacteria 4241
217 Ga0495652_0018254 3300046529 Bacteria 6258
218 Ga0495652_0029879 3300046529 Bacteria 4783
219 Ga0495665_0031670 3300046531 Bacteria 2830
220 Ga0495587_0014296 3300046536 Bacteria 4982
221 Ga0495645_0000213 3300046543 Bacteria 41703
222 Ga0495645_0003088 3300046543 Bacteria 11279
223 Ga0495668_0002664 3300046616 Bacteria 14337
224 Ga0495625_0006278 3300046660 Bacteria 10629
225 Ga0495657_0094496 3300046675 Bacteria 1912
226 Ga0495599_0000289 3300046678 Bacteria 30818
227 Ga0495623_0138567 3300046679 Bacteria 1449
228 Ga0495646_0008974 3300046680 Bacteria 6346
229 Ga0495658_0001106 3300046683 Bacteria 14267
230 Ga0495658_0002601 3300046683 Bacteria 9071
231 Ga0495624_0036763 3300046690 Bacteria 3154
232 Ga0495674_0065548 3300047319 Bacteria 3154
233 Ga0495674_0191001 3300047319 Bacteria 1702
234 Ga0495676_0057980 3300047321 Bacteria 3050
235 Ga0495676_0145058 3300047321 Bacteria 1697
236 Ga0495675_0003794 3300047444 Bacteria 9142
237 Ga0495675_0005915 3300047444 Bacteria 7476
238 Ga0495593_0027135 3300047673 Bacteria 3154
239 Ga0495626_0000129 3300048091 Bacteria 95400
240 Ga0496100_0363709 3300048903 Bacteria 1095
241 Ga0496101_0038081 3300048904 Bacteria 3414
242 Ga0496102_0279196 3300048905 Bacteria 1575
243 Ga0496104_0001747 3300048907 Bacteria 18769
244 Ga0496106_0067384 3300048909 Bacteria 2729
245 Ga0496106_0260258 3300048909 Bacteria 1388
246 Ga0496107_0148740 3300048910 Bacteria 1732
247 Ga0496109_0013118 3300048912 Bacteria 7169
248 Ga0496110_0015994 3300048913 Bacteria 6257
249 Ga0496110_0097262 3300048913 Bacteria 2638
250 Ga0496111_0000509 3300048914 Bacteria 20095
251 Ga0496111_0114258 3300048914 Bacteria 1990
252 Ga0496112_0019390 3300048915 Bacteria 6420
253 Ga0496112_0058088 3300048915 Bacteria 3809
254 Ga0496112_0090011 3300048915 Bacteria 3037
255 Ga0496112_0201024 3300048915 Bacteria 1952
256 Ga0496113_0007032 3300048916 Bacteria 7198
257 Ga0496113_0315410 3300048916 Bacteria 1253
258 Ga0496119_0010862 3300048922 Bacteria 7611
259 Ga0495682_0001219 3300049460 Bacteria 14595
260 Ga0501031_0125149 3300049568 Bacteria 1679
261 Ga0501031_0132988 3300049568 Bacteria 1625
262 Ga0501033_0150747 3300049570 Bacteria 1678
263 Ga0501036_0032015 3300049572 Bacteria 4443
264 Ga0501036_0034355 3300049572 Bacteria 4289
265 Ga0501036_0101684 3300049572 Bacteria 2431
266 Ga0501036_0137059 3300049572 Bacteria 2066
267 Ga0501037_0176375 3300049573 Bacteria 1518
268 Ga0501038_0299782 3300049574 Bacteria 1262
269 Ga0501039_0162999 3300049575 Bacteria 1753
270 Ga0501040_0027843 3300049576 Bacteria 3807
271 Ga0501040_0051676 3300049576 Bacteria 2812
272 Ga0501041_0019447 3300049577 Bacteria 4056
273 Ga0501042_0025394 3300049578 Bacteria 4161
274 Ga0501042_0165276 3300049578 Bacteria 1597
275 Ga0501043_0072372 3300049579 Bacteria 2708
276 Ga0501046_0086413 3300049580 Bacteria 2418
277 Ga0501047_0000387 3300049581 Bacteria 49436
278 Ga0501047_0000893 3300049581 Bacteria 30459
279 Ga0501070_0139467 3300049586 Bacteria 2002
280 Ga0501071_0052272 3300049587 Bacteria 2946
281 Ga0501072_0026304 3300049588 Bacteria 4536
282 Ga0501072_0053889 3300049588 Bacteria 3168
