F417872
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 349 | 190 | 349 | 990 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10063908|Ga0105240_100639082 |
| Length | 1066 |
| Sequence | LHCGKPPPLDPSIEIAMTDHSNAGDSYTSSGCLPYVQPLKEKIMLSSGNSRLHRMWSVIGICLITLALSAAVSSQDTTSGSIQGTVSDEQGAAVAGASVEARSAGTNFSKTFVTDSDGRFTFLSLPPGAYSVSVTKQGFAKLTQDGVALTVGRIVSLNVTLKVSGVSGEVTITGSPTIDTAKTEASTXXXXAAIENTPILGRKFEDLLTLTPGVSITQGPDGDEINFSGQRGIFNNVSLDGGDYNNGFFGEQAGGQRAAIDITLEAVQEFQVVATGATAEFGRTAGGIVNVITKSGTNDVNGSLFYFQRLKALTSNTSDGKPLSGFHREQFGGTVGGPIKRDKAFFFFAFEQIFEKLTRANLSEAIGTPCSVTNPTIQANEALINGSPDCQRLALINFIQSTRQFNEGVPVDHKIRNSAFLAKVDWNLTQSNKLGISYNFDFSKNTNQTFDVPTYGASANGTEGPSKINVLNVNLFTTVSPTMLNEAHFTYSREDRPRGATPSNILADTAMGFGTTFRFGNPFFLQPGVDEVFWRTQARDNFSIVKGAHTVKFGGEWLHSLNDQVFRGFFTGRYIFDSVTGFLRYASPAAPGGFGPSTGECTTPAGVFTGWVTQDAPFSEACPAGSSVGFAGGGPLLLYLQNGIPTGISGVPPPGKSTITNDDYALFAQDKWQVRPNLSFNYGLRWEAEMFPKPVVPPSQTAYGPLLNDPRFPSDGTLHSQKAEFQPRVGFAWDITNKGRSVLRASYGVYYARQNMLSEVGSITDNGVQQFGIACFSNPGCFGASSRPVWPNPVNVPPLGGRRIIEKISVFIKDYENPRIYTANVQYEQELVKDLALYFDFTHSKGVHLTRFFNYARTGFFPTLGDVFVTSSNGKSLYDGFTVGMRKRFSRRYQFEWNYVLSRDKDDDSNERDPFTDRSFDIFNPGLDYGLSDRDIRHKFNFFAYAQLPWKLEFTPRIQARSAQPATPAVLMLVDDHTNRNTLRKDNEFFTFDWRLSRVFGLTEKIDLVPQIEMFNTFNNKNLINSLSGAGNQNSITAPSLFNFDGFLRQGVGDPRQVQLALKLRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 137 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 172 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 175 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 177 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 178 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 179 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 181 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.72 |
| Rhizosphere | 96.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000014 | 3300002074 | Bacteria | 147126 |
| 2 | JGI24034J26672_10000012 | 3300002239 | Bacteria | 146139 |
| 3 | JGI24751J29686_10000076 | 3300002459 | Bacteria | 55757 |
| 4 | JGI25406J46586_10002270 | 3300003203 | Bacteria | 9064 |
| 5 | Ga0065714_10064481 | 3300005288 | Bacteria | 54282 |
| 6 | Ga0065712_10000143 | 3300005290 | Bacteria | 54339 |
| 7 | Ga0065712_10001320 | 3300005290 | Bacteria | 6352 |
| 8 | Ga0065712_10007284 | 3300005290 | Unclassified | 4980 |
| 9 | Ga0065715_10002541 | 3300005293 | Bacteria | 11566 |
| 10 | Ga0065715_10007201 | 3300005293 | Unclassified | 4170 |
| 11 | Ga0065707_10001961 | 3300005295 | Bacteria | 10763 |
| 12 | Ga0065707_10007416 | 3300005295 | Bacteria | 3856 |
| 13 | Ga0065707_10086218 | 3300005295 | Bacteria | 5589 |
| 14 | Ga0070690_100001615 | 3300005330 | Bacteria | 11843 |
| 15 | Ga0070690_100002614 | 3300005330 | Bacteria | 9705 |
| 16 | Ga0070690_100016472 | 3300005330 | Unclassified | 4429 |
| 17 | Ga0070670_100000428 | 3300005331 | Bacteria | 34724 |
| 18 | Ga0070670_100014249 | 3300005331 | Bacteria | 6821 |
| 19 | Ga0070670_100055828 | 3300005331 | Bacteria | 3390 |
| 20 | Ga0070680_100003364 | 3300005336 | Bacteria | 11935 |
| 21 | Ga0070682_100003676 | 3300005337 | Bacteria | 8515 |
| 22 | Ga0070682_100009314 | 3300005337 | Bacteria | 5559 |
| 23 | Ga0070689_100006742 | 3300005340 | Bacteria | 7982 |
| 24 | Ga0070687_100005508 | 3300005343 | Bacteria | 5130 |
| 25 | Ga0070692_10005018 | 3300005345 | Bacteria | 5593 |
| 26 | Ga0070669_100011687 | 3300005353 | Bacteria | 6228 |
| 27 | Ga0070675_100005392 | 3300005354 | Bacteria | 9778 |
| 28 | Ga0070671_100006488 | 3300005355 | Bacteria | 9356 |
| 29 | Ga0070671_100034638 | 3300005355 | Bacteria | 4180 |
| 30 | Ga0070671_100044853 | 3300005355 | Bacteria | 3674 |
| 31 | Ga0070673_100049870 | 3300005364 | Bacteria | 3270 |
| 32 | Ga0070667_100022199 | 3300005367 | Bacteria | 5266 |
| 33 | Ga0070703_10000034 | 3300005406 | Bacteria | 66916 |
| 34 | Ga0070703_10000273 | 3300005406 | Bacteria | 24543 |
| 35 | Ga0070703_10001111 | 3300005406 | Bacteria | 8342 |
| 36 | Ga0070703_10004394 | 3300005406 | Unclassified | 3968 |
| 37 | Ga0070701_10013662 | 3300005438 | Bacteria | 3701 |
| 38 | Ga0070711_100000049 | 3300005439 | Bacteria | 73819 |
| 39 | Ga0070705_100000136 | 3300005440 | Bacteria | 43205 |
| 40 | Ga0070705_100001309 | 3300005440 | Bacteria | 13345 |
| 41 | Ga0070700_100000215 | 3300005441 | Bacteria | 32331 |
| 42 | Ga0070700_100010271 | 3300005441 | Bacteria | 5167 |
| 43 | Ga0070694_100001750 | 3300005444 | Bacteria | 12820 |
| 44 | Ga0070694_100002376 | 3300005444 | Bacteria | 11126 |
| 45 | Ga0070708_100000354 | 3300005445 | Bacteria | 34774 |
| 46 | Ga0070708_100009963 | 3300005445 | Bacteria | 7684 |
| 47 | Ga0070708_100065422 | 3300005445 | Unclassified | 3260 |
| 48 | Ga0070681_10000312 | 3300005458 | Bacteria | 39403 |
| 49 | Ga0070681_10000976 | 3300005458 | Bacteria | 24193 |
| 50 | Ga0070681_10016945 | 3300005458 | Bacteria | 7279 |
| 51 | Ga0068867_100014832 | 3300005459 | Bacteria | 5525 |
| 52 | Ga0068867_100018101 | 3300005459 | Bacteria | 5005 |
| 53 | Ga0068867_100030562 | 3300005459 | Bacteria | 3884 |
| 54 | Ga0070706_100000019 | 3300005467 | Bacteria | 166483 |
| 55 | Ga0070706_100000587 | 3300005467 | Bacteria | 42203 |
| 56 | Ga0070706_100019911 | 3300005467 | Bacteria | 6186 |
| 57 | Ga0070706_100038945 | 3300005467 | Unclassified | 4388 |
| 58 | Ga0070706_100043656 | 3300005467 | Unclassified | 4142 |
| 59 | Ga0070706_100045200 | 3300005467 | Bacteria | 4068 |
| 60 | Ga0070707_100000247 | 3300005468 | Bacteria | 54124 |
| 61 | Ga0070707_100002616 | 3300005468 | Bacteria | 17106 |
| 62 | Ga0070707_100010571 | 3300005468 | Bacteria | 8597 |
| 63 | Ga0070707_100025668 | 3300005468 | Bacteria | 5593 |
| 64 | Ga0070707_100033191 | 3300005468 | Bacteria | 4920 |
| 65 | Ga0070698_100000134 | 3300005471 | Bacteria | 65298 |
| 66 | Ga0070698_100005556 | 3300005471 | Bacteria | 13783 |
| 67 | Ga0070698_100011827 | 3300005471 | Bacteria | 9260 |
| 68 | Ga0070698_100013125 | 3300005471 | Bacteria | 8767 |
| 69 | Ga0070698_100031053 | 3300005471 | Bacteria | 5539 |
| 70 | Ga0070699_100000034 | 3300005518 | Bacteria | 135576 |
| 71 | Ga0070699_100009233 | 3300005518 | Bacteria | 8546 |
| 72 | Ga0070699_100031414 | 3300005518 | Unclassified | 4584 |
| 73 | Ga0070679_100000278 | 3300005530 | Bacteria | 43146 |
| 74 | Ga0070697_100000150 | 3300005536 | Bacteria | 56876 |
