F417872

General Info

Members Datasets Scaffolds Average Seq Length
349 190 349 990

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10063908|Ga0105240_100639082
Length 1066
Sequence LHCGKPPPLDPSIEIAMTDHSNAGDSYTSSGCLPYVQPLKEKIMLSSGNSRLHRMWSVIGICLITLALSAAVSSQDTTSGSIQGTVSDEQGAAVAGASVEARSAGTNFSKTFVTDSDGRFTFLSLPPGAYSVSVTKQGFAKLTQDGVALTVGRIVSLNVTLKVSGVSGEVTITGSPTIDTAKTEASTXXXXAAIENTPILGRKFEDLLTLTPGVSITQGPDGDEINFSGQRGIFNNVSLDGGDYNNGFFGEQAGGQRAAIDITLEAVQEFQVVATGATAEFGRTAGGIVNVITKSGTNDVNGSLFYFQRLKALTSNTSDGKPLSGFHREQFGGTVGGPIKRDKAFFFFAFEQIFEKLTRANLSEAIGTPCSVTNPTIQANEALINGSPDCQRLALINFIQSTRQFNEGVPVDHKIRNSAFLAKVDWNLTQSNKLGISYNFDFSKNTNQTFDVPTYGASANGTEGPSKINVLNVNLFTTVSPTMLNEAHFTYSREDRPRGATPSNILADTAMGFGTTFRFGNPFFLQPGVDEVFWRTQARDNFSIVKGAHTVKFGGEWLHSLNDQVFRGFFTGRYIFDSVTGFLRYASPAAPGGFGPSTGECTTPAGVFTGWVTQDAPFSEACPAGSSVGFAGGGPLLLYLQNGIPTGISGVPPPGKSTITNDDYALFAQDKWQVRPNLSFNYGLRWEAEMFPKPVVPPSQTAYGPLLNDPRFPSDGTLHSQKAEFQPRVGFAWDITNKGRSVLRASYGVYYARQNMLSEVGSITDNGVQQFGIACFSNPGCFGASSRPVWPNPVNVPPLGGRRIIEKISVFIKDYENPRIYTANVQYEQELVKDLALYFDFTHSKGVHLTRFFNYARTGFFPTLGDVFVTSSNGKSLYDGFTVGMRKRFSRRYQFEWNYVLSRDKDDDSNERDPFTDRSFDIFNPGLDYGLSDRDIRHKFNFFAYAQLPWKLEFTPRIQARSAQPATPAVLMLVDDHTNRNTLRKDNEFFTFDWRLSRVFGLTEKIDLVPQIEMFNTFNNKNLINSLSGAGNQNSITAPSLFNFDGFLRQGVGDPRQVQLALKLRF