283 Ga0501072_0062665 3300049588 Bacteria 2933
284 Ga0501074_0058618 3300049590 Bacteria 2774
285 Ga0501074_0184163 3300049590 Bacteria 1489
286 Ga0501074_0189656 3300049590 Bacteria 1466
287 Ga0501076_0041239 3300049592 Bacteria 3630
288 Ga0501076_0063489 3300049592 Bacteria 2942
289 Ga0501076_0084390 3300049592 Bacteria 2551
290 Ga0501079_0037227 3300049741 Bacteria 3749
291 Ga0501080_0020286 3300049742 Bacteria 6151
292 Ga0501081_0035878 3300049743 Bacteria 3377
293 Ga0501081_0062816 3300049743 Bacteria 2576
294 Ga0501081_0071992 3300049743 Bacteria 2410
295 Ga0501035_0130825 3300049822 Bacteria 2188
296 Ga0501045_0044380 3300049824 Bacteria 3238
297 nmdc:mga05p37_126_c1 3300050507 Bacteria 69639
298 nmdc:mga05p37_389233_c1 3300050507 Bacteria 1631
299 nmdc:mga09592_12_c1 3300050508 Bacteria 104148
300 nmdc:mga09592_47324_c1 3300050508 Bacteria 3625
301 nmdc:mga0qj67_161152_c1 3300050509 Bacteria 1821
302 nmdc:mga0qj67_168376_c1 3300050509 Bacteria 1779
303 nmdc:mga0qj67_6_c2 3300050509 Bacteria 123818
304 nmdc:mga06r32_102509_c1 3300050510 Bacteria 2809
305 nmdc:mga06r32_10_c1 3300050510 Bacteria 113242
306 nmdc:mga06r32_6198_c1 3300050510 Bacteria 10735
307 nmdc:mga06r32_98974_c1 3300050510 Bacteria 2860
308 nmdc:mga0n895_175024_c1 3300050512 Bacteria 2177
309 Ga0495601_0180830 3300053077 Bacteria 1379
310 Ga0495619_0062092 3300053085 Bacteria 2487
311 Ga0500646_0000320 3300053090 Bacteria 14742
312 Ga0500583_0022872 3300053092 Bacteria 2626
313 Ga0500641_0013922 3300053096 Bacteria 2961
314 Ga0500660_022495 3300053100 Bacteria 3346
315 Ga0500569_011992 3300053109 Bacteria 2085
316 Ga0500594_0007387 3300053118 Bacteria 2486
317 Ga0500652_021845 3300053131 Bacteria 2415
318 Ga0500655_002980 3300053133 Bacteria 3072
319 Ga0500588_0006234 3300053146 Bacteria 2689
320 Ga0500600_0054255 3300053149 Bacteria 2260
321 Ga0501084_0042746 3300054114 Bacteria 3791
322 Ga0501082_0014245 3300060353 Bacteria 6843
323 Ga0501082_0038467 3300060353 Bacteria 4128
324 Ga0501082_0041925 3300060353 Bacteria 3946
325 Ga0501082_0134394 3300060353 Bacteria 2146
326 Ga0501082_0227698 3300060353 Bacteria 1623
327 Ga0530510_0009180 3300061734 Bacteria 6929
328 Ga0530510_0010367 3300061734 Bacteria 6534
329 Ga0530510_0018101 3300061734 Bacteria 4993
330 Ga0530510_0021810 3300061734 Bacteria 4558
331 2501941369 2501939600 Bacteria 6907073
332 2515496037 2515154088 Bacteria 5526283
333 2515719808 2515154129 Bacteria 5584369
334 2515757875 2515154137 Bacteria 5711575
335 2516082358 2515154202 Bacteria 5471270
336 2516090301 2515154203 Bacteria 5458536
337 2623587202 2622736626 Bacteria 7181580
338 2753264744 2751185782 Bacteria 11227053
339 2757570281 2757320392 Bacteria 3737298
340 2856861040 2856858025 Bacteria 7255264
341 2858870970 2858868258 Bacteria 7683772
342 2867304880 2867302475 Bacteria 7087181
343 2867315667 2867312974 Bacteria 7058875
344 2867324367 2867319477 Bacteria 7069771
345 2887482840 2887478801 Bacteria 8972725
346 2902587019 2902582711 Bacteria 6187705
347 649811789 649633069 Bacteria 6962533
348 8001781909 8001781756 Bacteria 9586736