| 75 | Ga0070697_100007630 | 3300005536 | Bacteria | 8420 |
| 76 | Ga0070697_100024434 | 3300005536 | Bacteria | 4810 |
| 77 | Ga0070697_100045196 | 3300005536 | Bacteria | 3569 |
| 78 | Ga0068853_100002289 | 3300005539 | Bacteria | 14308 |
| 79 | Ga0068853_100019161 | 3300005539 | Bacteria | 5671 |
| 80 | Ga0070686_100001958 | 3300005544 | Bacteria | 11433 |
| 81 | Ga0070696_100000255 | 3300005546 | Bacteria | 32239 |
| 82 | Ga0070696_100021389 | 3300005546 | Bacteria | 4385 |
| 83 | Ga0070693_100004197 | 3300005547 | Bacteria | 6804 |
| 84 | Ga0070665_100002551 | 3300005548 | Bacteria | 20004 |
| 85 | Ga0070704_100003947 | 3300005549 | Bacteria | 8540 |
| 86 | Ga0070704_100005807 | 3300005549 | Bacteria | 7222 |
| 87 | Ga0068855_100023109 | 3300005563 | Bacteria | 7450 |
| 88 | Ga0070664_100003370 | 3300005564 | Bacteria | 12916 |
| 89 | Ga0070664_100026376 | 3300005564 | Unclassified | 4819 |
| 90 | Ga0068857_100002182 | 3300005577 | Bacteria | 15923 |
| 91 | Ga0068857_100029332 | 3300005577 | Unclassified | 4855 |
| 92 | Ga0068854_100027619 | 3300005578 | Bacteria | 3914 |
| 93 | Ga0068859_100025157 | 3300005617 | Bacteria | 5974 |
| 94 | Ga0068859_100033852 | 3300005617 | Bacteria | 5130 |
| 95 | Ga0068859_100037763 | 3300005617 | Bacteria | 4847 |
| 96 | Ga0068864_100018893 | 3300005618 | Bacteria | 5763 |
| 97 | Ga0068866_10003972 | 3300005718 | Bacteria | 6071 |
| 98 | Ga0068866_10008679 | 3300005718 | Bacteria | 4294 |
| 99 | Ga0068861_100017743 | 3300005719 | Bacteria | 5057 |
| 100 | Ga0068861_100034330 | 3300005719 | Bacteria | 3751 |
| 101 | Ga0068861_100044969 | 3300005719 | Bacteria | 3322 |
| 102 | Ga0068851_10001390 | 3300005834 | Bacteria | 10577 |
| 103 | Ga0068863_100002866 | 3300005841 | Bacteria | 17075 |
| 104 | Ga0068858_100000602 | 3300005842 | Bacteria | 37601 |
| 105 | Ga0068858_100036339 | 3300005842 | Bacteria | 4568 |
| 106 | Ga0068860_100002059 | 3300005843 | Bacteria | 21186 |
| 107 | Ga0068862_100016151 | 3300005844 | Bacteria | 6210 |
| 108 | Ga0081540_1001509 | 3300005983 | Bacteria | 20013 |
| 109 | Ga0081539_10000480 | 3300005985 | Bacteria | 84478 |
| 110 | Ga0081539_10001808 | 3300005985 | Bacteria | 33796 |
| 111 | Ga0081539_10001988 | 3300005985 | Bacteria | 31070 |
| 112 | Ga0081539_10006272 | 3300005985 | Bacteria | 11498 |
| 113 | Ga0070715_10000013 | 3300006163 | Bacteria | 155405 |
| 114 | Ga0070716_100000003 | 3300006173 | Bacteria | 312721 |
| 115 | Ga0070716_100000547 | 3300006173 | Bacteria | 15776 |
| 116 | Ga0097621_100000620 | 3300006237 | Bacteria | 25068 |
| 117 | Ga0097621_100004982 | 3300006237 | Bacteria | 9310 |
| 118 | Ga0068871_100001197 | 3300006358 | Bacteria | 17313 |
| 119 | Ga0068871_100014648 | 3300006358 | Bacteria | 5851 |
| 120 | Ga0075431_100071659 | 3300006847 | Bacteria | 3575 |
| 121 | Ga0075433_10009563 | 3300006852 | Bacteria | 7752 |
| 122 | Ga0075433_10012779 | 3300006852 | Bacteria | 6798 |
| 123 | Ga0075434_100002895 | 3300006871 | Bacteria | 15232 |
| 124 | Ga0075434_100027748 | 3300006871 | Bacteria | 5559 |
| 125 | Ga0075434_100035333 | 3300006871 | Bacteria | 4940 |
| 126 | Ga0075434_100044320 | 3300006871 | Bacteria | 4413 |
| 127 | Ga0075434_100072556 | 3300006871 | Bacteria | 3435 |
| 128 | Ga0075429_100038111 | 3300006880 | Unclassified | 4184 |
| 129 | Ga0075429_100047936 | 3300006880 | Bacteria | 3716 |
| 130 | Ga0068865_100008540 | 3300006881 | Bacteria | 6331 |
| 131 | Ga0075436_100000051 | 3300006914 | Bacteria | 70811 |
| 132 | Ga0075436_100000271 | 3300006914 | Bacteria | 32591 |
| 133 | Ga0075436_100005575 | 3300006914 | Bacteria | 8642 |
| 134 | Ga0097620_100025158 | 3300006931 | Bacteria | 5974 |
| 135 | Ga0097620_100033851 | 3300006931 | Bacteria | 5130 |
| 136 | Ga0097620_100037762 | 3300006931 | Bacteria | 4847 |
| 137 | Ga0075435_100000819 | 3300007076 | Bacteria | 19376 |
| 138 | Ga0075435_100011012 | 3300007076 | Bacteria | 6632 |
| 139 | Ga0075435_100014658 | 3300007076 | Bacteria | 5872 |
| 140 | Ga0075435_100036505 | 3300007076 | Bacteria | 3907 |
| 141 | Ga0105240_10025651 | 3300009093 | Bacteria | 7742 |
| 142 | Ga0105240_10063908 | 3300009093 | Bacteria | 4576 |
| 143 | Ga0111539_10003562 | 3300009094 | Bacteria | 20524 |
| 144 | Ga0111539_10007514 | 3300009094 | Bacteria | 13941 |
| 145 | Ga0105247_10000050 | 3300009101 | Bacteria | 146183 |
| 146 | Ga0105247_10000217 | 3300009101 | Bacteria | 55594 |
| 147 | Ga0105247_10020766 | 3300009101 | Bacteria | 3949 |
| 148 | Ga0114129_10018054 | 3300009147 | Viruses | 10049 |
| 149 | Ga0114129_10021727 | 3300009147 | Bacteria | 9107 |
| 150 | Ga0114129_10033767 | 3300009147 | Bacteria | 7227 |
| 151 | Ga0114129_10081708 | 3300009147 | Unclassified | 4492 |
| 152 | Ga0105243_10000029 | 3300009148 | Bacteria | 190577 |
| 153 | Ga0105243_10002136 | 3300009148 | Bacteria | 16718 |
| 154 | Ga0105243_10014294 | 3300009148 | Bacteria | 6007 |
| 155 | Ga0105241_10021643 | 3300009174 | Unclassified | 4756 |
| 156 | Ga0105242_10000009 | 3300009176 | Bacteria | 162286 |
| 157 | Ga0105242_10000581 | 3300009176 | Bacteria | 28877 |
| 158 | Ga0105242_10012588 | 3300009176 | Bacteria | 6514 |
| 159 | Ga0105242_10052361 | 3300009176 | Unclassified | 3331 |
| 160 | Ga0105248_10033040 | 3300009177 | Bacteria | 5778 |
| 161 | Ga0105237_10002924 | 3300009545 | Bacteria | 20689 |
| 162 | Ga0105237_10025808 | 3300009545 | Bacteria | 6008 |
| 163 | Ga0105237_10027738 | 3300009545 | Bacteria | 5773 |
| 164 | Ga0105238_10002086 | 3300009551 | Bacteria | 20178 |
| 165 | Ga0105238_10007150 | 3300009551 | Bacteria | 11164 |
| 166 | Ga0105249_10001651 | 3300009553 | Bacteria | 19539 |
| 167 | Ga0105249_10014054 | 3300009553 | Bacteria | 7078 |
| 168 | Ga0105249_10028429 | 3300009553 | Bacteria | 5046 |
| 169 | Ga0105239_10025302 | 3300010375 | Bacteria | 6536 |
| 170 | Ga0105239_10051197 | 3300010375 | Bacteria | 4527 |
| 171 | Ga0105246_10005142 | 3300011119 | Bacteria | 7954 |
| 172 | Ga0157373_10002783 | 3300013100 | Bacteria | 13233 |
| 173 | Ga0157378_10000047 | 3300013297 | Bacteria | 104964 |
| 174 | Ga0157378_10000314 | 3300013297 | Bacteria | 47424 |
| 175 | Ga0157378_10009598 | 3300013297 | Bacteria | 8427 |
| 176 | Ga0157378_10012402 | 3300013297 | Bacteria | 7461 |
| 177 | Ga0157378_10022567 | 3300013297 | Bacteria | 5538 |