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
177 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
178 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
181 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000014 3300002074 Bacteria 147126
2 JGI24034J26672_10000012 3300002239 Bacteria 146139
3 JGI24751J29686_10000076 3300002459 Bacteria 55757
4 JGI25406J46586_10002270 3300003203 Bacteria 9064
5 Ga0065714_10064481 3300005288 Bacteria 54282
6 Ga0065712_10000143 3300005290 Bacteria 54339
7 Ga0065712_10001320 3300005290 Bacteria 6352
8 Ga0065712_10007284 3300005290 Unclassified 4980
9 Ga0065715_10002541 3300005293 Bacteria 11566
10 Ga0065715_10007201 3300005293 Unclassified 4170
11 Ga0065707_10001961 3300005295 Bacteria 10763
12 Ga0065707_10007416 3300005295 Bacteria 3856
13 Ga0065707_10086218 3300005295 Bacteria 5589
14 Ga0070690_100001615 3300005330 Bacteria 11843
15 Ga0070690_100002614 3300005330 Bacteria 9705
16 Ga0070690_100016472 3300005330 Unclassified 4429
17 Ga0070670_100000428 3300005331 Bacteria 34724
18 Ga0070670_100014249 3300005331 Bacteria 6821
19 Ga0070670_100055828 3300005331 Bacteria 3390
20 Ga0070680_100003364 3300005336 Bacteria 11935
21 Ga0070682_100003676 3300005337 Bacteria 8515
22 Ga0070682_100009314 3300005337 Bacteria 5559
23 Ga0070689_100006742 3300005340 Bacteria 7982
24 Ga0070687_100005508 3300005343 Bacteria 5130
25 Ga0070692_10005018 3300005345 Bacteria 5593
26 Ga0070669_100011687 3300005353 Bacteria 6228
27 Ga0070675_100005392 3300005354 Bacteria 9778
28 Ga0070671_100006488 3300005355 Bacteria 9356
29 Ga0070671_100034638 3300005355 Bacteria 4180
30 Ga0070671_100044853 3300005355 Bacteria 3674
31 Ga0070673_100049870 3300005364 Bacteria 3270
32 Ga0070667_100022199 3300005367 Bacteria 5266
33 Ga0070703_10000034 3300005406 Bacteria 66916
34 Ga0070703_10000273 3300005406 Bacteria 24543
35 Ga0070703_10001111 3300005406 Bacteria 8342
36 Ga0070703_10004394 3300005406 Unclassified 3968
37 Ga0070701_10013662 3300005438 Bacteria 3701
38 Ga0070711_100000049 3300005439 Bacteria 73819
39 Ga0070705_100000136 3300005440 Bacteria 43205
40 Ga0070705_100001309 3300005440 Bacteria 13345
41 Ga0070700_100000215 3300005441 Bacteria 32331
42 Ga0070700_100010271 3300005441 Bacteria 5167
43 Ga0070694_100001750 3300005444 Bacteria 12820
44 Ga0070694_100002376 3300005444 Bacteria 11126
45 Ga0070708_100000354 3300005445 Bacteria 34774
46 Ga0070708_100009963 3300005445 Bacteria 7684
47 Ga0070708_100065422 3300005445 Unclassified 3260
48 Ga0070681_10000312 3300005458 Bacteria 39403
49 Ga0070681_10000976 3300005458 Bacteria 24193
50 Ga0070681_10016945 3300005458 Bacteria 7279
51 Ga0068867_100014832 3300005459 Bacteria 5525
52 Ga0068867_100018101 3300005459 Bacteria 5005
53 Ga0068867_100030562 3300005459 Bacteria 3884
54 Ga0070706_100000019 3300005467 Bacteria 166483
55 Ga0070706_100000587 3300005467 Bacteria 42203
56 Ga0070706_100019911 3300005467 Bacteria 6186
57 Ga0070706_100038945 3300005467 Unclassified 4388
58 Ga0070706_100043656 3300005467 Unclassified 4142
59 Ga0070706_100045200 3300005467 Bacteria 4068
60 Ga0070707_100000247 3300005468 Bacteria 54124
61 Ga0070707_100002616 3300005468 Bacteria 17106
62 Ga0070707_100010571 3300005468 Bacteria 8597
63 Ga0070707_100025668 3300005468 Bacteria 5593
64 Ga0070707_100033191 3300005468 Bacteria 4920
65 Ga0070698_100000134 3300005471 Bacteria 65298
66 Ga0070698_100005556 3300005471 Bacteria 13783
67 Ga0070698_100011827 3300005471 Bacteria 9260
68 Ga0070698_100013125 3300005471 Bacteria 8767
69 Ga0070698_100031053 3300005471 Bacteria 5539
70 Ga0070699_100000034 3300005518 Bacteria 135576
71 Ga0070699_100009233 3300005518 Bacteria 8546
72 Ga0070699_100031414 3300005518 Unclassified 4584
73 Ga0070679_100000278 3300005530 Bacteria 43146
74 Ga0070697_100000150 3300005536 Bacteria 56876
75 Ga0070697_100007630 3300005536 Bacteria 8420
76 Ga0070697_100024434 3300005536 Bacteria 4810
77 Ga0070697_100045196 3300005536 Bacteria 3569
78 Ga0068853_100002289 3300005539 Bacteria 14308
79 Ga0068853_100019161 3300005539 Bacteria 5671
80 Ga0070686_100001958 3300005544 Bacteria 11433
81 Ga0070696_100000255 3300005546 Bacteria 32239
82 Ga0070696_100021389 3300005546 Bacteria 4385
83 Ga0070693_100004197 3300005547 Bacteria 6804
84 Ga0070665_100002551 3300005548 Bacteria 20004
85 Ga0070704_100003947 3300005549 Bacteria 8540
86 Ga0070704_100005807 3300005549 Bacteria 7222
87 Ga0068855_100023109 3300005563 Bacteria 7450
88 Ga0070664_100003370 3300005564 Bacteria 12916
89 Ga0070664_100026376 3300005564 Unclassified 4819
90 Ga0068857_100002182 3300005577 Bacteria 15923
91 Ga0068857_100029332 3300005577 Unclassified 4855
92 Ga0068854_100027619 3300005578 Bacteria 3914
93 Ga0068859_100025157 3300005617 Bacteria 5974
94 Ga0068859_100033852 3300005617 Bacteria 5130
95 Ga0068859_100037763 3300005617 Bacteria 4847
96 Ga0068864_100018893 3300005618 Bacteria 5763
97 Ga0068866_10003972 3300005718 Bacteria 6071
98 Ga0068866_10008679 3300005718 Bacteria 4294
99 Ga0068861_100017743 3300005719 Bacteria 5057
100 Ga0068861_100034330 3300005719 Bacteria 3751
101 Ga0068861_100044969 3300005719 Bacteria 3322
102 Ga0068851_10001390 3300005834 Bacteria 10577
103 Ga0068863_100002866 3300005841 Bacteria 17075
104 Ga0068858_100000602 3300005842 Bacteria 37601
105 Ga0068858_100036339 3300005842 Bacteria 4568
106 Ga0068860_100002059 3300005843 Bacteria 21186
107 Ga0068862_100016151 3300005844 Bacteria 6210
108 Ga0081540_1001509 3300005983 Bacteria 20013
109 Ga0081539_10000480 3300005985 Bacteria 84478
110 Ga0081539_10001808 3300005985 Bacteria 33796
111 Ga0081539_10001988 3300005985 Bacteria 31070
112 Ga0081539_10006272 3300005985 Bacteria 11498
113 Ga0070715_10000013 3300006163 Bacteria 155405
114 Ga0070716_100000003 3300006173 Bacteria 312721