349 8055413783 8055412473 Bacteria 6257500
350 Ga0114129_10000082
351 JGI24738J21930_10003066
352 Ga0070658_10002468
353 Ga0070683_100078340
354 Ga0070682_100090440
355 Ga0070660_100154638
356 Ga0070661_100063531
357 Ga0070668_100003271
358 Ga0070668_100131238
359 Ga0070668_100151132
360 Ga0070709_10004986
361 Ga0070713_100047242
362 Ga0070694_100055245
363 Ga0070708_100081997
364 Ga0070706_100016959
365 Ga0070706_100137399
366 Ga0070707_100026792
367 Ga0070707_100092964
368 Ga0070698_100013403
369 Ga0070698_100103289
370 Ga0070699_100008150
371 Ga0070699_100107978
372 Ga0070679_100040693
373 Ga0070686_100038353
374 Ga0070665_100027155
375 Ga0070704_100029468
376 Ga0068857_100180028
377 Ga0068857_100213074
378 Ga0068852_100276876
379 Ga0068859_100071570
380 Ga0068859_100300557
381 Ga0068864_100011149
382 Ga0068864_100052454
383 Ga0068861_100075356
384 Ga0068863_100008837
385 Ga0068863_100019495
386 Ga0068858_100032005
387 Ga0068860_100022214
388 Ga0068860_100279906
389 Ga0068862_100077048
390 Ga0081455_10011521
391 Ga0081455_10039799
392 Ga0081455_10091518
393 Ga0081540_1001016
394 Ga0081540_1005748
395 Ga0081540_1029641
396 Ga0081539_10007196
397 Ga0081539_10009561
398 Ga0070716_100002186
399 Ga0070712_100136651
400 Ga0075428_100000650
401 Ga0075428_100000717
402 Ga0075428_100021175
403 Ga0075428_100028984
404 Ga0075428_100095818
405 Ga0075428_100101055
406 Ga0075428_100318914
407 Ga0075430_100001505
408 Ga0075431_100001109
409 Ga0075431_100012151
410 Ga0075431_100083328
411 Ga0075431_100111227
412 Ga0075433_10055832
413 Ga0075434_100105546
414 Ga0075429_100008800
415 Ga0075429_100010207
416 Ga0068865_100087561
417 Ga0097620_100071570
418 Ga0097620_100300558
419 Ga0114129_10014688
420 Ga0114129_10054002
421 Ga0114129_10149799
422 Ga0114129_10254097
423 Ga0114129_10499040
424 Ga0105248_10023153
425 Ga0105248_10146395
426 Ga0105237_10254153
427 Ga0105238_10089857
428 Ga0157369_10217259
429 Ga0157378_10168405
430 Ga0157372_10032424
431 Ga0157375_10071836
432 Ga0163163_10005779
433 Ga0163163_10197867
434 Ga0157379_10084927
435 Ga0157376_10006876
436 Ga0157376_10216847
437 Ga0206356_10738473
438 Ga0207699_10005527
439 Ga0207684_10037795
440 Ga0207707_10014387
441 Ga0207693_10037709
442 Ga0207693_10067853
443 Ga0207663_10036369
444 Ga0207660_10042355
445 Ga0207652_10056899
446 Ga0207646_10044710
447 Ga0207646_10056002
448 Ga0207700_10000001
449 Ga0207700_10100348
450 Ga0207664_10061361
451 Ga0207665_10011043
452 Ga0207711_10009684
453 Ga0207661_10001620
454 Ga0207668_10003375
455 Ga0207668_10028182
456 Ga0207668_10112923
457 Ga0207703_10092754
458 Ga0207641_10006045
459 Ga0207641_10041986
460 Ga0207648_10222947
461 Ga0207676_10050127
462 Ga0207674_10029816
463 Ga0207674_10050383
464 Ga0207674_10152172
465 Ga0207675_100128935
466 Ga0209998_10005918
467 Ga0265356_1000016
468 Ga0268266_10005114
469 Ga0268266_10116523
470 Ga0268266_10304460
471 Ga0268264_10009964
472 Ga0268264_10205345
473 Ga0265319_1029808
474 Ga0265318_10000062
475 Ga0307517_10044559
476 Ga0307515_10000045
477 Ga0307515_10080208
478 Ga0307515_10084772
479 Ga0307515_10092180
480 Ga0265338_10009542
481 Ga0265338_10012202