| 178 | Ga0157378_10033717 | 3300013297 | Bacteria | 4528 |
| 179 | Ga0163162_10007029 | 3300013306 | Bacteria | 10916 |
| 180 | Ga0163162_10037743 | 3300013306 | Bacteria | 4822 |
| 181 | Ga0157372_10020177 | 3300013307 | Bacteria | 7186 |
| 182 | Ga0157375_10004211 | 3300013308 | Bacteria | 12479 |
| 183 | Ga0157375_10036730 | 3300013308 | Unclassified | 4688 |
| 184 | Ga0163163_10000640 | 3300014325 | Bacteria | 30070 |
| 185 | Ga0163163_10016828 | 3300014325 | Bacteria | 6805 |
| 186 | Ga0163163_10031094 | 3300014325 | Bacteria | 5150 |
| 187 | Ga0163163_10035548 | 3300014325 | Bacteria | 4834 |
| 188 | Ga0163163_10041726 | 3300014325 | Unclassified | 4488 |
| 189 | Ga0157380_10000343 | 3300014326 | Bacteria | 27894 |
| 190 | Ga0157380_10003326 | 3300014326 | Bacteria | 11034 |
| 191 | Ga0157380_10008978 | 3300014326 | Bacteria | 7141 |
| 192 | Ga0157379_10014525 | 3300014968 | Bacteria | 6911 |
| 193 | Ga0157376_10000017 | 3300014969 | Bacteria | 268501 |
| 194 | Ga0163161_10001849 | 3300017792 | Bacteria | 15463 |
| 195 | Ga0163161_10010347 | 3300017792 | Bacteria | 6458 |
| 196 | Ga0213876_10000041 | 3300021384 | Bacteria | 169380 |
| 197 | Ga0213876_10000246 | 3300021384 | Bacteria | 51765 |
| 198 | Ga0213876_10007578 | 3300021384 | Bacteria | 5894 |
| 199 | Ga0207697_10005532 | 3300025315 | Bacteria | 5860 |
| 200 | Ga0207656_10003895 | 3300025321 | Bacteria | 5171 |
| 201 | Ga0207653_10000015 | 3300025885 | Bacteria | 150553 |
| 202 | Ga0207653_10000276 | 3300025885 | Bacteria | 30342 |
| 203 | Ga0207653_10000912 | 3300025885 | Bacteria | 9802 |
| 204 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 205 | Ga0207680_10011860 | 3300025903 | Unclassified | 4421 |
| 206 | Ga0207647_10008902 | 3300025904 | Bacteria | 7158 |
| 207 | Ga0207647_10039405 | 3300025904 | Bacteria | 2981 |
| 208 | Ga0207685_10000013 | 3300025905 | Bacteria | 186374 |
| 209 | Ga0207643_10013807 | 3300025908 | Bacteria | 4383 |
| 210 | Ga0207684_10000387 | 3300025910 | Bacteria | 59233 |
| 211 | Ga0207684_10000701 | 3300025910 | Bacteria | 39518 |
| 212 | Ga0207684_10003144 | 3300025910 | Bacteria | 16249 |
| 213 | Ga0207684_10021042 | 3300025910 | Bacteria | 5570 |
| 214 | Ga0207684_10024309 | 3300025910 | Bacteria | 5166 |
| 215 | Ga0207684_10029436 | 3300025910 | Unclassified | 4677 |
| 216 | Ga0207707_10000024 | 3300025912 | Bacteria | 183501 |
| 217 | Ga0207707_10000741 | 3300025912 | Bacteria | 32266 |
| 218 | Ga0207707_10019266 | 3300025912 | Bacteria | 5955 |
| 219 | Ga0207695_10021332 | 3300025913 | Bacteria | 7393 |
| 220 | Ga0207671_10007374 | 3300025914 | Bacteria | 9552 |
| 221 | Ga0207663_10000035 | 3300025916 | Bacteria | 88027 |
| 222 | Ga0207660_10008162 | 3300025917 | Bacteria | 6774 |
| 223 | Ga0207662_10003556 | 3300025918 | Bacteria | 8040 |
| 224 | Ga0207652_10000189 | 3300025921 | Bacteria | 64976 |
| 225 | Ga0207646_10000020 | 3300025922 | Bacteria | 272909 |
| 226 | Ga0207646_10002263 | 3300025922 | Bacteria | 22899 |
| 227 | Ga0207646_10007111 | 3300025922 | Bacteria | 11446 |
| 228 | Ga0207646_10007115 | 3300025922 | Bacteria | 11443 |
| 229 | Ga0207646_10007747 | 3300025922 | Bacteria | 10866 |
| 230 | Ga0207681_10003344 | 3300025923 | Bacteria | 10035 |
| 231 | Ga0207694_10000931 | 3300025924 | Bacteria | 25933 |
| 232 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 233 | Ga0207650_10001186 | 3300025925 | Bacteria | 19153 |
| 234 | Ga0207644_10002180 | 3300025931 | Bacteria | 12701 |
| 235 | Ga0207644_10031381 | 3300025931 | Bacteria | 3701 |
| 236 | Ga0207706_10006919 | 3300025933 | Bacteria | 10486 |
| 237 | Ga0207686_10000010 | 3300025934 | Bacteria | 227471 |
| 238 | Ga0207686_10000496 | 3300025934 | Bacteria | 25802 |
| 239 | Ga0207686_10005230 | 3300025934 | Bacteria | 6967 |
| 240 | Ga0207709_10000052 | 3300025935 | Bacteria | 227471 |
| 241 | Ga0207709_10001154 | 3300025935 | Bacteria | 19226 |
| 242 | Ga0207709_10002585 | 3300025935 | Bacteria | 11271 |
| 243 | Ga0207670_10000351 | 3300025936 | Bacteria | 27321 |
| 244 | Ga0207665_10000038 | 3300025939 | Bacteria | 85922 |
| 245 | Ga0207665_10001777 | 3300025939 | Bacteria | 14508 |
| 246 | Ga0207691_10008763 | 3300025940 | Bacteria | 9704 |
| 247 | Ga0207689_10003115 | 3300025942 | Bacteria | 15213 |
| 248 | Ga0207651_10002332 | 3300025960 | Bacteria | 9047 |
| 249 | Ga0207703_10000355 | 3300026035 | Bacteria | 49221 |
| 250 | Ga0207703_10042432 | 3300026035 | Unclassified | 3649 |
| 251 | Ga0207639_10028314 | 3300026041 | Unclassified | 4089 |
| 252 | Ga0207708_10000126 | 3300026075 | Bacteria | 59505 |
| 253 | Ga0207641_10001775 | 3300026088 | Bacteria | 20771 |
| 254 | Ga0207641_10038408 | 3300026088 | Bacteria | 4003 |
| 255 | Ga0207648_10022747 | 3300026089 | Bacteria | 5625 |
| 256 | Ga0207676_10006243 | 3300026095 | Bacteria | 8413 |
| 257 | Ga0207674_10000023 | 3300026116 | Bacteria | 157752 |
| 258 | Ga0207674_10002846 | 3300026116 | Bacteria | 21521 |
| 259 | Ga0207674_10067989 | 3300026116 | Unclassified | 3586 |
| 260 | Ga0207675_100002805 | 3300026118 | Bacteria | 17123 |
| 261 | Ga0207675_100005270 | 3300026118 | Bacteria | 12439 |
| 262 | Ga0207675_100026919 | 3300026118 | Bacteria | 5353 |
| 263 | Ga0207675_100032778 | 3300026118 | Bacteria | 4840 |
| 264 | Ga0209588_1001233 | 3300027671 | Bacteria | 6610 |
| 265 | Ga0207428_10013998 | 3300027907 | Bacteria | 6987 |
| 266 | Ga0207428_10015378 | 3300027907 | Bacteria | 6620 |
| 267 | Ga0207428_10020922 | 3300027907 | Bacteria | 5547 |
| 268 | Ga0268266_10001124 | 3300028379 | Bacteria | 33359 |
| 269 | Ga0268264_10020313 | 3300028381 | Bacteria | 5428 |
| 270 | Ga0307408_100003089 | 3300031548 | Bacteria | 11466 |
| 271 | Ga0307405_10011784 | 3300031731 | Bacteria | 4601 |
| 272 | Ga0307413_10001506 | 3300031824 | Bacteria | 8913 |
| 273 | Ga0307410_10009241 | 3300031852 | Bacteria | 5518 |
| 274 | Ga0307406_10000987 | 3300031901 | Bacteria | 15787 |
| 275 | Ga0307412_10006065 | 3300031911 | Bacteria | 6804 |
| 276 | Ga0307416_100031403 | 3300032002 | Bacteria | 3998 |
| 277 | Ga0307414_10001583 | 3300032004 | Bacteria | 11803 |
| 278 | Ga0307415_100010354 | 3300032126 | Bacteria | 5278 |
| 279 | Ga0307415_100018751 | 3300032126 | Bacteria | 4186 |
| 280 | Ga0373951_0000881 | 3300035091 | Bacteria | 8112 |