115 Ga0070716_100000547 3300006173 Bacteria 15776
116 Ga0097621_100000620 3300006237 Bacteria 25068
117 Ga0097621_100004982 3300006237 Bacteria 9310
118 Ga0068871_100001197 3300006358 Bacteria 17313
119 Ga0068871_100014648 3300006358 Bacteria 5851
120 Ga0075431_100071659 3300006847 Bacteria 3575
121 Ga0075433_10009563 3300006852 Bacteria 7752
122 Ga0075433_10012779 3300006852 Bacteria 6798
123 Ga0075434_100002895 3300006871 Bacteria 15232
124 Ga0075434_100027748 3300006871 Bacteria 5559
125 Ga0075434_100035333 3300006871 Bacteria 4940
126 Ga0075434_100044320 3300006871 Bacteria 4413
127 Ga0075434_100072556 3300006871 Bacteria 3435
128 Ga0075429_100038111 3300006880 Unclassified 4184
129 Ga0075429_100047936 3300006880 Bacteria 3716
130 Ga0068865_100008540 3300006881 Bacteria 6331
131 Ga0075436_100000051 3300006914 Bacteria 70811
132 Ga0075436_100000271 3300006914 Bacteria 32591
133 Ga0075436_100005575 3300006914 Bacteria 8642
134 Ga0097620_100025158 3300006931 Bacteria 5974
135 Ga0097620_100033851 3300006931 Bacteria 5130
136 Ga0097620_100037762 3300006931 Bacteria 4847
137 Ga0075435_100000819 3300007076 Bacteria 19376
138 Ga0075435_100011012 3300007076 Bacteria 6632
139 Ga0075435_100014658 3300007076 Bacteria 5872
140 Ga0075435_100036505 3300007076 Bacteria 3907
141 Ga0105240_10025651 3300009093 Bacteria 7742
142 Ga0105240_10063908 3300009093 Bacteria 4576
143 Ga0111539_10003562 3300009094 Bacteria 20524
144 Ga0111539_10007514 3300009094 Bacteria 13941
145 Ga0105247_10000050 3300009101 Bacteria 146183
146 Ga0105247_10000217 3300009101 Bacteria 55594
147 Ga0105247_10020766 3300009101 Bacteria 3949
148 Ga0114129_10018054 3300009147 Viruses 10049
149 Ga0114129_10021727 3300009147 Bacteria 9107
150 Ga0114129_10033767 3300009147 Bacteria 7227
151 Ga0114129_10081708 3300009147 Unclassified 4492
152 Ga0105243_10000029 3300009148 Bacteria 190577
153 Ga0105243_10002136 3300009148 Bacteria 16718
154 Ga0105243_10014294 3300009148 Bacteria 6007
155 Ga0105241_10021643 3300009174 Unclassified 4756
156 Ga0105242_10000009 3300009176 Bacteria 162286
157 Ga0105242_10000581 3300009176 Bacteria 28877
158 Ga0105242_10012588 3300009176 Bacteria 6514
159 Ga0105242_10052361 3300009176 Unclassified 3331
160 Ga0105248_10033040 3300009177 Bacteria 5778
161 Ga0105237_10002924 3300009545 Bacteria 20689
162 Ga0105237_10025808 3300009545 Bacteria 6008
163 Ga0105237_10027738 3300009545 Bacteria 5773
164 Ga0105238_10002086 3300009551 Bacteria 20178
165 Ga0105238_10007150 3300009551 Bacteria 11164
166 Ga0105249_10001651 3300009553 Bacteria 19539
167 Ga0105249_10014054 3300009553 Bacteria 7078
168 Ga0105249_10028429 3300009553 Bacteria 5046
169 Ga0105239_10025302 3300010375 Bacteria 6536
170 Ga0105239_10051197 3300010375 Bacteria 4527
171 Ga0105246_10005142 3300011119 Bacteria 7954
172 Ga0157373_10002783 3300013100 Bacteria 13233
173 Ga0157378_10000047 3300013297 Bacteria 104964
174 Ga0157378_10000314 3300013297 Bacteria 47424
175 Ga0157378_10009598 3300013297 Bacteria 8427
176 Ga0157378_10012402 3300013297 Bacteria 7461
177 Ga0157378_10022567 3300013297 Bacteria 5538
178 Ga0157378_10033717 3300013297 Bacteria 4528
179 Ga0163162_10007029 3300013306 Bacteria 10916
180 Ga0163162_10037743 3300013306 Bacteria 4822
181 Ga0157372_10020177 3300013307 Bacteria 7186
182 Ga0157375_10004211 3300013308 Bacteria 12479
183 Ga0157375_10036730 3300013308 Unclassified 4688
184 Ga0163163_10000640 3300014325 Bacteria 30070
185 Ga0163163_10016828 3300014325 Bacteria 6805
186 Ga0163163_10031094 3300014325 Bacteria 5150
187 Ga0163163_10035548 3300014325 Bacteria 4834
188 Ga0163163_10041726 3300014325 Unclassified 4488
189 Ga0157380_10000343 3300014326 Bacteria 27894
190 Ga0157380_10003326 3300014326 Bacteria 11034
191 Ga0157380_10008978 3300014326 Bacteria 7141
192 Ga0157379_10014525 3300014968 Bacteria 6911
193 Ga0157376_10000017 3300014969 Bacteria 268501
194 Ga0163161_10001849 3300017792 Bacteria 15463
195 Ga0163161_10010347 3300017792 Bacteria 6458
196 Ga0213876_10000041 3300021384 Bacteria 169380
197 Ga0213876_10000246 3300021384 Bacteria 51765
198 Ga0213876_10007578 3300021384 Bacteria 5894
199 Ga0207697_10005532 3300025315 Bacteria 5860
200 Ga0207656_10003895 3300025321 Bacteria 5171
201 Ga0207653_10000015 3300025885 Bacteria 150553
202 Ga0207653_10000276 3300025885 Bacteria 30342
203 Ga0207653_10000912 3300025885 Bacteria 9802
204 Ga0207710_10000003 3300025900 Bacteria 1071597
205 Ga0207680_10011860 3300025903 Unclassified 4421
206 Ga0207647_10008902 3300025904 Bacteria 7158
207 Ga0207647_10039405 3300025904 Bacteria 2981
208 Ga0207685_10000013 3300025905 Bacteria 186374
209 Ga0207643_10013807 3300025908 Bacteria 4383
210 Ga0207684_10000387 3300025910 Bacteria 59233
211 Ga0207684_10000701 3300025910 Bacteria 39518
212 Ga0207684_10003144 3300025910 Bacteria 16249
213 Ga0207684_10021042 3300025910 Bacteria 5570
214 Ga0207684_10024309 3300025910 Bacteria 5166
215 Ga0207684_10029436 3300025910 Unclassified 4677
216 Ga0207707_10000024 3300025912 Bacteria 183501
217 Ga0207707_10000741 3300025912 Bacteria 32266
218 Ga0207707_10019266 3300025912 Bacteria 5955
219 Ga0207695_10021332 3300025913 Bacteria 7393
220 Ga0207671_10007374 3300025914 Bacteria 9552
221 Ga0207663_10000035 3300025916 Bacteria 88027
222 Ga0207660_10008162 3300025917 Bacteria 6774
223 Ga0207662_10003556 3300025918 Bacteria 8040
224 Ga0207652_10000189 3300025921 Bacteria 64976
225 Ga0207646_10000020 3300025922 Bacteria 272909
226 Ga0207646_10002263 3300025922 Bacteria 22899
227 Ga0207646_10007111 3300025922 Bacteria 11446
228 Ga0207646_10007115 3300025922 Bacteria 11443
229 Ga0207646_10007747 3300025922 Bacteria 10866
230 Ga0207681_10003344 3300025923 Bacteria 10035
231 Ga0207694_10000931 3300025924 Bacteria 25933