482 Ga0265338_10039444
483 Ga0307512_10016438
484 Ga0307512_10072901
485 Ga0265760_10004342
486 Ga0265332_10028455
487 Ga0265325_10010810
488 Ga0265316_10118302
489 Ga0307513_10002212
490 Ga0307513_10010848
491 Ga0307513_10017935
492 Ga0307513_10080749
493 Ga0307509_10014918
494 Ga0307408_100078352
495 Ga0307508_10009661
496 Ga0307508_10063244
497 Ga0265342_10098326
498 Ga0307516_10001714
499 Ga0307516_10027001
500 Ga0307516_10043898
501 Ga0307516_10202624
502 Ga0307516_10238501
503 Ga0307413_10005154
504 Ga0307410_10003872
505 Ga0307406_10004191
506 Ga0307406_10053999
507 Ga0307407_10022983
508 Ga0307409_100001007
509 Ga0307415_100000190
510 Ga0307415_100043669
511 Ga0307415_100074058
512 Ga0316583_10013705
513 Ga0316588_1009901
514 Ga0373944_0024704
515 Ga0373953_0031311
516 Ga0373956_0041454
517 Ga0373943_0002025
518 Ga0373943_0080020
519 Ga0373946_0035460
520 Ga0373955_0075603
521 Ga0373942_0001416
522 Ga0373962_0021659
523 Ga0373935_0015445
524 Ga0373927_0212969
525 Ga0373947_0032744
526 Ga0373937_0002272
527 Ga0373937_0013083
528 Ga0373937_0038905
529 Ga0373937_0050770
530 Ga0373937_0229033
531 Ga0373925_0001359
532 Ga0395899_0011517
533 Ga0395900_0027086
534 Ga0395898_0048540
535 Ga0395905_0030641
536 Ga0436364_0973373
537 Ga0395901_0216789
538 Ga0400489_76700
539 Ga0451853_0018382
540 Ga0439460_0026712
541 Ga0439440_0021380
542 Ga0466966_0022887
543 Ga0466961_0003317
544 Ga0466963_0186567
545 Ga0466964_0014768
546 Ga0466968_0004184
547 Ga0466959_0001014
548 Ga0451576_0000079
549 Ga0451576_0003971
550 Ga0451576_0025373
551 Ga0451576_0065934
552 Ga0495629_0043340
553 Ga0495629_0079683
554 Ga0495651_0159609
555 Ga0495653_0051819
556 Ga0495580_0019310
557 Ga0495580_0044539
558 Ga0495580_0154629
559 Ga0495582_0001533
560 Ga0495582_0028521
561 Ga0495639_0059431
562 Ga0495606_0001817
563 Ga0495628_0001480
564 Ga0495628_0018499
565 Ga0495628_0032113
566 Ga0495652_0018254
567 Ga0495652_0029879
568 Ga0495665_0031670
569 Ga0495587_0014296
570 Ga0495645_0000213
571 Ga0495645_0003088
572 Ga0495668_0002664
573 Ga0495625_0006278
574 Ga0495657_0094496
575 Ga0495599_0000289
576 Ga0495623_0138567
577 Ga0495646_0008974
578 Ga0495658_0001106
579 Ga0495658_0002601
580 Ga0495624_0036763
581 Ga0495674_0065548
582 Ga0495674_0191001
583 Ga0495676_0057980
584 Ga0495676_0145058
585 Ga0495675_0003794
586 Ga0495675_0005915
587 Ga0495593_0027135
588 Ga0495626_0000129
589 Ga0496100_0363709
590 Ga0496101_0038081
591 Ga0496102_0279196
592 Ga0496104_0001747
593 Ga0496106_0067384
594 Ga0496106_0260258
595 Ga0496107_0148740
596 Ga0496109_0013118
597 Ga0496110_0015994
598 Ga0496110_0097262
599 Ga0496111_0000509
600 Ga0496111_0114258
601 Ga0496112_0019390
602 Ga0496112_0058088
603 Ga0496112_0090011
604 Ga0496112_0201024
605 Ga0496113_0007032
606 Ga0496113_0315410
607 Ga0496119_0010862
608 Ga0495682_0001219
609 Ga0501031_0125149
610 Ga0501031_0132988
611 Ga0501033_0150747
612 Ga0501036_0032015
613 Ga0501036_0034355
614 Ga0501036_0101684
615 Ga0501036_0137059
616 Ga0501037_0176375
617 Ga0501038_0299782
618 Ga0501039_0162999
619 Ga0501040_0027843
620 Ga0501040_0051676
621 Ga0501041_0019447