| 281 | Ga0373927_0000179 | 3300035695 | Bacteria | 50200 |
| 282 | Ga0373925_0000500 | 3300037068 | Bacteria | 39549 |
| 283 | Ga0436365_0213934 | 3300039437 | Bacteria | 51788 |
| 284 | Ga0436365_1476328 | 3300039437 | Bacteria | 212791 |
| 285 | Ga0436365_1520167 | 3300039437 | Bacteria | 10189 |
| 286 | Ga0453683_0026925 | 3300044673 | Bacteria | 3650 |
| 287 | Ga0453684_0004862 | 3300044712 | Bacteria | 27560 |
| 288 | Ga0451576_0037897 | 3300045051 | Bacteria | 5105 |
| 289 | Ga0495629_0014377 | 3300046459 | Bacteria | 5694 |
| 290 | Ga0495651_0040547 | 3300046462 | Bacteria | 3620 |
| 291 | Ga0495580_0003557 | 3300046472 | Bacteria | 13232 |
| 292 | Ga0495580_0028174 | 3300046472 | Bacteria | 4085 |
| 293 | Ga0495582_0000242 | 3300046473 | Bacteria | 30326 |
| 294 | Ga0495582_0008371 | 3300046473 | Bacteria | 5708 |
| 295 | Ga0495639_0008815 | 3300046475 | Bacteria | 4327 |
| 296 | Ga0495662_0004573 | 3300046476 | Bacteria | 6937 |
| 297 | Ga0495630_0006239 | 3300046517 | Bacteria | 8459 |
| 298 | Ga0495663_0000363 | 3300046525 | Bacteria | 16811 |
| 299 | Ga0495666_0007016 | 3300046526 | Bacteria | 5659 |
| 300 | Ga0495652_0047244 | 3300046529 | Bacteria | 3692 |
| 301 | Ga0495640_0023808 | 3300046533 | Bacteria | 4455 |
| 302 | Ga0495669_0001864 | 3300046684 | Bacteria | 8642 |
| 303 | Ga0495669_0010887 | 3300046684 | Bacteria | 3850 |
| 304 | Ga0495669_0019949 | 3300046684 | Unclassified | 2896 |
| 305 | Ga0495581_0009792 | 3300047315 | Bacteria | 5546 |
| 306 | Ga0495636_0006345 | 3300047318 | Bacteria | 4645 |
| 307 | Ga0495674_0032985 | 3300047319 | Bacteria | 4694 |
| 308 | Ga0495680_0019777 | 3300047322 | Bacteria | 5679 |
| 309 | Ga0495680_0021353 | 3300047322 | Bacteria | 5422 |
| 310 | Ga0495684_0024389 | 3300047471 | Bacteria | 4656 |
| 311 | Ga0495614_0000592 | 3300048089 | Bacteria | 15152 |
| 312 | Ga0495614_0011376 | 3300048089 | Bacteria | 3917 |
| 313 | Ga0496102_0003285 | 3300048905 | Bacteria | 13706 |
| 314 | Ga0496106_0031838 | 3300048909 | Bacteria | 3930 |
| 315 | Ga0496109_0000125 | 3300048912 | Bacteria | 78217 |
| 316 | Ga0496114_0002334 | 3300048917 | Bacteria | 14451 |
| 317 | Ga0496115_0006914 | 3300048918 | Bacteria | 8334 |
| 318 | Ga0496115_0007294 | 3300048918 | Bacteria | 8131 |
| 319 | Ga0501038_0003831 | 3300049574 | Bacteria | 13987 |
| 320 | Ga0501217_000048 | 3300049661 | Bacteria | 13703 |
| 321 | Ga0501223_001236 | 3300049663 | Bacteria | 5961 |
| 322 | Ga0501227_000222 | 3300049665 | Bacteria | 11466 |
| 323 | Ga0501240_000103 | 3300049673 | Bacteria | 5425 |
| 324 | Ga0501221_001761 | 3300049704 | Bacteria | 3607 |
| 325 | Ga0501225_0000379 | 3300049705 | Bacteria | 14042 |
| 326 | Ga0501234_000182 | 3300049707 | Bacteria | 8744 |
| 327 | Ga0501226_000482 | 3300049853 | Bacteria | 5586 |
| 328 | nmdc:mga05p37_31536_c1 | 3300050507 | Bacteria | 6474 |
| 329 | nmdc:mga05p37_52682_c1 | 3300050507 | Bacteria | 5003 |
| 330 | nmdc:mga05p37_82832_c1 | 3300050507 | Unclassified | 3953 |
| 331 | nmdc:mga06r32_41320_c1 | 3300050510 | Bacteria | 4381 |
| 332 | nmdc:mga08y16_35062_c1 | 3300050511 | Bacteria | 5271 |
| 333 | nmdc:mga08y16_40143_c1 | 3300050511 | Bacteria | 4907 |
| 334 | nmdc:mga08y16_4199_c1 | 3300050511 | Bacteria | 15035 |
| 335 | nmdc:mga08y16_84535_c1 | 3300050511 | Bacteria | 3308 |
| 336 | nmdc:mga0n895_23179_c1 | 3300050512 | Bacteria | 5831 |
| 337 | nmdc:mga0n895_41015_c1 | 3300050512 | Bacteria | 4499 |
| 338 | nmdc:mga0n895_43134_c1 | 3300050512 | Bacteria | 4394 |
| 339 | nmdc:mga0n895_48510_c1 | 3300050512 | Bacteria | 4157 |
| 340 | nmdc:mga0rr50_13465_c1 | 3300050513 | Bacteria | 5326 |
| 341 | nmdc:mga0rr50_337_c1 | 3300050513 | Bacteria | 25438 |
| 342 | nmdc:mga08x19_116_c1 | 3300050514 | Bacteria | 70950 |
| 343 | nmdc:mga08x19_19_c1 | 3300050514 | Bacteria | 315774 |
| 344 | nmdc:mga08x19_8152_c1 | 3300050514 | Bacteria | 6227 |
| 345 | nmdc:mga0a205_15067_c1 | 3300050515 | Bacteria | 7219 |
| 346 | nmdc:mga0a205_26490_c1 | 3300050515 | Bacteria | 5530 |
| 347 | nmdc:mga0a205_6627_c1 | 3300050515 | Bacteria | 6819 |
| 348 | Ga0501084_0032801 | 3300054114 | Bacteria | 4346 |
| 349 | Ga0530510_0003429 | 3300061734 | Bacteria | 10903 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046684 | Ga0495669_0019949 | Ga0495669_0019949_15_2714 | 826 |
| 2 | 3300014325 | Ga0163163_10031094 | Ga0163163_100310941 | 863 |
| 3 | 3300025904 | Ga0207647_10039405 | Ga0207647_100394051 | 893 |
| 4 | 3300044712 | Ga0453684_0004862 | Ga0453684_0004862_7870_11019 | 909 |
| 5 | 3300045051 | Ga0451576_0037897 | Ga0451576_0037897_1688_4837 | 909 |
| 6 | 3300026116 | Ga0207674_10067989 | Ga0207674_100679892 | 910 |
| 7 | 3300050515 | nmdc:mga0a205_26490_c1 | nmdc:mga0a205_26490_c1_542_3505 | 916 |
| 8 | 3300005406 | Ga0070703_10000034 | Ga0070703_1000003433 | 917 |
| 9 | 3300005467 | Ga0070706_100000587 | Ga0070706_10000058711 | 917 |
| 10 | 3300005547 | Ga0070693_100004197 | Ga0070693_1000041973 | 917 |
| 11 | 3300025885 | Ga0207653_10000015 | Ga0207653_10000015108 | 917 |
| 12 | 3300025910 | Ga0207684_10000701 | Ga0207684_1000070110 | 917 |
| 13 | 3300005468 | Ga0070707_100025668 | Ga0070707_1000256681 | 918 |
| 14 | 3300025922 | Ga0207646_10000020 | Ga0207646_10000020115 | 918 |
| 15 | 3300046529 | Ga0495652_0047244 | Ga0495652_0047244_674_3649 | 918 |
| 16 | 3300005440 | Ga0070705_100000136 | Ga0070705_1000001367 | 920 |
| 17 | 3300006173 | Ga0070716_100000547 | Ga0070716_10000054712 | 923 |
| 18 | 3300025939 | Ga0207665_10000038 | Ga0207665_1000003813 | 923 |
| 19 | 3300006847 | Ga0075431_100071659 | Ga0075431_1000716592 | 926 |
| 20 | 3300005518 | Ga0070699_100000034 | Ga0070699_10000003413 | 927 |
| 21 | 3300005546 | Ga0070696_100000255 | Ga0070696_10000025512 | 927 |
| 22 | 3300061734 | Ga0530510_0003429 | Ga0530510_0003429_2475_5522 | 927 |
| 23 | 3300006871 | Ga0075434_100002895 | Ga0075434_1000028952 | 931 |
| 24 | 3300007076 | Ga0075435_100036505 | Ga0075435_1000365052 | 931 |
| 25 | 3300050512 | nmdc:mga0n895_23179_c1 | nmdc:mga0n895_23179_c1_675_3779 | 931 |
| 26 | 3300005468 | Ga0070707_100010571 | Ga0070707_1000105715 | 932 |
| 27 | 3300005564 | Ga0070664_100003370 | Ga0070664_1000033702 | 932 |
| 28 | 3300005577 | Ga0068857_100002182 | Ga0068857_1000021828 | 932 |
| 29 | 3300025912 | Ga0207707_10019266 | Ga0207707_100192662 | 932 |