232 Ga0207650_10000001 3300025925 Bacteria 1545726
233 Ga0207650_10001186 3300025925 Bacteria 19153
234 Ga0207644_10002180 3300025931 Bacteria 12701
235 Ga0207644_10031381 3300025931 Bacteria 3701
236 Ga0207706_10006919 3300025933 Bacteria 10486
237 Ga0207686_10000010 3300025934 Bacteria 227471
238 Ga0207686_10000496 3300025934 Bacteria 25802
239 Ga0207686_10005230 3300025934 Bacteria 6967
240 Ga0207709_10000052 3300025935 Bacteria 227471
241 Ga0207709_10001154 3300025935 Bacteria 19226
242 Ga0207709_10002585 3300025935 Bacteria 11271
243 Ga0207670_10000351 3300025936 Bacteria 27321
244 Ga0207665_10000038 3300025939 Bacteria 85922
245 Ga0207665_10001777 3300025939 Bacteria 14508
246 Ga0207691_10008763 3300025940 Bacteria 9704
247 Ga0207689_10003115 3300025942 Bacteria 15213
248 Ga0207651_10002332 3300025960 Bacteria 9047
249 Ga0207703_10000355 3300026035 Bacteria 49221
250 Ga0207703_10042432 3300026035 Unclassified 3649
251 Ga0207639_10028314 3300026041 Unclassified 4089
252 Ga0207708_10000126 3300026075 Bacteria 59505
253 Ga0207641_10001775 3300026088 Bacteria 20771
254 Ga0207641_10038408 3300026088 Bacteria 4003
255 Ga0207648_10022747 3300026089 Bacteria 5625
256 Ga0207676_10006243 3300026095 Bacteria 8413
257 Ga0207674_10000023 3300026116 Bacteria 157752
258 Ga0207674_10002846 3300026116 Bacteria 21521
259 Ga0207674_10067989 3300026116 Unclassified 3586
260 Ga0207675_100002805 3300026118 Bacteria 17123
261 Ga0207675_100005270 3300026118 Bacteria 12439
262 Ga0207675_100026919 3300026118 Bacteria 5353
263 Ga0207675_100032778 3300026118 Bacteria 4840
264 Ga0209588_1001233 3300027671 Bacteria 6610
265 Ga0207428_10013998 3300027907 Bacteria 6987
266 Ga0207428_10015378 3300027907 Bacteria 6620
267 Ga0207428_10020922 3300027907 Bacteria 5547
268 Ga0268266_10001124 3300028379 Bacteria 33359
269 Ga0268264_10020313 3300028381 Bacteria 5428
270 Ga0307408_100003089 3300031548 Bacteria 11466
271 Ga0307405_10011784 3300031731 Bacteria 4601
272 Ga0307413_10001506 3300031824 Bacteria 8913
273 Ga0307410_10009241 3300031852 Bacteria 5518
274 Ga0307406_10000987 3300031901 Bacteria 15787
275 Ga0307412_10006065 3300031911 Bacteria 6804
276 Ga0307416_100031403 3300032002 Bacteria 3998
277 Ga0307414_10001583 3300032004 Bacteria 11803
278 Ga0307415_100010354 3300032126 Bacteria 5278
279 Ga0307415_100018751 3300032126 Bacteria 4186
280 Ga0373951_0000881 3300035091 Bacteria 8112
281 Ga0373927_0000179 3300035695 Bacteria 50200
282 Ga0373925_0000500 3300037068 Bacteria 39549
283 Ga0436365_0213934 3300039437 Bacteria 51788
284 Ga0436365_1476328 3300039437 Bacteria 212791
285 Ga0436365_1520167 3300039437 Bacteria 10189
286 Ga0453683_0026925 3300044673 Bacteria 3650
287 Ga0453684_0004862 3300044712 Bacteria 27560
288 Ga0451576_0037897 3300045051 Bacteria 5105
289 Ga0495629_0014377 3300046459 Bacteria 5694
290 Ga0495651_0040547 3300046462 Bacteria 3620
291 Ga0495580_0003557 3300046472 Bacteria 13232
292 Ga0495580_0028174 3300046472 Bacteria 4085
293 Ga0495582_0000242 3300046473 Bacteria 30326
294 Ga0495582_0008371 3300046473 Bacteria 5708
295 Ga0495639_0008815 3300046475 Bacteria 4327
296 Ga0495662_0004573 3300046476 Bacteria 6937
297 Ga0495630_0006239 3300046517 Bacteria 8459
298 Ga0495663_0000363 3300046525 Bacteria 16811
299 Ga0495666_0007016 3300046526 Bacteria 5659
300 Ga0495652_0047244 3300046529 Bacteria 3692
301 Ga0495640_0023808 3300046533 Bacteria 4455
302 Ga0495669_0001864 3300046684 Bacteria 8642
303 Ga0495669_0010887 3300046684 Bacteria 3850
304 Ga0495669_0019949 3300046684 Unclassified 2896
305 Ga0495581_0009792 3300047315 Bacteria 5546
306 Ga0495636_0006345 3300047318 Bacteria 4645
307 Ga0495674_0032985 3300047319 Bacteria 4694
308 Ga0495680_0019777 3300047322 Bacteria 5679
309 Ga0495680_0021353 3300047322 Bacteria 5422
310 Ga0495684_0024389 3300047471 Bacteria 4656
311 Ga0495614_0000592 3300048089 Bacteria 15152
312 Ga0495614_0011376 3300048089 Bacteria 3917
313 Ga0496102_0003285 3300048905 Bacteria 13706
314 Ga0496106_0031838 3300048909 Bacteria 3930
315 Ga0496109_0000125 3300048912 Bacteria 78217
316 Ga0496114_0002334 3300048917 Bacteria 14451
317 Ga0496115_0006914 3300048918 Bacteria 8334
318 Ga0496115_0007294 3300048918 Bacteria 8131
319 Ga0501038_0003831 3300049574 Bacteria 13987
320 Ga0501217_000048 3300049661 Bacteria 13703
321 Ga0501223_001236 3300049663 Bacteria 5961
322 Ga0501227_000222 3300049665 Bacteria 11466
323 Ga0501240_000103 3300049673 Bacteria 5425
324 Ga0501221_001761 3300049704 Bacteria 3607
325 Ga0501225_0000379 3300049705 Bacteria 14042
326 Ga0501234_000182 3300049707 Bacteria 8744
327 Ga0501226_000482 3300049853 Bacteria 5586
328 nmdc:mga05p37_31536_c1 3300050507 Bacteria 6474
329 nmdc:mga05p37_52682_c1 3300050507 Bacteria 5003
330 nmdc:mga05p37_82832_c1 3300050507 Unclassified 3953
331 nmdc:mga06r32_41320_c1 3300050510 Bacteria 4381
332 nmdc:mga08y16_35062_c1 3300050511 Bacteria 5271
333 nmdc:mga08y16_40143_c1 3300050511 Bacteria 4907
334 nmdc:mga08y16_4199_c1 3300050511 Bacteria 15035
335 nmdc:mga08y16_84535_c1 3300050511 Bacteria 3308
336 nmdc:mga0n895_23179_c1 3300050512 Bacteria 5831
337 nmdc:mga0n895_41015_c1 3300050512 Bacteria 4499
338 nmdc:mga0n895_43134_c1 3300050512 Bacteria 4394
339 nmdc:mga0n895_48510_c1 3300050512 Bacteria 4157
340 nmdc:mga0rr50_13465_c1 3300050513 Bacteria 5326
341 nmdc:mga0rr50_337_c1 3300050513 Bacteria 25438
342 nmdc:mga08x19_116_c1 3300050514 Bacteria 70950
343 nmdc:mga08x19_19_c1 3300050514 Bacteria 315774
344 nmdc:mga08x19_8152_c1 3300050514 Bacteria 6227
345 nmdc:mga0a205_15067_c1 3300050515 Bacteria 7219
346 nmdc:mga0a205_26490_c1 3300050515 Bacteria 5530
347 nmdc:mga0a205_6627_c1 3300050515 Bacteria 6819
348 Ga0501084_0032801 3300054114 Bacteria 4346
349 Ga0530510_0003429 3300061734 Bacteria 10903