622 Ga0501042_0025394
623 Ga0501042_0165276
624 Ga0501043_0072372
625 Ga0501046_0086413
626 Ga0501047_0000387
627 Ga0501047_0000893
628 Ga0501070_0139467
629 Ga0501071_0052272
630 Ga0501072_0026304
631 Ga0501072_0053889
632 Ga0501072_0062665
633 Ga0501074_0058618
634 Ga0501074_0184163
635 Ga0501074_0189656
636 Ga0501076_0041239
637 Ga0501076_0063489
638 Ga0501076_0084390
639 Ga0501079_0037227
640 Ga0501080_0020286
641 Ga0501081_0035878
642 Ga0501081_0062816
643 Ga0501081_0071992
644 Ga0501035_0130825
645 Ga0501045_0044380
646 nmdc:mga05p37_126_c1
647 nmdc:mga05p37_389233_c1
648 nmdc:mga09592_12_c1
649 nmdc:mga09592_47324_c1
650 nmdc:mga0qj67_161152_c1
651 nmdc:mga0qj67_168376_c1
652 nmdc:mga0qj67_6_c2
653 nmdc:mga06r32_102509_c1
654 nmdc:mga06r32_10_c1
655 nmdc:mga06r32_6198_c1
656 nmdc:mga06r32_98974_c1
657 nmdc:mga0n895_175024_c1
658 Ga0495601_0180830
659 Ga0495619_0062092
660 Ga0500646_0000320
661 Ga0500583_0022872
662 Ga0500641_0013922
663 Ga0500660_022495
664 Ga0500569_011992
665 Ga0500594_0007387
666 Ga0500652_021845
667 Ga0500655_002980
668 Ga0500588_0006234
669 Ga0500600_0054255
670 Ga0501084_0042746
671 Ga0501082_0014245
672 Ga0501082_0038467
673 Ga0501082_0041925
674 Ga0501082_0134394
675 Ga0501082_0227698
676 Ga0530510_0009180
677 Ga0530510_0010367
678 Ga0530510_0018101
679 Ga0530510_0021810
680 2501941369
681 2515496037
682 2515719808
683 2515757875
684 2516082358
685 2516090301
686 2623587202
687 2753264744
688 2757570281
689 2856861040
690 2858870970
691 2867304880
692 2867315667
693 2867324367
694 2887482840
695 2902587019
696 649811789
697 8001781909
698 8055413783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00909

Ammonium_transp

Ammonium Transporter Family

43

449

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nuu-assembly2.cif.gz_D regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex 0.986 2 405
2npe-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9839 1 385
6b21-assembly1.cif.gz_A crystal structure of amtb from e. coli bound to topfluor cardiolipin 0.9831 1 384
2npd-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9831 2 385
2npg-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9831 2 385
ID Description Score Start End Superfamily
2npdA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9831 2 385 1.10.3430.10
2npdA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9751 2 385 1.10.3430.10
2b2hA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9619 2 404 1.10.3430.10
2b2hA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9595 2 404 1.10.3430.10
af_Q9BLG4_16_459_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9567 2 404 1.10.3430.10
ID Description Score Start End GO Terms
AF-A0A7Y4ZD68-F1-model_v4 Ammonium transporter 0.9967 94 404 GO:0005886
GO:0008519
AF-A0A7V2SLJ3-F1-model_v4 Ammonium transporter 0.996 21 313 GO:0005886
GO:0008519
AF-A0A356PYW4-F1-model_v4 Ammonium transporter 0.9959 2 364 GO:0005886
GO:0008519
AF-A0A2D6P144-F1-model_v4 Ammonium transporter 0.9958 2 331 GO:0005886
GO:0008519
AF-A0A2E0J2W8-F1-model_v4 Ammonia channel protein 0.9931 12 312 GO:0005886
GO:0008519

Map