| 30 | 3300025922 | Ga0207646_10007747 | Ga0207646_100077475 | 932 |
| 31 | 3300026116 | Ga0207674_10000023 | Ga0207674_1000002365 | 932 |
| 32 | 3300005330 | Ga0070690_100016472 | Ga0070690_1000164722 | 933 |
| 33 | 3300005343 | Ga0070687_100005508 | Ga0070687_1000055083 | 933 |
| 34 | 3300005718 | Ga0068866_10008679 | Ga0068866_100086792 | 933 |
| 35 | 3300006358 | Ga0068871_100014648 | Ga0068871_1000146483 | 933 |
| 36 | 3300006881 | Ga0068865_100008540 | Ga0068865_1000085403 | 933 |
| 37 | 3300009148 | Ga0105243_10014294 | Ga0105243_100142943 | 933 |
| 38 | 3300011119 | Ga0105246_10005142 | Ga0105246_100051425 | 933 |
| 39 | 3300017792 | Ga0163161_10010347 | Ga0163161_100103472 | 933 |
| 40 | 3300025315 | Ga0207697_10005532 | Ga0207697_100055322 | 933 |
| 41 | 3300025918 | Ga0207662_10003556 | Ga0207662_100035564 | 933 |
| 42 | 3300025940 | Ga0207691_10008763 | Ga0207691_100087636 | 933 |
| 43 | 3300026118 | Ga0207675_100026919 | Ga0207675_1000269194 | 933 |
| 44 | 3300005336 | Ga0070680_100003364 | Ga0070680_1000033644 | 935 |
| 45 | 3300005458 | Ga0070681_10000312 | Ga0070681_1000031223 | 935 |
| 46 | 3300005530 | Ga0070679_100000278 | Ga0070679_10000027823 | 935 |
| 47 | 3300025912 | Ga0207707_10000024 | Ga0207707_1000002468 | 935 |
| 48 | 3300025917 | Ga0207660_10008162 | Ga0207660_100081623 | 935 |
| 49 | 3300025921 | Ga0207652_10000189 | Ga0207652_1000018912 | 935 |
| 50 | 3300047315 | Ga0495581_0009792 | Ga0495581_0009792_1991_5026 | 935 |
| 51 | 3300014968 | Ga0157379_10014525 | Ga0157379_100145253 | 937 |
| 52 | 3300027907 | Ga0207428_10020922 | Ga0207428_100209222 | 942 |
| 53 | 3300009545 | Ga0105237_10025808 | Ga0105237_100258082 | 943 |
| 54 | 3300046472 | Ga0495580_0003557 | Ga0495580_0003557_8577_11687 | 945 |
| 55 | 3300046473 | Ga0495582_0000242 | Ga0495582_0000242_26620_29730 | 945 |
| 56 | 3300005288 | Ga0065714_10064481 | Ga0065714_1006448145 | 947 |
| 57 | 3300005290 | Ga0065712_10000143 | Ga0065712_1000014345 | 947 |
| 58 | 3300005467 | Ga0070706_100043656 | Ga0070706_1000436562 | 947 |
| 59 | 3300005471 | Ga0070698_100011827 | Ga0070698_10001182710 | 947 |
| 60 | 3300005983 | Ga0081540_1001509 | Ga0081540_10015097 | 947 |
| 61 | 3300005445 | Ga0070708_100009963 | Ga0070708_1000099634 | 949 |
| 62 | 3300009093 | Ga0105240_10025651 | Ga0105240_100256511 | 949 |
| 63 | 3300025913 | Ga0207695_10021332 | Ga0207695_100213324 | 949 |
| 64 | 3300007076 | Ga0075435_100011012 | Ga0075435_1000110121 | 950 |
| 65 | 3300031731 | Ga0307405_10011784 | Ga0307405_100117841 | 950 |
| 66 | 3300031824 | Ga0307413_10001506 | Ga0307413_100015063 | 950 |
| 67 | 3300032002 | Ga0307416_100031403 | Ga0307416_1000314032 | 950 |
| 68 | 3300005718 | Ga0068866_10003972 | Ga0068866_100039725 | 951 |
| 69 | 3300027671 | Ga0209588_1001233 | Ga0209588_10012331 | 952 |
| 70 | 3300005290 | Ga0065712_10001320 | Ga0065712_100013204 | 953 |
| 71 | 3300005459 | Ga0068867_100018101 | Ga0068867_1000181012 | 953 |
| 72 | 3300005536 | Ga0070697_100024434 | Ga0070697_1000244344 | 953 |
| 73 | 3300005546 | Ga0070696_100021389 | Ga0070696_1000213892 | 953 |
| 74 | 3300005843 | Ga0068860_100002059 | Ga0068860_10000205912 | 953 |
| 75 | 3300013297 | Ga0157378_10000314 | Ga0157378_1000031432 | 953 |
| 76 | 3300025934 | Ga0207686_10005230 | Ga0207686_100052304 | 953 |
| 77 | 3300048905 | Ga0496102_0003285 | Ga0496102_0003285_65_3262 | 953 |
| 78 | 3300048909 | Ga0496106_0031838 | Ga0496106_0031838_294_3491 | 953 |
| 79 | 3300050507 | nmdc:mga05p37_82832_c1 | nmdc:mga05p37_82832_c1_26_3076 | 953 |
| 80 | 3300005441 | Ga0070700_100000215 | Ga0070700_10000021517 | 954 |
| 81 | 3300026075 | Ga0207708_10000126 | Ga0207708_100001269 | 954 |
| 82 | 3300046684 | Ga0495669_0010887 | Ga0495669_0010887_594_3665 | 954 |
| 83 | 3300050511 | nmdc:mga08y16_40143_c1 | nmdc:mga08y16_40143_c1_1449_4370 | 954 |
| 84 | 3300005337 | Ga0070682_100009314 | Ga0070682_1000093143 | 955 |
| 85 | 3300005345 | Ga0070692_10005018 | Ga0070692_100050182 | 955 |
| 86 | 3300005406 | Ga0070703_10001111 | Ga0070703_100011114 | 955 |
| 87 | 3300005439 | Ga0070711_100000049 | Ga0070711_1000000499 | 955 |
| 88 | 3300005440 | Ga0070705_100001309 | Ga0070705_1000013091 | 955 |
| 89 | 3300005549 | Ga0070704_100003947 | Ga0070704_1000039474 | 955 |
| 90 | 3300005834 | Ga0068851_10001390 | Ga0068851_100013903 | 955 |
| 91 | 3300005842 | Ga0068858_100036339 | Ga0068858_1000363393 | 955 |
| 92 | 3300005985 | Ga0081539_10001808 | Ga0081539_1000180820 | 955 |
| 93 | 3300006914 | Ga0075436_100000271 | Ga0075436_10000027119 | 955 |
| 94 | 3300009545 | Ga0105237_10002924 | Ga0105237_100029245 | 955 |
| 95 | 3300025321 | Ga0207656_10003895 | Ga0207656_100038952 | 955 |
| 96 | 3300025885 | Ga0207653_10000912 | Ga0207653_100009124 | 955 |
| 97 | 3300025914 | Ga0207671_10007374 | Ga0207671_100073745 | 955 |
| 98 | 3300025916 | Ga0207663_10000035 | Ga0207663_1000003518 | 955 |
| 99 | 3300044673 | Ga0453683_0026925 | Ga0453683_0026925_21_3074 | 955 |
| 100 | 3300050514 | nmdc:mga08x19_19_c1 | nmdc:mga08x19_19_c1_73470_76481 | 955 |
| 101 | 3300013306 | Ga0163162_10007029 | Ga0163162_100070297 | 956 |
| 102 | 3300005330 | Ga0070690_100001615 | Ga0070690_1000016152 | 957 |
| 103 | 3300005544 | Ga0070686_100001958 | Ga0070686_1000019583 | 957 |
| 104 | 3300006914 | Ga0075436_100005575 | Ga0075436_1000055754 | 957 |
| 105 | 3300013297 | Ga0157378_10033717 | Ga0157378_100337172 | 957 |
| 106 | 3300021384 | Ga0213876_10000041 | Ga0213876_100000417 | 957 |
| 107 | 3300039437 | Ga0436365_1476328 | Ga0436365_1476328_48671_51691 | 957 |
| 108 | 3300050514 | nmdc:mga08x19_8152_c1 | nmdc:mga08x19_8152_c1_2548_5667 | 957 |
| 109 | 3300021384 | Ga0213876_10000246 | Ga0213876_1000024626 | 958 |
| 110 | 3300039437 | Ga0436365_0213934 | Ga0436365_0213934_29734_32760 | 958 |
| 111 | 3300046459 | Ga0495629_0014377 | Ga0495629_0014377_2069_5176 | 958 |
| 112 | 3300046462 | Ga0495651_0040547 | Ga0495651_0040547_79_3186 | 958 |
| 113 | 3300046472 | Ga0495580_0028174 | Ga0495580_0028174_256_3363 | 958 |
| 114 | 3300046473 | Ga0495582_0008371 | Ga0495582_0008371_2238_5345 | 958 |
| 115 | 3300046475 | Ga0495639_0008815 | Ga0495639_0008815_208_3315 | 958 |
| 116 | 3300046476 | Ga0495662_0004573 | Ga0495662_0004573_1537_4644 | 958 |