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0019949 Ga0495669_0019949_15_2714 826
2 3300014325 Ga0163163_10031094 Ga0163163_100310941 863
3 3300025904 Ga0207647_10039405 Ga0207647_100394051 893
4 3300044712 Ga0453684_0004862 Ga0453684_0004862_7870_11019 909
5 3300045051 Ga0451576_0037897 Ga0451576_0037897_1688_4837 909
6 3300026116 Ga0207674_10067989 Ga0207674_100679892 910
7 3300050515 nmdc:mga0a205_26490_c1 nmdc:mga0a205_26490_c1_542_3505 916
8 3300005406 Ga0070703_10000034 Ga0070703_1000003433 917
9 3300005467 Ga0070706_100000587 Ga0070706_10000058711 917
10 3300005547 Ga0070693_100004197 Ga0070693_1000041973 917
11 3300025885 Ga0207653_10000015 Ga0207653_10000015108 917
12 3300025910 Ga0207684_10000701 Ga0207684_1000070110 917
13 3300005468 Ga0070707_100025668 Ga0070707_1000256681 918
14 3300025922 Ga0207646_10000020 Ga0207646_10000020115 918
15 3300046529 Ga0495652_0047244 Ga0495652_0047244_674_3649 918
16 3300005440 Ga0070705_100000136 Ga0070705_1000001367 920
17 3300006173 Ga0070716_100000547 Ga0070716_10000054712 923
18 3300025939 Ga0207665_10000038 Ga0207665_1000003813 923
19 3300006847 Ga0075431_100071659 Ga0075431_1000716592 926
20 3300005518 Ga0070699_100000034 Ga0070699_10000003413 927
21 3300005546 Ga0070696_100000255 Ga0070696_10000025512 927
22 3300061734 Ga0530510_0003429 Ga0530510_0003429_2475_5522 927
23 3300006871 Ga0075434_100002895 Ga0075434_1000028952 931
24 3300007076 Ga0075435_100036505 Ga0075435_1000365052 931
25 3300050512 nmdc:mga0n895_23179_c1 nmdc:mga0n895_23179_c1_675_3779 931
26 3300005468 Ga0070707_100010571 Ga0070707_1000105715 932
27 3300005564 Ga0070664_100003370 Ga0070664_1000033702 932
28 3300005577 Ga0068857_100002182 Ga0068857_1000021828 932
29 3300025912 Ga0207707_10019266 Ga0207707_100192662 932
30 3300025922 Ga0207646_10007747 Ga0207646_100077475 932
31 3300026116 Ga0207674_10000023 Ga0207674_1000002365 932
32 3300005330 Ga0070690_100016472 Ga0070690_1000164722 933
33 3300005343 Ga0070687_100005508 Ga0070687_1000055083 933
34 3300005718 Ga0068866_10008679 Ga0068866_100086792 933
35 3300006358 Ga0068871_100014648 Ga0068871_1000146483 933
36 3300006881 Ga0068865_100008540 Ga0068865_1000085403 933
37 3300009148 Ga0105243_10014294 Ga0105243_100142943 933
38 3300011119 Ga0105246_10005142 Ga0105246_100051425 933
39 3300017792 Ga0163161_10010347 Ga0163161_100103472 933
40 3300025315 Ga0207697_10005532 Ga0207697_100055322 933
41 3300025918 Ga0207662_10003556 Ga0207662_100035564 933
42 3300025940 Ga0207691_10008763 Ga0207691_100087636 933
43 3300026118 Ga0207675_100026919 Ga0207675_1000269194 933
44 3300005336 Ga0070680_100003364 Ga0070680_1000033644 935
45 3300005458 Ga0070681_10000312 Ga0070681_1000031223 935
46 3300005530 Ga0070679_100000278 Ga0070679_10000027823 935
47 3300025912 Ga0207707_10000024 Ga0207707_1000002468 935
48 3300025917 Ga0207660_10008162 Ga0207660_100081623 935
49 3300025921 Ga0207652_10000189 Ga0207652_1000018912 935
50 3300047315 Ga0495581_0009792 Ga0495581_0009792_1991_5026 935
51 3300014968 Ga0157379_10014525 Ga0157379_100145253 937
52 3300027907 Ga0207428_10020922 Ga0207428_100209222 942
53 3300009545 Ga0105237_10025808 Ga0105237_100258082 943
54 3300046472 Ga0495580_0003557 Ga0495580_0003557_8577_11687 945
55 3300046473 Ga0495582_0000242 Ga0495582_0000242_26620_29730 945
56 3300005288 Ga0065714_10064481 Ga0065714_1006448145 947
57 3300005290 Ga0065712_10000143 Ga0065712_1000014345 947
58 3300005467 Ga0070706_100043656 Ga0070706_1000436562 947
59 3300005471 Ga0070698_100011827 Ga0070698_10001182710 947
60 3300005983 Ga0081540_1001509 Ga0081540_10015097 947
61 3300005445 Ga0070708_100009963 Ga0070708_1000099634 949
62 3300009093 Ga0105240_10025651 Ga0105240_100256511 949
63 3300025913 Ga0207695_10021332 Ga0207695_100213324 949
64 3300007076 Ga0075435_100011012 Ga0075435_1000110121 950
65 3300031731 Ga0307405_10011784 Ga0307405_100117841 950
66 3300031824 Ga0307413_10001506 Ga0307413_100015063 950
67 3300032002 Ga0307416_100031403 Ga0307416_1000314032 950
68 3300005718 Ga0068866_10003972 Ga0068866_100039725 951
69 3300027671 Ga0209588_1001233 Ga0209588_10012331 952
70 3300005290 Ga0065712_10001320 Ga0065712_100013204 953
71 3300005459 Ga0068867_100018101 Ga0068867_1000181012 953
72 3300005536 Ga0070697_100024434 Ga0070697_1000244344 953
73 3300005546 Ga0070696_100021389 Ga0070696_1000213892 953
74 3300005843 Ga0068860_100002059 Ga0068860_10000205912 953
75 3300013297 Ga0157378_10000314 Ga0157378_1000031432 953
76 3300025934 Ga0207686_10005230 Ga0207686_100052304 953
77 3300048905 Ga0496102_0003285 Ga0496102_0003285_65_3262 953
78 3300048909 Ga0496106_0031838 Ga0496106_0031838_294_3491 953
79 3300050507 nmdc:mga05p37_82832_c1 nmdc:mga05p37_82832_c1_26_3076 953
80 3300005441 Ga0070700_100000215 Ga0070700_10000021517 954
81 3300026075 Ga0207708_10000126 Ga0207708_100001269 954
82 3300046684 Ga0495669_0010887 Ga0495669_0010887_594_3665 954
83 3300050511 nmdc:mga08y16_40143_c1 nmdc:mga08y16_40143_c1_1449_4370 954
84 3300005337 Ga0070682_100009314 Ga0070682_1000093143 955
85 3300005345 Ga0070692_10005018 Ga0070692_100050182 955
86 3300005406 Ga0070703_10001111 Ga0070703_100011114 955
87 3300005439 Ga0070711_100000049 Ga0070711_1000000499 955
88 3300005440 Ga0070705_100001309 Ga0070705_1000013091 955
89 3300005549 Ga0070704_100003947 Ga0070704_1000039474 955
90 3300005834 Ga0068851_10001390 Ga0068851_100013903 955
91 3300005842 Ga0068858_100036339 Ga0068858_1000363393 955
92 3300005985 Ga0081539_10001808 Ga0081539_1000180820 955
93 3300006914 Ga0075436_100000271 Ga0075436_10000027119 955
94 3300009545 Ga0105237_10002924 Ga0105237_100029245 955
95 3300025321 Ga0207656_10003895 Ga0207656_100038952 955
96 3300025885 Ga0207653_10000912 Ga0207653_100009124 955
97 3300025914 Ga0207671_10007374 Ga0207671_100073745 955
98 3300025916 Ga0207663_10000035 Ga0207663_1000003518 955
99 3300044673 Ga0453683_0026925 Ga0453683_0026925_21_3074 955
100 3300050514 nmdc:mga08x19_19_c1 nmdc:mga08x19_19_c1_73470_76481 955
101 3300013306 Ga0163162_10007029 Ga0163162_100070297 956
102 3300005330 Ga0070690_100001615 Ga0070690_1000016152 957
103 3300005544 Ga0070686_100001958 Ga0070686_1000019583 957
104 3300006914 Ga0075436_100005575 Ga0075436_1000055754 957
105 3300013297 Ga0157378_10033717 Ga0157378_100337172 957
106 3300021384 Ga0213876_10000041 Ga0213876_100000417 957
107 3300039437 Ga0436365_1476328 Ga0436365_1476328_48671_51691 957
108 3300050514 nmdc:mga08x19_8152_c1 nmdc:mga08x19_8152_c1_2548_5667 957
109 3300021384 Ga0213876_10000246 Ga0213876_1000024626 958
110 3300039437 Ga0436365_0213934 Ga0436365_0213934_29734_32760 958
111 3300046459 Ga0495629_0014377 Ga0495629_0014377_2069_5176 958
112 3300046462 Ga0495651_0040547 Ga0495651_0040547_79_3186 958
113 3300046472 Ga0495580_0028174 Ga0495580_0028174_256_3363 958
114 3300046473 Ga0495582_0008371 Ga0495582_0008371_2238_5345 958
115 3300046475 Ga0495639_0008815 Ga0495639_0008815_208_3315 958
116 3300046476 Ga0495662_0004573 Ga0495662_0004573_1537_4644 958
117 3300046526 Ga0495666_0007016 Ga0495666_0007016_1153_4260 958