| 117 | 3300046526 | Ga0495666_0007016 | Ga0495666_0007016_1153_4260 | 958 |
| 118 | 3300047322 | Ga0495680_0021353 | Ga0495680_0021353_340_3447 | 958 |
| 119 | 3300048089 | Ga0495614_0000592 | Ga0495614_0000592_11080_14187 | 958 |
| 120 | 3300005438 | Ga0070701_10013662 | Ga0070701_100136622 | 959 |
| 121 | 3300005467 | Ga0070706_100000019 | Ga0070706_10000001921 | 959 |
| 122 | 3300009101 | Ga0105247_10000217 | Ga0105247_1000021737 | 959 |
| 123 | 3300025910 | Ga0207684_10000387 | Ga0207684_1000038729 | 959 |
| 124 | 3300026035 | Ga0207703_10042432 | Ga0207703_100424321 | 959 |
| 125 | 3300028381 | Ga0268264_10020313 | Ga0268264_100203132 | 959 |
| 126 | 3300005331 | Ga0070670_100055828 | Ga0070670_1000558281 | 960 |
| 127 | 3300005355 | Ga0070671_100006488 | Ga0070671_1000064886 | 961 |
| 128 | 3300009551 | Ga0105238_10002086 | Ga0105238_100020863 | 961 |
| 129 | 3300009551 | Ga0105238_10007150 | Ga0105238_100071505 | 961 |
| 130 | 3300025924 | Ga0207694_10000931 | Ga0207694_1000093110 | 961 |
| 131 | 3300025931 | Ga0207644_10031381 | Ga0207644_100313811 | 961 |
| 132 | 3300035091 | Ga0373951_0000881 | Ga0373951_0000881_5019_8045 | 961 |
| 133 | 3300049574 | Ga0501038_0003831 | Ga0501038_0003831_4905_7910 | 962 |
| 134 | 3300005841 | Ga0068863_100002866 | Ga0068863_10000286616 | 964 |
| 135 | 3300006871 | Ga0075434_100044320 | Ga0075434_1000443202 | 964 |
| 136 | 3300009176 | Ga0105242_10052361 | Ga0105242_100523611 | 964 |
| 137 | 3300013297 | Ga0157378_10009598 | Ga0157378_100095982 | 964 |
| 138 | 3300013308 | Ga0157375_10036730 | Ga0157375_100367302 | 964 |
| 139 | 3300050512 | nmdc:mga0n895_43134_c1 | nmdc:mga0n895_43134_c1_125_3184 | 964 |
| 140 | 3300054114 | Ga0501084_0032801 | Ga0501084_0032801_861_3842 | 964 |
| 141 | 3300005290 | Ga0065712_10007284 | Ga0065712_100072842 | 965 |
| 142 | 3300005293 | Ga0065715_10007201 | Ga0065715_100072011 | 965 |
| 143 | 3300006880 | Ga0075429_100047936 | Ga0075429_1000479363 | 965 |
| 144 | 3300009553 | Ga0105249_10001651 | Ga0105249_1000165112 | 965 |
| 145 | 3300002459 | JGI24751J29686_10000076 | JGI24751J29686_1000007627 | 966 |
| 146 | 3300005331 | Ga0070670_100000428 | Ga0070670_10000042827 | 966 |
| 147 | 3300005353 | Ga0070669_100011687 | Ga0070669_1000116875 | 966 |
| 148 | 3300005467 | Ga0070706_100045200 | Ga0070706_1000452002 | 966 |
| 149 | 3300005617 | Ga0068859_100025157 | Ga0068859_1000251573 | 966 |
| 150 | 3300006931 | Ga0097620_100025158 | Ga0097620_1000251583 | 966 |
| 151 | 3300009177 | Ga0105248_10033040 | Ga0105248_100330402 | 966 |
| 152 | 3300013306 | Ga0163162_10037743 | Ga0163162_100377432 | 966 |
| 153 | 3300014325 | Ga0163163_10000640 | Ga0163163_100006404 | 966 |
| 154 | 3300025910 | Ga0207684_10021042 | Ga0207684_100210423 | 966 |
| 155 | 3300025923 | Ga0207681_10003344 | Ga0207681_100033442 | 966 |
| 156 | 3300025925 | Ga0207650_10000001 | Ga0207650_1000000126 | 966 |
| 157 | 3300025925 | Ga0207650_10001186 | Ga0207650_1000118612 | 966 |
| 158 | 3300035695 | Ga0373927_0000179 | Ga0373927_0000179_17491_20550 | 966 |
| 159 | 3300037068 | Ga0373925_0000500 | Ga0373925_0000500_26193_29252 | 966 |
| 160 | 3300046517 | Ga0495630_0006239 | Ga0495630_0006239_4265_7324 | 966 |
| 161 | 3300005331 | Ga0070670_100014249 | Ga0070670_1000142492 | 967 |
| 162 | 3300005354 | Ga0070675_100005392 | Ga0070675_1000053922 | 967 |
| 163 | 3300005444 | Ga0070694_100001750 | Ga0070694_1000017502 | 967 |
| 164 | 3300005468 | Ga0070707_100002616 | Ga0070707_1000026161 | 967 |
| 165 | 3300009176 | Ga0105242_10012588 | Ga0105242_100125883 | 967 |
| 166 | 3300025922 | Ga0207646_10002263 | Ga0207646_1000226315 | 967 |
| 167 | 3300005295 | Ga0065707_10086218 | Ga0065707_100862182 | 968 |
| 168 | 3300005617 | Ga0068859_100033852 | Ga0068859_1000338523 | 968 |
| 169 | 3300006880 | Ga0075429_100038111 | Ga0075429_1000381112 | 968 |
| 170 | 3300006931 | Ga0097620_100033851 | Ga0097620_1000338513 | 968 |
| 171 | 3300009094 | Ga0111539_10003562 | Ga0111539_1000356213 | 968 |
| 172 | 3300027907 | Ga0207428_10013998 | Ga0207428_100139985 | 968 |
| 173 | 3300032126 | Ga0307415_100018751 | Ga0307415_1000187512 | 968 |
| 174 | 3300049673 | Ga0501240_000103 | Ga0501240_000103_504_3500 | 968 |
| 175 | 3300005406 | Ga0070703_10000273 | Ga0070703_1000027314 | 969 |
| 176 | 3300009148 | Ga0105243_10000029 | Ga0105243_1000002986 | 969 |
| 177 | 3300009176 | Ga0105242_10000009 | Ga0105242_1000000992 | 969 |
| 178 | 3300014325 | Ga0163163_10041726 | Ga0163163_100417261 | 969 |
| 179 | 3300025885 | Ga0207653_10000276 | Ga0207653_1000027611 | 969 |
| 180 | 3300025934 | Ga0207686_10000010 | Ga0207686_1000001091 | 969 |
| 181 | 3300025935 | Ga0207709_10000052 | Ga0207709_1000005291 | 969 |
| 182 | 3300050507 | nmdc:mga05p37_52682_c1 | nmdc:mga05p37_52682_c1_456_3473 | 969 |
| 183 | 3300005295 | Ga0065707_10001961 | Ga0065707_100019611 | 970 |
| 184 | 3300005549 | Ga0070704_100005807 | Ga0070704_1000058072 | 970 |
| 185 | 3300005617 | Ga0068859_100037763 | Ga0068859_1000377632 | 970 |
| 186 | 3300006931 | Ga0097620_100037762 | Ga0097620_1000377622 | 970 |
| 187 | 3300014326 | Ga0157380_10000343 | Ga0157380_1000034318 | 970 |
| 188 | 3300027907 | Ga0207428_10015378 | Ga0207428_100153783 | 970 |
| 189 | 3300046525 | Ga0495663_0000363 | Ga0495663_0000363_3592_6633 | 971 |
| 190 | 3300046684 | Ga0495669_0001864 | Ga0495669_0001864_3546_6539 | 971 |
| 191 | 3300048912 | Ga0496109_0000125 | Ga0496109_0000125_40750_43698 | 971 |
| 192 | 3300048918 | Ga0496115_0006914 | Ga0496115_0006914_1725_4853 | 971 |
| 193 | 3300005445 | Ga0070708_100000354 | Ga0070708_1000003547 | 972 |
| 194 | 3300005518 | Ga0070699_100009233 | Ga0070699_1000092335 | 972 |
| 195 | 3300005536 | Ga0070697_100007630 | Ga0070697_1000076304 | 972 |
| 196 | 3300025908 | Ga0207643_10013807 | Ga0207643_100138073 | 972 |
| 197 | 3300026088 | Ga0207641_10001775 | Ga0207641_100017757 | 972 |
| 198 | 3300005459 | Ga0068867_100014832 | Ga0068867_1000148323 | 973 |
| 199 | 3300005471 | Ga0070698_100031053 | Ga0070698_1000310535 | 973 |
| 200 | 3300026089 | Ga0207648_10022747 | Ga0207648_100227472 | 973 |
| 201 | 3300046533 | Ga0495640_0023808 | Ga0495640_0023808_535_3666 | 973 |
| 202 | 3300047319 | Ga0495674_0032985 | Ga0495674_0032985_844_3975 | 973 |
| 203 | 3300047322 | Ga0495680_0019777 | Ga0495680_0019777_83_3214 | 973 |
| 204 | 3300047471 | Ga0495684_0024389 | Ga0495684_0024389_1258_4389 | 973 |
| 205 | 3300048089 | Ga0495614_0011376 | Ga0495614_0011376_676_3807 | 973 |
| 206 | 3300003203 | JGI25406J46586_10002270 | JGI25406J46586_100022706 | 974 |
| 207 | 3300005985 | Ga0081539_10006272 | Ga0081539_100062724 | 974 |
| 208 | 3300014325 | Ga0163163_10035548 | Ga0163163_100355482 | 974 |
| 209 | 3300050512 | nmdc:mga0n895_48510_c1 | nmdc:mga0n895_48510_c1_244_3264 | 974 |
| 210 | 3300005719 | Ga0068861_100017743 | Ga0068861_1000177432 | 975 |
| 211 | 3300026118 | Ga0207675_100002805 | Ga0207675_1000028053 | 975 |
| 212 | 3300005444 | Ga0070694_100002376 | Ga0070694_1000023763 | 976 |
| 213 | 3300009094 | Ga0111539_10007514 | Ga0111539_100075143 | 976 |
| 214 | 3300031548 | Ga0307408_100003089 | Ga0307408_1000030894 | 976 |
| 215 | 3300031901 | Ga0307406_10000987 | Ga0307406_100009879 | 976 |
| 216 | 3300031911 | Ga0307412_10006065 | Ga0307412_100060654 | 976 |
| 217 | 3300032004 | Ga0307414_10001583 | Ga0307414_100015833 | 976 |
| 218 | 3300032126 | Ga0307415_100010354 | Ga0307415_1000103542 | 976 |
| 219 | 3300049661 | Ga0501217_000048 | Ga0501217_000048_1306_4326 | 976 |
| 220 | 3300049663 | Ga0501223_001236 | Ga0501223_001236_1910_4930 | 976 |
| 221 | 3300049665 | Ga0501227_000222 | Ga0501227_000222_1305_4325 | 976 |
| 222 | 3300049704 | Ga0501221_001761 | Ga0501221_001761_532_3552 | 976 |
| 223 | 3300049705 | Ga0501225_0000379 | Ga0501225_0000379_10306_13326 | 976 |
| 224 | 3300049707 | Ga0501234_000182 | Ga0501234_000182_4286_7306 | 976 |
| 225 | 3300049853 | Ga0501226_000482 | Ga0501226_000482_2106_5126 | 976 |
| 226 | 3300050511 | nmdc:mga08y16_35062_c1 | nmdc:mga08y16_35062_c1_2225_5242 | 976 |
| 227 | 3300005471 | Ga0070698_100000134 | Ga0070698_10000013414 | 977 |
| 228 | 3300005539 | Ga0068853_100019161 | Ga0068853_1000191613 | 977 |
| 229 | 3300006237 | Ga0097621_100004982 | Ga0097621_1000049827 | 977 |
| 230 | 3300014969 | Ga0157376_10000017 | Ga0157376_10000017209 | 977 |
| 231 | 3300048917 | Ga0496114_0002334 | Ga0496114_0002334_5320_8475 | 977 |
| 232 | 3300048918 | Ga0496115_0007294 | Ga0496115_0007294_4824_7979 | 977 |
| 233 | 3300009147 | Ga0114129_10021727 | Ga0114129_100217276 | 978 |
| 234 | 3300013297 | Ga0157378_10022567 | Ga0157378_100225671 | 978 |
| 235 | 3300013307 | Ga0157372_10020177 | Ga0157372_100201775 | 978 |
| 236 | 3300050510 | nmdc:mga06r32_41320_c1 | nmdc:mga06r32_41320_c1_438_3386 | 978 |
| 237 | 3300050511 | nmdc:mga08y16_4199_c1 | nmdc:mga08y16_4199_c1_10978_13956 | 978 |
| 238 | 3300005518 | Ga0070699_100031414 | Ga0070699_1000314144 | 979 |
| 239 | 3300005536 | Ga0070697_100000150 | Ga0070697_1000001508 | 979 |
| 240 | 3300013297 | Ga0157378_10012402 | Ga0157378_100124022 | 979 |
| 241 | 3300005330 | Ga0070690_100002614 | Ga0070690_1000026144 | 980 |
| 242 | 3300005406 | Ga0070703_10004394 | Ga0070703_100043942 | 980 |
| 243 | 3300005467 | Ga0070706_100038945 | Ga0070706_1000389452 | 980 |
| 244 | 3300005719 | Ga0068861_100034330 | Ga0068861_1000343302 | 980 |
| 245 | 3300005844 | Ga0068862_100016151 | Ga0068862_1000161513 | 980 |
| 246 | 3300005985 | Ga0081539_10000480 | Ga0081539_1000048020 | 980 |
| 247 | 3300025910 | Ga0207684_10024309 | Ga0207684_100243092 | 980 |
| 248 | 3300025910 | Ga0207684_10029436 | Ga0207684_100294362 | 980 |
| 249 | 3300005458 | Ga0070681_10000976 | Ga0070681_1000097612 | 981 |
| 250 | 3300006852 | Ga0075433_10012779 | Ga0075433_100127794 | 981 |
| 251 | 3300006871 | Ga0075434_100035333 | Ga0075434_1000353333 | 981 |
| 252 | 3300025903 | Ga0207680_10011860 | Ga0207680_100118601 | 981 |
| 253 | 3300005367 | Ga0070667_100022199 | Ga0070667_1000221993 | 982 |
| 254 | 3300005548 | Ga0070665_100002551 | Ga0070665_1000025511 | 982 |
| 255 | 3300005618 | Ga0068864_100018893 | Ga0068864_1000188934 | 982 |
| 256 | 3300006914 | Ga0075436_100000051 | Ga0075436_10000005148 | 982 |
| 257 | 3300007076 | Ga0075435_100000819 | Ga0075435_1000008193 | 982 |
| 258 | 3300021384 | Ga0213876_10007578 | Ga0213876_100075781 | 982 |
| 259 | 3300026088 | Ga0207641_10038408 | Ga0207641_100384081 | 982 |
| 260 | 3300028379 | Ga0268266_10001124 | Ga0268266_1000112420 | 982 |
| 261 | 3300039437 | Ga0436365_1520167 | Ga0436365_1520167_12_3113 | 982 |
| 262 | 3300050513 | nmdc:mga0rr50_337_c1 | nmdc:mga0rr50_337_c1_20966_23986 | 982 |
| 263 | 3300050514 | nmdc:mga08x19_116_c1 | nmdc:mga08x19_116_c1_15060_18080 | 982 |
| 264 | 3300005337 | Ga0070682_100003676 | Ga0070682_1000036762 | 983 |
| 265 | 3300005340 | Ga0070689_100006742 | Ga0070689_1000067421 | 983 |
| 266 | 3300005441 | Ga0070700_100010271 | Ga0070700_1000102713 | 983 |
| 267 | 3300005539 | Ga0068853_100002289 | Ga0068853_1000022895 | 983 |
| 268 | 3300005985 | Ga0081539_10001988 | Ga0081539_100019888 | 983 |
| 269 | 3300006237 | Ga0097621_100000620 | Ga0097621_10000062010 | 983 |
| 270 | 3300006358 | Ga0068871_100001197 | Ga0068871_1000011979 | 983 |
| 271 | 3300009101 | Ga0105247_10020766 | Ga0105247_100207662 | 983 |
| 272 | 3300009147 | Ga0114129_10081708 | Ga0114129_100817082 | 983 |
| 273 | 3300025904 | Ga0207647_10008902 | Ga0207647_100089023 | 983 |
| 274 | 3300025936 | Ga0207670_10000351 | Ga0207670_1000035111 | 983 |
| 275 | 3300026041 | Ga0207639_10028314 | Ga0207639_100283142 | 983 |
| 276 | 3300009174 | Ga0105241_10021643 | Ga0105241_100216432 | 984 |
| 277 | 3300013100 | Ga0157373_10002783 | Ga0157373_100027833 | 984 |
| 278 | 3300014325 | Ga0163163_10016828 | Ga0163163_100168284 | 984 |
| 279 | 3300005364 | Ga0070673_100049870 | Ga0070673_1000498701 | 985 |
| 280 | 3300009147 | Ga0114129_10033767 | Ga0114129_100337672 | 985 |
| 281 | 3300025960 | Ga0207651_10002332 | Ga0207651_100023321 | 985 |
| 282 | 3300050507 | nmdc:mga05p37_31536_c1 | nmdc:mga05p37_31536_c1_2793_5813 | 985 |
| 283 | 3300017792 | Ga0163161_10001849 | Ga0163161_100018498 | 986 |
| 284 | 3300005467 | Ga0070706_100019911 | Ga0070706_1000199113 | 987 |
| 285 | 3300005468 | Ga0070707_100033191 | Ga0070707_1000331913 | 987 |
| 286 | 3300005471 | Ga0070698_100005556 | Ga0070698_1000055569 | 987 |
| 287 | 3300025910 | Ga0207684_10003144 | Ga0207684_100031441 | 987 |
| 288 | 3300025922 | Ga0207646_10007111 | Ga0207646_100071118 | 987 |
| 289 | 3300005468 | Ga0070707_100000247 | Ga0070707_10000024742 | 988 |