118 3300047322 Ga0495680_0021353 Ga0495680_0021353_340_3447 958
119 3300048089 Ga0495614_0000592 Ga0495614_0000592_11080_14187 958
120 3300005438 Ga0070701_10013662 Ga0070701_100136622 959
121 3300005467 Ga0070706_100000019 Ga0070706_10000001921 959
122 3300009101 Ga0105247_10000217 Ga0105247_1000021737 959
123 3300025910 Ga0207684_10000387 Ga0207684_1000038729 959
124 3300026035 Ga0207703_10042432 Ga0207703_100424321 959
125 3300028381 Ga0268264_10020313 Ga0268264_100203132 959
126 3300005331 Ga0070670_100055828 Ga0070670_1000558281 960
127 3300005355 Ga0070671_100006488 Ga0070671_1000064886 961
128 3300009551 Ga0105238_10002086 Ga0105238_100020863 961
129 3300009551 Ga0105238_10007150 Ga0105238_100071505 961
130 3300025924 Ga0207694_10000931 Ga0207694_1000093110 961
131 3300025931 Ga0207644_10031381 Ga0207644_100313811 961
132 3300035091 Ga0373951_0000881 Ga0373951_0000881_5019_8045 961
133 3300049574 Ga0501038_0003831 Ga0501038_0003831_4905_7910 962
134 3300005841 Ga0068863_100002866 Ga0068863_10000286616 964
135 3300006871 Ga0075434_100044320 Ga0075434_1000443202 964
136 3300009176 Ga0105242_10052361 Ga0105242_100523611 964
137 3300013297 Ga0157378_10009598 Ga0157378_100095982 964
138 3300013308 Ga0157375_10036730 Ga0157375_100367302 964
139 3300050512 nmdc:mga0n895_43134_c1 nmdc:mga0n895_43134_c1_125_3184 964
140 3300054114 Ga0501084_0032801 Ga0501084_0032801_861_3842 964
141 3300005290 Ga0065712_10007284 Ga0065712_100072842 965
142 3300005293 Ga0065715_10007201 Ga0065715_100072011 965
143 3300006880 Ga0075429_100047936 Ga0075429_1000479363 965
144 3300009553 Ga0105249_10001651 Ga0105249_1000165112 965
145 3300002459 JGI24751J29686_10000076 JGI24751J29686_1000007627 966
146 3300005331 Ga0070670_100000428 Ga0070670_10000042827 966
147 3300005353 Ga0070669_100011687 Ga0070669_1000116875 966
148 3300005467 Ga0070706_100045200 Ga0070706_1000452002 966
149 3300005617 Ga0068859_100025157 Ga0068859_1000251573 966
150 3300006931 Ga0097620_100025158 Ga0097620_1000251583 966
151 3300009177 Ga0105248_10033040 Ga0105248_100330402 966
152 3300013306 Ga0163162_10037743 Ga0163162_100377432 966
153 3300014325 Ga0163163_10000640 Ga0163163_100006404 966
154 3300025910 Ga0207684_10021042 Ga0207684_100210423 966
155 3300025923 Ga0207681_10003344 Ga0207681_100033442 966
156 3300025925 Ga0207650_10000001 Ga0207650_1000000126 966
157 3300025925 Ga0207650_10001186 Ga0207650_1000118612 966
158 3300035695 Ga0373927_0000179 Ga0373927_0000179_17491_20550 966
159 3300037068 Ga0373925_0000500 Ga0373925_0000500_26193_29252 966
160 3300046517 Ga0495630_0006239 Ga0495630_0006239_4265_7324 966
161 3300005331 Ga0070670_100014249 Ga0070670_1000142492 967
162 3300005354 Ga0070675_100005392 Ga0070675_1000053922 967
163 3300005444 Ga0070694_100001750 Ga0070694_1000017502 967
164 3300005468 Ga0070707_100002616 Ga0070707_1000026161 967
165 3300009176 Ga0105242_10012588 Ga0105242_100125883 967
166 3300025922 Ga0207646_10002263 Ga0207646_1000226315 967
167 3300005295 Ga0065707_10086218 Ga0065707_100862182 968
168 3300005617 Ga0068859_100033852 Ga0068859_1000338523 968
169 3300006880 Ga0075429_100038111 Ga0075429_1000381112 968
170 3300006931 Ga0097620_100033851 Ga0097620_1000338513 968
171 3300009094 Ga0111539_10003562 Ga0111539_1000356213 968
172 3300027907 Ga0207428_10013998 Ga0207428_100139985 968
173 3300032126 Ga0307415_100018751 Ga0307415_1000187512 968
174 3300049673 Ga0501240_000103 Ga0501240_000103_504_3500 968
175 3300005406 Ga0070703_10000273 Ga0070703_1000027314 969
176 3300009148 Ga0105243_10000029 Ga0105243_1000002986 969
177 3300009176 Ga0105242_10000009 Ga0105242_1000000992 969
178 3300014325 Ga0163163_10041726 Ga0163163_100417261 969
179 3300025885 Ga0207653_10000276 Ga0207653_1000027611 969
180 3300025934 Ga0207686_10000010 Ga0207686_1000001091 969
181 3300025935 Ga0207709_10000052 Ga0207709_1000005291 969
182 3300050507 nmdc:mga05p37_52682_c1 nmdc:mga05p37_52682_c1_456_3473 969
183 3300005295 Ga0065707_10001961 Ga0065707_100019611 970
184 3300005549 Ga0070704_100005807 Ga0070704_1000058072 970
185 3300005617 Ga0068859_100037763 Ga0068859_1000377632 970
186 3300006931 Ga0097620_100037762 Ga0097620_1000377622 970
187 3300014326 Ga0157380_10000343 Ga0157380_1000034318 970
188 3300027907 Ga0207428_10015378 Ga0207428_100153783 970
189 3300046525 Ga0495663_0000363 Ga0495663_0000363_3592_6633 971
190 3300046684 Ga0495669_0001864 Ga0495669_0001864_3546_6539 971
191 3300048912 Ga0496109_0000125 Ga0496109_0000125_40750_43698 971
192 3300048918 Ga0496115_0006914 Ga0496115_0006914_1725_4853 971
193 3300005445 Ga0070708_100000354 Ga0070708_1000003547 972
194 3300005518 Ga0070699_100009233 Ga0070699_1000092335 972
195 3300005536 Ga0070697_100007630 Ga0070697_1000076304 972
196 3300025908 Ga0207643_10013807 Ga0207643_100138073 972
197 3300026088 Ga0207641_10001775 Ga0207641_100017757 972
198 3300005459 Ga0068867_100014832 Ga0068867_1000148323 973
199 3300005471 Ga0070698_100031053 Ga0070698_1000310535 973
200 3300026089 Ga0207648_10022747 Ga0207648_100227472 973
201 3300046533 Ga0495640_0023808 Ga0495640_0023808_535_3666 973
202 3300047319 Ga0495674_0032985 Ga0495674_0032985_844_3975 973
203 3300047322 Ga0495680_0019777 Ga0495680_0019777_83_3214 973
204 3300047471 Ga0495684_0024389 Ga0495684_0024389_1258_4389 973
205 3300048089 Ga0495614_0011376 Ga0495614_0011376_676_3807 973
206 3300003203 JGI25406J46586_10002270 JGI25406J46586_100022706 974
207 3300005985 Ga0081539_10006272 Ga0081539_100062724 974
208 3300014325 Ga0163163_10035548 Ga0163163_100355482 974
209 3300050512 nmdc:mga0n895_48510_c1 nmdc:mga0n895_48510_c1_244_3264 974
210 3300005719 Ga0068861_100017743 Ga0068861_1000177432 975
211 3300026118 Ga0207675_100002805 Ga0207675_1000028053 975
212 3300005444 Ga0070694_100002376 Ga0070694_1000023763 976
213 3300009094 Ga0111539_10007514 Ga0111539_100075143 976
214 3300031548 Ga0307408_100003089 Ga0307408_1000030894 976
215 3300031901 Ga0307406_10000987 Ga0307406_100009879 976
216 3300031911 Ga0307412_10006065 Ga0307412_100060654 976
217 3300032004 Ga0307414_10001583 Ga0307414_100015833 976
218 3300032126 Ga0307415_100010354 Ga0307415_1000103542 976
219 3300049661 Ga0501217_000048 Ga0501217_000048_1306_4326 976
220 3300049663 Ga0501223_001236 Ga0501223_001236_1910_4930 976
221 3300049665 Ga0501227_000222 Ga0501227_000222_1305_4325 976
222 3300049704 Ga0501221_001761 Ga0501221_001761_532_3552 976
223 3300049705 Ga0501225_0000379 Ga0501225_0000379_10306_13326 976
224 3300049707 Ga0501234_000182 Ga0501234_000182_4286_7306 976
225 3300049853 Ga0501226_000482 Ga0501226_000482_2106_5126 976
226 3300050511 nmdc:mga08y16_35062_c1 nmdc:mga08y16_35062_c1_2225_5242 976
227 3300005471 Ga0070698_100000134 Ga0070698_10000013414 977
228 3300005539 Ga0068853_100019161 Ga0068853_1000191613 977
229 3300006237 Ga0097621_100004982 Ga0097621_1000049827 977
230 3300014969 Ga0157376_10000017 Ga0157376_10000017209 977
231 3300048917 Ga0496114_0002334 Ga0496114_0002334_5320_8475 977
232 3300048918 Ga0496115_0007294 Ga0496115_0007294_4824_7979 977
233 3300009147 Ga0114129_10021727 Ga0114129_100217276 978
234 3300013297 Ga0157378_10022567 Ga0157378_100225671 978
235 3300013307 Ga0157372_10020177 Ga0157372_100201775 978
236 3300050510 nmdc:mga06r32_41320_c1 nmdc:mga06r32_41320_c1_438_3386 978
237 3300050511 nmdc:mga08y16_4199_c1 nmdc:mga08y16_4199_c1_10978_13956 978
238 3300005518 Ga0070699_100031414 Ga0070699_1000314144 979
239 3300005536 Ga0070697_100000150 Ga0070697_1000001508 979
240 3300013297 Ga0157378_10012402 Ga0157378_100124022 979
241 3300005330 Ga0070690_100002614 Ga0070690_1000026144 980
242 3300005406 Ga0070703_10004394 Ga0070703_100043942 980
243 3300005467 Ga0070706_100038945 Ga0070706_1000389452 980
244 3300005719 Ga0068861_100034330 Ga0068861_1000343302 980
245 3300005844 Ga0068862_100016151 Ga0068862_1000161513 980
246 3300005985 Ga0081539_10000480 Ga0081539_1000048020 980
247 3300025910 Ga0207684_10024309 Ga0207684_100243092 980
248 3300025910 Ga0207684_10029436 Ga0207684_100294362 980
249 3300005458 Ga0070681_10000976 Ga0070681_1000097612 981
250 3300006852 Ga0075433_10012779 Ga0075433_100127794 981
251 3300006871 Ga0075434_100035333 Ga0075434_1000353333 981
252 3300025903 Ga0207680_10011860 Ga0207680_100118601 981
253 3300005367 Ga0070667_100022199 Ga0070667_1000221993 982
254 3300005548 Ga0070665_100002551 Ga0070665_1000025511 982
255 3300005618 Ga0068864_100018893 Ga0068864_1000188934 982
256 3300006914 Ga0075436_100000051 Ga0075436_10000005148 982
257 3300007076 Ga0075435_100000819 Ga0075435_1000008193 982
258 3300021384 Ga0213876_10007578 Ga0213876_100075781 982
259 3300026088 Ga0207641_10038408 Ga0207641_100384081 982
260 3300028379 Ga0268266_10001124 Ga0268266_1000112420 982
261 3300039437 Ga0436365_1520167 Ga0436365_1520167_12_3113 982
262 3300050513 nmdc:mga0rr50_337_c1 nmdc:mga0rr50_337_c1_20966_23986 982
263 3300050514 nmdc:mga08x19_116_c1 nmdc:mga08x19_116_c1_15060_18080 982
264 3300005337 Ga0070682_100003676 Ga0070682_1000036762 983
265 3300005340 Ga0070689_100006742 Ga0070689_1000067421 983
266 3300005441 Ga0070700_100010271 Ga0070700_1000102713 983
267 3300005539 Ga0068853_100002289 Ga0068853_1000022895 983
268 3300005985 Ga0081539_10001988 Ga0081539_100019888 983
269 3300006237 Ga0097621_100000620 Ga0097621_10000062010 983
270 3300006358 Ga0068871_100001197 Ga0068871_1000011979 983
271 3300009101 Ga0105247_10020766 Ga0105247_100207662 983
272 3300009147 Ga0114129_10081708 Ga0114129_100817082 983
273 3300025904 Ga0207647_10008902 Ga0207647_100089023 983
274 3300025936 Ga0207670_10000351 Ga0207670_1000035111 983
275 3300026041 Ga0207639_10028314 Ga0207639_100283142 983
276 3300009174 Ga0105241_10021643 Ga0105241_100216432 984
277 3300013100 Ga0157373_10002783 Ga0157373_100027833 984
278 3300014325 Ga0163163_10016828 Ga0163163_100168284 984
279 3300005364 Ga0070673_100049870 Ga0070673_1000498701 985
280 3300009147 Ga0114129_10033767 Ga0114129_100337672 985
281 3300025960 Ga0207651_10002332 Ga0207651_100023321 985
282 3300050507 nmdc:mga05p37_31536_c1 nmdc:mga05p37_31536_c1_2793_5813 985
283 3300017792 Ga0163161_10001849 Ga0163161_100018498 986
284 3300005467 Ga0070706_100019911 Ga0070706_1000199113 987
285 3300005468 Ga0070707_100033191 Ga0070707_1000331913 987
286 3300005471 Ga0070698_100005556 Ga0070698_1000055569 987
287 3300025910 Ga0207684_10003144 Ga0207684_100031441 987
288 3300025922 Ga0207646_10007111 Ga0207646_100071118 987
289 3300005468 Ga0070707_100000247 Ga0070707_10000024742 988
290 3300006173 Ga0070716_100000003 Ga0070716_100000003270 988
291 3300025922 Ga0207646_10007115 Ga0207646_100071155 988
292 3300025939 Ga0207665_10001777 Ga0207665_1000177712 988
293 3300005459 Ga0068867_100030562 Ga0068867_1000305622 989
294 3300005578 Ga0068854_100027619 Ga0068854_1000276191 989
295 3300005719 Ga0068861_100044969 Ga0068861_1000449691 989
296 3300006871 Ga0075434_100072556 Ga0075434_1000725562 989
297 3300007076 Ga0075435_100014658 Ga0075435_1000146582 989
298 3300014326 Ga0157380_10008978 Ga0157380_100089781 989
299 3300025935 Ga0207709_10002585 Ga0207709_100025858 989
300 3300026118 Ga0207675_100032778 Ga0207675_1000327781 989
301 3300050511 nmdc:mga08y16_84535_c1 nmdc:mga08y16_84535_c1_114_3176 989
302 3300050512 nmdc:mga0n895_41015_c1 nmdc:mga0n895_41015_c1_1259_4345 989
303 3300050513 nmdc:mga0rr50_13465_c1 nmdc:mga0rr50_13465_c1_1993_5079 989
304 3300050515 nmdc:mga0a205_15067_c1 nmdc:mga0a205_15067_c1_2447_5533 989
305 3300005295 Ga0065707_10007416 Ga0065707_100074161 990
306 3300005293 Ga0065715_10002541 Ga0065715_1000254110 994
307 3300050515 nmdc:mga0a205_6627_c1 nmdc:mga0a205_6627_c1_1667_4711 994
308 3300010375 Ga0105239_10025302 Ga0105239_100253027 995
309 3300025912 Ga0207707_10000741 Ga0207707_1000074125 995
310 3300006163 Ga0070715_10000013 Ga0070715_1000001341 996
311 3300025905 Ga0207685_10000013 Ga0207685_1000001340 996
312 3300005471 Ga0070698_100013125 Ga0070698_1000131253 998
313 3300005355 Ga0070671_100044853 Ga0070671_1000448531 999
314 3300009553 Ga0105249_10028429 Ga0105249_100284292 999
315 3300031852 Ga0307410_10009241 Ga0307410_100092411 999
316 3300005445 Ga0070708_100065422 Ga0070708_1000654221 1000
317 3300014326 Ga0157380_10003326 Ga0157380_100033264 1000
318 3300005563 Ga0068855_100023109 Ga0068855_1000231094 1001
319 3300005564 Ga0070664_100026376 Ga0070664_1000263762 1001
320 3300005577 Ga0068857_100029332 Ga0068857_1000293321 1001
321 3300025933 Ga0207706_10006919 Ga0207706_100069197 1001
322 3300026116 Ga0207674_10002846 Ga0207674_100028463 1001
323 3300009147 Ga0114129_10018054 Ga0114129_100180543 1005
324 3300009553 Ga0105249_10014054 Ga0105249_100140544 1005
325 3300026095 Ga0207676_10006243 Ga0207676_100062432 1005
326 3300005458 Ga0070681_10016945 Ga0070681_100169456 1006
327 3300009093 Ga0105240_10063908 Ga0105240_100639082 1006
328 3300009545 Ga0105237_10027738 Ga0105237_100277383 1006
329 3300010375 Ga0105239_10051197 Ga0105239_100511972 1006
330 3300005536 Ga0070697_100045196 Ga0070697_1000451961 1007
331 3300006852 Ga0075433_10009563 Ga0075433_100095636 1010
332 3300025942 Ga0207689_10003115 Ga0207689_1000311510 1010
333 3300026118 Ga0207675_100005270 Ga0207675_1000052704 1010
334 3300009148 Ga0105243_10002136 Ga0105243_100021365 1017
335 3300009176 Ga0105242_10000581 Ga0105242_1000058116 1017
336 3300013297 Ga0157378_10000047 Ga0157378_100000475 1017
337 3300013308 Ga0157375_10004211 Ga0157375_100042114 1017
338 3300025934 Ga0207686_10000496 Ga0207686_1000049610 1017
339 3300025935 Ga0207709_10001154 Ga0207709_1000115414 1017
340 3300002074 JGI24748J21848_1000014 JGI24748J21848_1000014110 1020
341 3300002239 JGI24034J26672_10000012 JGI24034J26672_1000001214 1020
342 3300005355 Ga0070671_100034638 Ga0070671_1000346382 1020
343 3300005842 Ga0068858_100000602 Ga0068858_1000006024 1020
344 3300006871 Ga0075434_100027748 Ga0075434_1000277481 1020
345 3300009101 Ga0105247_10000050 Ga0105247_10000050109 1020
346 3300025900 Ga0207710_10000003 Ga0207710_10000003899 1020
347 3300025931 Ga0207644_10002180 Ga0207644_100021804 1020
348 3300026035 Ga0207703_10000355 Ga0207703_1000035517 1020
349 3300047318 Ga0495636_0006345 Ga0495636_0006345_13_3075 1020

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

81

162

0.99

PF07715

Plug

TonB-dependent Receptor Plug Domain

180

289

0.84

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

484

779

0.53

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p0d-assembly1.cif.gz_A the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions 0.8176 40 98
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.8092 39 121
5fp2-assembly1.cif.gz_A crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.8065 144 1020
3m8b-assembly1.cif.gz_A crystal structure of spin-labeled btub v10r1 in the apo state 0.8061 139 1020
5fp2-assembly1.cif.gz_A crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.7959 144 1020
ID Description Score Start End Superfamily
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9126 41 124 2.60.40.1120
af_E7F254_344_443_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9088 41 124 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.899 41 123 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.878 41 123 2.60.40.1120
af_I1NBD7_943_1024_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8762 41 96 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A2V8JMT1-F1-model_v4 Alpha-2-macroglobulin bait region domain-containing protein 0.9561 38 125 GO:0004866
GO:0016020
GO:0030246
AF-A0A355UVY8-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9502 39 125
AF-A0A2V7UJC3-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9379 40 125
AF-A0A3D6EHI3-F1-model_v4 TonB-dependent receptor 0.9358 35 124
AF-A0A2V8DXY9-F1-model_v4 TonB-dependent receptor 0.9355 37 125 GO:0030246

Feature Viewer

pLDDT pTM Quality
74.91 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map