| 290 | 3300006173 | Ga0070716_100000003 | Ga0070716_100000003270 | 988 |
| 291 | 3300025922 | Ga0207646_10007115 | Ga0207646_100071155 | 988 |
| 292 | 3300025939 | Ga0207665_10001777 | Ga0207665_1000177712 | 988 |
| 293 | 3300005459 | Ga0068867_100030562 | Ga0068867_1000305622 | 989 |
| 294 | 3300005578 | Ga0068854_100027619 | Ga0068854_1000276191 | 989 |
| 295 | 3300005719 | Ga0068861_100044969 | Ga0068861_1000449691 | 989 |
| 296 | 3300006871 | Ga0075434_100072556 | Ga0075434_1000725562 | 989 |
| 297 | 3300007076 | Ga0075435_100014658 | Ga0075435_1000146582 | 989 |
| 298 | 3300014326 | Ga0157380_10008978 | Ga0157380_100089781 | 989 |
| 299 | 3300025935 | Ga0207709_10002585 | Ga0207709_100025858 | 989 |
| 300 | 3300026118 | Ga0207675_100032778 | Ga0207675_1000327781 | 989 |
| 301 | 3300050511 | nmdc:mga08y16_84535_c1 | nmdc:mga08y16_84535_c1_114_3176 | 989 |
| 302 | 3300050512 | nmdc:mga0n895_41015_c1 | nmdc:mga0n895_41015_c1_1259_4345 | 989 |
| 303 | 3300050513 | nmdc:mga0rr50_13465_c1 | nmdc:mga0rr50_13465_c1_1993_5079 | 989 |
| 304 | 3300050515 | nmdc:mga0a205_15067_c1 | nmdc:mga0a205_15067_c1_2447_5533 | 989 |
| 305 | 3300005295 | Ga0065707_10007416 | Ga0065707_100074161 | 990 |
| 306 | 3300005293 | Ga0065715_10002541 | Ga0065715_1000254110 | 994 |
| 307 | 3300050515 | nmdc:mga0a205_6627_c1 | nmdc:mga0a205_6627_c1_1667_4711 | 994 |
| 308 | 3300010375 | Ga0105239_10025302 | Ga0105239_100253027 | 995 |
| 309 | 3300025912 | Ga0207707_10000741 | Ga0207707_1000074125 | 995 |
| 310 | 3300006163 | Ga0070715_10000013 | Ga0070715_1000001341 | 996 |
| 311 | 3300025905 | Ga0207685_10000013 | Ga0207685_1000001340 | 996 |
| 312 | 3300005471 | Ga0070698_100013125 | Ga0070698_1000131253 | 998 |
| 313 | 3300005355 | Ga0070671_100044853 | Ga0070671_1000448531 | 999 |
| 314 | 3300009553 | Ga0105249_10028429 | Ga0105249_100284292 | 999 |
| 315 | 3300031852 | Ga0307410_10009241 | Ga0307410_100092411 | 999 |
| 316 | 3300005445 | Ga0070708_100065422 | Ga0070708_1000654221 | 1000 |
| 317 | 3300014326 | Ga0157380_10003326 | Ga0157380_100033264 | 1000 |
| 318 | 3300005563 | Ga0068855_100023109 | Ga0068855_1000231094 | 1001 |
| 319 | 3300005564 | Ga0070664_100026376 | Ga0070664_1000263762 | 1001 |
| 320 | 3300005577 | Ga0068857_100029332 | Ga0068857_1000293321 | 1001 |
| 321 | 3300025933 | Ga0207706_10006919 | Ga0207706_100069197 | 1001 |
| 322 | 3300026116 | Ga0207674_10002846 | Ga0207674_100028463 | 1001 |
| 323 | 3300009147 | Ga0114129_10018054 | Ga0114129_100180543 | 1005 |
| 324 | 3300009553 | Ga0105249_10014054 | Ga0105249_100140544 | 1005 |
| 325 | 3300026095 | Ga0207676_10006243 | Ga0207676_100062432 | 1005 |
| 326 | 3300005458 | Ga0070681_10016945 | Ga0070681_100169456 | 1006 |
| 327 | 3300009093 | Ga0105240_10063908 | Ga0105240_100639082 | 1006 |
| 328 | 3300009545 | Ga0105237_10027738 | Ga0105237_100277383 | 1006 |
| 329 | 3300010375 | Ga0105239_10051197 | Ga0105239_100511972 | 1006 |
| 330 | 3300005536 | Ga0070697_100045196 | Ga0070697_1000451961 | 1007 |
| 331 | 3300006852 | Ga0075433_10009563 | Ga0075433_100095636 | 1010 |
| 332 | 3300025942 | Ga0207689_10003115 | Ga0207689_1000311510 | 1010 |
| 333 | 3300026118 | Ga0207675_100005270 | Ga0207675_1000052704 | 1010 |
| 334 | 3300009148 | Ga0105243_10002136 | Ga0105243_100021365 | 1017 |
| 335 | 3300009176 | Ga0105242_10000581 | Ga0105242_1000058116 | 1017 |
| 336 | 3300013297 | Ga0157378_10000047 | Ga0157378_100000475 | 1017 |
| 337 | 3300013308 | Ga0157375_10004211 | Ga0157375_100042114 | 1017 |
| 338 | 3300025934 | Ga0207686_10000496 | Ga0207686_1000049610 | 1017 |
| 339 | 3300025935 | Ga0207709_10001154 | Ga0207709_1000115414 | 1017 |
| 340 | 3300002074 | JGI24748J21848_1000014 | JGI24748J21848_1000014110 | 1020 |
| 341 | 3300002239 | JGI24034J26672_10000012 | JGI24034J26672_1000001214 | 1020 |
| 342 | 3300005355 | Ga0070671_100034638 | Ga0070671_1000346382 | 1020 |
| 343 | 3300005842 | Ga0068858_100000602 | Ga0068858_1000006024 | 1020 |
| 344 | 3300006871 | Ga0075434_100027748 | Ga0075434_1000277481 | 1020 |
| 345 | 3300009101 | Ga0105247_10000050 | Ga0105247_10000050109 | 1020 |
| 346 | 3300025900 | Ga0207710_10000003 | Ga0207710_10000003899 | 1020 |
| 347 | 3300025931 | Ga0207644_10002180 | Ga0207644_100021804 | 1020 |
| 348 | 3300026035 | Ga0207703_10000355 | Ga0207703_1000035517 | 1020 |
| 349 | 3300047318 | Ga0495636_0006345 | Ga0495636_0006345_13_3075 | 1020 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p0d-assembly1.cif.gz_A | the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions | 0.8176 | 40 | 98 |
| 4v4c-assembly3.cif.gz_F | crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici | 0.8092 | 39 | 121 |
| 5fp2-assembly1.cif.gz_A | crystal structure of the siderophore receptor pira from pseudomonas aeruginosa | 0.8065 | 144 | 1020 |
| 3m8b-assembly1.cif.gz_A | crystal structure of spin-labeled btub v10r1 in the apo state | 0.8061 | 139 | 1020 |
| 5fp2-assembly1.cif.gz_A | crystal structure of the siderophore receptor pira from pseudomonas aeruginosa | 0.7959 | 144 | 1020 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FFQ7_314_405_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.9126 | 41 | 124 | 2.60.40.1120 |
| af_E7F254_344_443_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.9088 | 41 | 124 | 2.60.40.1120 |
| af_O75976_383_462_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.899 | 41 | 123 | 2.60.40.1120 |
| af_O75976_383_462_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.878 | 41 | 123 | 2.60.40.1120 |
| af_I1NBD7_943_1024_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.8762 | 41 | 96 | 2.60.40.1120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8JMT1-F1-model_v4 | Alpha-2-macroglobulin bait region domain-containing protein | 0.9561 | 38 | 125 |
GO:0004866
GO:0016020 GO:0030246 |
| AF-A0A355UVY8-F1-model_v4 | Carboxypeptidase regulatory-like domain-containing protein | 0.9502 | 39 | 125 |
|
| AF-A0A2V7UJC3-F1-model_v4 | Carboxypeptidase regulatory-like domain-containing protein | 0.9379 | 40 | 125 |
|
| AF-A0A3D6EHI3-F1-model_v4 | TonB-dependent receptor | 0.9358 | 35 | 124 |
|
| AF-A0A2V8DXY9-F1-model_v4 | TonB-dependent receptor | 0.9355 | 37 | 125 |
GO:0030246
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar