F417796

General Info

Members Datasets Scaffolds Average Seq Length
349 252 344 523

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100024312|Ga0068868_1000243123
Length 594
Sequence LISSDDILSITQRVQAENGRPRRFVYHAADALHCDSACATDRMGKETSVSDHGRRGSGRRDFLRAGLLSGAAAAGALPVLAAAQNAATSEPHVSSFEFDEITIGQLADGMASGKYTASGIAEKYLARIEEIDRGGPRLNSVIETNPDALEIAAGLDKERKEKGPRGPLHGIPVLVKDNLDTADKMMTTAGSLALVGSKPAKDSFVVQRLRAAGAVILGKTNLSEWANIRSTHSTSGWSGRGGQTKNAYALDRNPCGSSSGSGAAISANLCAVAIGTETDGSIVCPANANGIVGIKPTVGLTSRSGIIPISHTQDGAGPLTRTVRDAAILLGAITGVDPEDKATSESQGKGFSDYTKFLDPKGLKGARIGVVRKYFGFSDSVDRLMDECIAVLKKEGAILVDPADITTLGKFDDSEFMVFLYELKADLNAYLKKLGPSAPVKSLQEIINFNEKNRDKEMPYFGQDIFLKAEAKGSLTEKEYLDAMAKNRQLAKIEGIDVLMDKHKLDALVAPTGSPAWLTDLVNGDHSGGGSSNAAAVAGYPNINVPAGNLWGLPVGISFFGRAWSEPTLIKLAYAFEQATKARITPKFLPTAKL

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221586 Lysobacter sp. Root667 Isolate Unclassified
3 2643221593 Lysobacter sp. Root690 Isolate Unclassified
4 2643221612 Lysobacter sp. Root76 Isolate Unclassified
5 2643221727 Lysobacter sp. Root96 Isolate Unclassified
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
249 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
250 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0
Rhizoplane 5.44
Rhizosphere 83.95
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001720 3300001976 Bacteria 2931
2 JGI25151J46595_10000875 3300003187 Bacteria 23771
3 Ga0055526_1002188 3300003771 Bacteria 13402
4 Ga0055537_1001018 3300003773 Bacteria 12676
5 Ga0055524_1001196 3300003775 Bacteria 15423
6 Ga0055534_1000515 3300003784 Bacteria 20870
7 Ga0055528_1000337 3300003790 Bacteria 39377
8 Ga0065715_10000384 3300005293 Bacteria 12754
9 Ga0070658_10111221 3300005327 Bacteria 2270
10 Ga0070683_100000306 3300005329 Bacteria 33609
11 Ga0070690_100000023 3300005330 Bacteria 72780
12 Ga0070670_100100510 3300005331 Bacteria 2490
13 Ga0070677_10021601 3300005333 Bacteria 2363
14 Ga0070666_10000919 3300005335 Bacteria 17863
15 Ga0070680_100014180 3300005336 Bacteria 6225
16 Ga0070682_100011325 3300005337 Bacteria 5094
17 Ga0068868_100024312 3300005338 Bacteria 4596
18 Ga0070660_100005093 3300005339 Bacteria 9079
19 Ga0070689_100002242 3300005340 Bacteria 12563
20 Ga0070689_100006297 3300005340 Bacteria 8197
21 Ga0070689_100084197 3300005340 Bacteria 2499
22 Ga0070691_10028789 3300005341 Bacteria 2598
23 Ga0070661_100002838 3300005344 Bacteria 11906
24 Ga0070675_100008302 3300005354 Bacteria 8057
25 Ga0070671_100104584 3300005355 Bacteria 2376
26 Ga0070673_100013939 3300005364 Bacteria 5582
27 Ga0070673_100043715 3300005364 Bacteria 3464
28 Ga0070688_100002847 3300005365 Bacteria 8812
29 Ga0070688_100025742 3300005365 Bacteria 3488
30 Ga0070659_100016667 3300005366 Bacteria 5519
31 Ga0070667_100001919 3300005367 Bacteria 18451
32 Ga0070667_100012612 3300005367 Bacteria 6990
33 Ga0070709_10000312 3300005434 Bacteria 30748
34 Ga0070714_100047433 3300005435 Bacteria 3649
35 Ga0070713_100000072 3300005436 Bacteria 64154
36 Ga0070713_100000162 3300005436 Bacteria 45425
37 Ga0070710_10074662 3300005437 Bacteria 1963
38 Ga0070705_100031383 3300005440 Bacteria 2942
39 Ga0070694_100005187 3300005444 Bacteria 7865
40 Ga0070708_100032097 3300005445 Bacteria 4552
41 Ga0070708_100089526 3300005445 Bacteria 2800
42 Ga0070663_100002426 3300005455 Bacteria 10489
43 Ga0070663_100003587 3300005455 Bacteria 8964
44 Ga0070678_100046911 3300005456 Bacteria 3102
45 Ga0070678_100069880 3300005456 Unclassified 2623
46 Ga0070681_10005411 3300005458 Bacteria 12331
47 Ga0070681_10210117 3300005458 Bacteria 1862
48 Ga0068867_100005078 3300005459 Bacteria 9296
49 Ga0070685_10006430 3300005466 Bacteria 5990
50 Ga0070706_100121818 3300005467 Bacteria 2431
51 Ga0070698_100033125 3300005471 Bacteria 5352
52 Ga0070698_100130000 3300005471 Bacteria 2474
53 Ga0070699_100037575 3300005518 Bacteria 4192
54 Ga0070699_100053892 3300005518 Bacteria 3481
55 Ga0070679_100001679 3300005530 Bacteria 19948
56 Ga0070679_100077271 3300005530 Bacteria 3318
57 Ga0070684_100000680 3300005535 Bacteria 23440
58 Ga0070686_100012634 3300005544 Bacteria 4814
59 Ga0070686_100058023 3300005544 Bacteria 2489
60 Ga0070696_100007208 3300005546 Bacteria 7427
61 Ga0070693_100013342 3300005547 Bacteria 4183
62 Ga0070665_100003822 3300005548 Bacteria 15943
63 Ga0070664_100003218 3300005564 Bacteria 13202
64 Ga0070664_100018612 3300005564 Bacteria 5710
65 Ga0068857_100001275 3300005577 Bacteria 19765
66 Ga0068857_100147661 3300005577 Bacteria 2128
67 Ga0068856_100001522 3300005614 Bacteria 24315
68 Ga0068852_100080230 3300005616 Bacteria 2892
69 Ga0068859_100002820 3300005617 Bacteria 17620
70 Ga0068859_100095777 3300005617 Bacteria 3021
71 Ga0068859_100137485 3300005617 Bacteria 2517
72 Ga0068864_100003169 3300005618 Bacteria 13604
73 Ga0068866_10006580 3300005718 Bacteria 4845
74 Ga0068851_10038272 3300005834 Bacteria 2405
75 Ga0068863_100009207 3300005841 Bacteria 9635
76 Ga0068863_100031639 3300005841 Bacteria 5048
77 Ga0068863_100051161 3300005841 Bacteria 3916
78 Ga0068863_100149789 3300005841 Bacteria 2232
79 Ga0068858_100003481 3300005842 Bacteria 15606
80 Ga0068858_100089310 3300005842 Bacteria 2867
81 Ga0068860_100000594 3300005843 Bacteria 43176
82 Ga0068860_100111468 3300005843 Bacteria 2616
83 Ga0068862_100020117 3300005844 Bacteria 5574
84 Ga0068862_100066019 3300005844 Bacteria 3117
85 Ga0070717_10089395 3300006028 Bacteria 2598
86 Ga0075365_10009762 3300006038 Bacteria 5545
87 Ga0070716_100001254 3300006173 Bacteria 11163
88 Ga0070712_100011418 3300006175 Bacteria 5632
89 Ga0097621_100130042 3300006237 Bacteria 2142
90 Ga0075428_100012544 3300006844 Bacteria 9423
91 Ga0075430_100010086 3300006846 Bacteria 7994
92 Ga0075433_10010265 3300006852 Bacteria 7512
93 Ga0075434_100000104 3300006871 Bacteria 47845
94 Ga0075434_100005120 3300006871 Bacteria 11901
95 Ga0075434_100013749 3300006871 Bacteria 7718
96 Ga0075434_100072610 3300006871 Bacteria 3433
97 Ga0068865_100023164 3300006881 Bacteria 4063
98 Ga0075436_100002230 3300006914 Bacteria 13387
99 Ga0075436_100006434 3300006914 Bacteria 8048
100 Ga0075436_100063378 3300006914 Bacteria 2555
101 Ga0097620_100002820 3300006931 Bacteria 17620
102 Ga0097620_100095769 3300006931 Bacteria 3021
103 Ga0097620_100137486 3300006931 Bacteria 2517
104 Ga0075435_100000354 3300007076 Bacteria 28199
105 Ga0105240_10002404 3300009093 Bacteria 30105
106 Ga0105240_10007054 3300009093 Bacteria 16382
107 Ga0111539_10003269 3300009094 Bacteria 21423
108 Ga0111539_10011554 3300009094 Bacteria 11082
109 Ga0105245_10185454 3300009098 Bacteria 1990
110 Ga0105247_10032832 3300009101 Bacteria 3154
111 Ga0114129_10006304 3300009147 Bacteria 16821
112 Ga0114129_10106698 3300009147 Bacteria 3869
113 Ga0114129_10296569 3300009147 Bacteria 2156
114 Ga0105241_10005642 3300009174 Bacteria 9233
115 Ga0105248_10005831 3300009177 Bacteria 13537
116 Ga0105238_10050931 3300009551 Bacteria 4167
117 Ga0105238_10096088 3300009551 Bacteria 2950
118 Ga0105249_10002253 3300009553 Bacteria 16736
119 Ga0105239_10066384 3300010375 Bacteria 3963
120 Ga0105246_10000779 3300011119 Bacteria 18081
121 Ga0157373_10120250 3300013100 Bacteria 1846
122 Ga0157371_10096515 3300013102 Bacteria 2095
123 Ga0157369_10027358 3300013105 Bacteria 6322
124 Ga0157374_10168291 3300013296 Unclassified 2137
125 Ga0157378_10002286 3300013297 Bacteria 17016
126 Ga0163162_10087032 3300013306 Bacteria 3203
127 Ga0163162_10097823 3300013306 Bacteria 3023
128 Ga0157372_10013933 3300013307 Bacteria 8592
129 Ga0157372_10047215 3300013307 Bacteria 4784
130 Ga0157372_10250181 3300013307 Bacteria 2057
131 Ga0163163_10002960 3300014325 Bacteria 14369
132 Ga0163163_10039032 3300014325 Bacteria 4632
133 Ga0182008_10036820 3300014497 Bacteria 2448
134 Ga0157377_10000192 3300014745 Bacteria 34317
135 Ga0157379_10000740 3300014968 Bacteria 26415
136 Ga0157379_10150044 3300014968 Bacteria 2102
137 Ga0157376_10001132 3300014969 Bacteria 17491
138 Ga0157376_10003919 3300014969 Bacteria 10289
139 Ga0157376_10018508 3300014969 Bacteria 5343
140 Ga0182006_1018262 3300015261 Bacteria 2965
141 Ga0213872_10000290 3300021361 Bacteria 42933
142 Ga0209026_1002468 3300025250 Bacteria 6916
143 Ga0209565_1000001 3300025263 Bacteria 2950419
144 Ga0209673_1000001 3300025273 Bacteria 3176258
145 Ga0209675_1000001 3300025291 Bacteria 2950293
146 Ga0209025_1000036 3300025294 Bacteria 404113
147 Ga0209564_1000001 3300025295 Bacteria 3176258
148 Ga0209256_1000002 3300025299 Bacteria 1906740
149 Ga0207682_10025899 3300025893 Bacteria 2327
150 Ga0207642_10008477 3300025899 Bacteria 3530
151 Ga0207680_10007414 3300025903 Bacteria 5345
152 Ga0207647_10035768 3300025904 Bacteria 3162
153 Ga0207699_10000541 3300025906 Bacteria 18660
154 Ga0207699_10005063 3300025906 Bacteria 6304
155 Ga0207699_10012420 3300025906 Unclassified 4332
156 Ga0207645_10001871 3300025907 Bacteria 16993
157 Ga0207645_10034014 3300025907 Bacteria 3275
158 Ga0207654_10028024 3300025911 Bacteria 3067
159 Ga0207707_10002022 3300025912 Bacteria 18412
160 Ga0207707_10079863 3300025912 Bacteria 2856
161 Ga0207695_10002822 3300025913 Bacteria 25243
162 Ga0207693_10000119 3300025915 Bacteria 69804
163 Ga0207693_10012678 3300025915 Bacteria 6808
164 Ga0207693_10077949 3300025915 Bacteria 2594
165 Ga0207660_10028081 3300025917 Bacteria 3846
166 Ga0207662_10009257 3300025918 Bacteria 5413
167 Ga0207657_10003048 3300025919 Bacteria 17919
168 Ga0207657_10086807 3300025919 Bacteria 2618
169 Ga0207649_10000167 3300025920 Bacteria 53742
170 Ga0207652_10004588 3300025921 Bacteria 11203
171 Ga0207652_10101272 3300025921 Bacteria 2544
172 Ga0207694_10074476 3300025924 Bacteria 2657
173 Ga0207650_10000168 3300025925 Bacteria 78419
174 Ga0207659_10000180 3300025926 Bacteria 37729
175 Ga0207687_10097812 3300025927 Bacteria 2154
176 Ga0207700_10001695 3300025928 Bacteria 12519
177 Ga0207700_10041731 3300025928 Bacteria 3359
178 Ga0207670_10124437 3300025936 Bacteria 1879
179 Ga0207704_10013447 3300025938 Bacteria 4095
180 Ga0207665_10028456 3300025939 Bacteria 3690
181 Ga0207691_10002220 3300025940 Bacteria 18981
182 Ga0207691_10011778 3300025940 Bacteria 8393
183 Ga0207711_10000623 3300025941 Bacteria 35575
184 Ga0207711_10022159 3300025941 Bacteria 5311
185 Ga0207689_10001725 3300025942 Bacteria 20675
186 Ga0207661_10000169 3300025944 Bacteria 42018
187 Ga0207679_10000857 3300025945 Bacteria 19470
188 Ga0207679_10085964 3300025945 Bacteria 2417
189 Ga0207651_10003083 3300025960 Bacteria 8096
190 Ga0207651_10042273 3300025960 Bacteria 3032
191 Ga0207668_10018683 3300025972 Bacteria 4369
192 Ga0207658_10001949 3300025986 Bacteria 15412
193 Ga0207703_10000889 3300026035 Bacteria 29312
194 Ga0207678_10002274 3300026067 Bacteria 17390
195 Ga0207678_10007797 3300026067 Bacteria 9453
196 Ga0207702_10005410 3300026078 Bacteria 11176
197 Ga0207641_10000149 3300026088 Bacteria 99331
198 Ga0207641_10034644 3300026088 Bacteria 4202
199 Ga0207641_10052640 3300026088 Bacteria 3449
200 Ga0207648_10001480 3300026089 Bacteria 25838
201 Ga0207648_10007545 3300026089 Bacteria 10674
202 Ga0207676_10003789 3300026095 Bacteria 10691
203 Ga0207674_10002394 3300026116 Bacteria 23701
204 Ga0207674_10074536 3300026116 Bacteria 3405
205 Ga0207675_100048623 3300026118 Bacteria 3959
206 Ga0207675_100053160 3300026118 Bacteria 3779
207 Ga0207683_10002200 3300026121 Bacteria 17135
208 Ga0207683_10062325 3300026121 Bacteria 3284
209 Ga0209999_1000443 3300027543 Bacteria 6379
210 Ga0207428_10024917 3300027907 Bacteria 5016
211 Ga0268266_10010465 3300028379 Bacteria 8107
212 Ga0268266_10012874 3300028379 Bacteria 7222
213 Ga0307517_10001109 3300028786 Bacteria 45519
214 Ga0307517_10112987 3300028786 Bacteria 2053
215 Ga0307515_10144882 3300028794 Bacteria 2523
216 Ga0307513_10013415 3300031456 Bacteria 10055
217 Ga0307513_10081821 3300031456 Bacteria 3326
218 Ga0307509_10003145 3300031507 Bacteria 25579
219 Ga0307509_10004938 3300031507 Bacteria 18878
220 Ga0307509_10060348 3300031507 Bacteria 4009
221 Ga0307508_10004351 3300031616 Bacteria 13853
222 Ga0307508_10004696 3300031616 Bacteria 13236
223 Ga0307508_10009523 3300031616 Bacteria 8928
224 Ga0307514_10085067 3300031649 Bacteria 2326
225 Ga0316576_10000918 3300031727 Bacteria 15041
226 Ga0307413_10001673 3300031824 Bacteria 8621
227 Ga0307409_100059467 3300031995 Bacteria 2974
228 Ga0307416_100008280 3300032002 Bacteria 6694
229 Ga0307510_10011738 3300033180 Bacteria 10395
230 Ga0307510_10020438 3300033180 Bacteria 7733
231 Ga0373948_0000512 3300034817 Bacteria 4855
232 Ga0373928_0000193 3300035084 Bacteria 11706
233 Ga0373929_0000350 3300035085 Bacteria 8597
234 Ga0373940_0000908 3300035088 Bacteria 4995
235 Ga0373949_0002810 3300035090 Bacteria 4333
236 Ga0373951_0001357 3300035091 Bacteria 6430
237 Ga0373952_0000168 3300035092 Bacteria 10016
238 Ga0373932_0000676 3300035112 Bacteria 10316
239 Ga0373939_0000207 3300035114 Bacteria 16310
240 Ga0373941_0001215 3300035115 Bacteria 5404
241 Ga0373960_0000066 3300035121 Bacteria 14802
242 Ga0373961_0000881 3300035241 Bacteria 10074
243 Ga0373931_0000370 3300035691 Bacteria 18463
244 Ga0373935_0004586 3300035692 Bacteria 8122
245 Ga0373937_0119549 3300036401 Bacteria 2455
246 Ga0316584_0087079 3300036712 Bacteria 2338
247 Ga0395899_0013155 3300037312 Bacteria 6328
248 Ga0395900_0004877 3300037418 Bacteria 14129
249 Ga0395905_0031621 3300037471 Bacteria 4981
250 Ga0395905_0051544 3300037471 Bacteria 3855
251 Ga0436364_0682900 3300037853 Bacteria 8884
252 Ga0436361_1196706 3300039447 Bacteria 36697
253 Ga0439447_002245 3300041407 Bacteria 7085
254 Ga0451577_0000070 3300042876 Bacteria 238621
255 Ga0453684_0000263 3300044712 Bacteria 226494
256 Ga0453684_0000444 3300044712 Bacteria 167501
257 Ga0453684_0026671 3300044712 Bacteria 8330
258 Ga0453684_0091845 3300044712 Bacteria 3745
259 Ga0451576_0036804 3300045051 Bacteria 5186
260 Ga0451576_0062990 3300045051 Bacteria 3866
261 Ga0451576_0096259 3300045051 Bacteria 3079
262 Ga0451576_0163473 3300045051 Bacteria 2323
263 Ga0466967_0126721 3300045976 Bacteria 2366
264 Ga0495592_0000131 3300046454 Bacteria 66382
265 Ga0495580_0020045 3300046472 Bacteria 4957
266 Ga0495580_0027695 3300046472 Bacteria 4123
267 Ga0495584_0000006 3300046491 Bacteria 301775
268 Ga0495594_0001294 3300046499 Bacteria 13053
269 Ga0495594_0042258 3300046499 Bacteria 2496
270 Ga0495594_0056732 3300046499 Bacteria 2162
271 Ga0495596_0005926 3300046500 Bacteria 5701
272 Ga0495583_0000878 3300046506 Bacteria 36404
273 Ga0495616_0000361 3300046513 Bacteria 35729
274 Ga0495630_0010385 3300046517 Bacteria 6721
275 Ga0495643_0000648 3300046522 Bacteria 41187
276 Ga0495609_0008275 3300046538 Bacteria 5101
277 Ga0495633_0032949 3300046558 Bacteria 2500
278 Ga0495668_0003266 3300046616 Bacteria 12327
279 Ga0495661_0022168 3300046665 Bacteria 4134
280 Ga0495636_0001192 3300047318 Bacteria 9814
281 Ga0495674_0101507 3300047319 Bacteria 2447
282 Ga0495672_0005921 3300047320 Bacteria 9582
283 Ga0495686_0001746 3300047472 Bacteria 22303
284 Ga0496101_0007120 3300048904 Bacteria 7234
285 Ga0496102_0010229 3300048905 Bacteria 8065
286 Ga0496103_0009307 3300048906 Bacteria 5821
287 Ga0496103_0048889 3300048906 Bacteria 2614
288 Ga0496105_0107142 3300048908 Bacteria 2307
289 Ga0496106_0000196 3300048909 Bacteria 42639
290 Ga0496107_0022031 3300048910 Bacteria 4500
291 Ga0496108_0000893 3300048911 Bacteria 23234
292 Ga0496109_0000055 3300048912 Bacteria 121528
293 Ga0496109_0077590 3300048912 Bacteria 3057
294 Ga0496110_0002537 3300048913 Bacteria 13728
295 Ga0496110_0008231 3300048913 Bacteria 8381
296 Ga0496111_0052206 3300048914 Bacteria 2952
297 Ga0496112_0000107 3300048915 Bacteria 52331
298 Ga0496112_0025715 3300048915 Bacteria 5653
299 Ga0496113_0015432 3300048916 Bacteria 5249
300 Ga0496113_0016734 3300048916 Bacteria 5071
301 Ga0496114_0000678 3300048917 Bacteria 25278
302 Ga0496115_0120365 3300048918 Bacteria 2160
303 Ga0501032_0032582 3300049569 Bacteria 3571
304 Ga0501034_0015132 3300049571 Bacteria 7929
305 Ga0501038_0035100 3300049574 Bacteria 4405
306 Ga0501042_0024146 3300049578 Bacteria 4263
307 Ga0501043_0022953 3300049579 Bacteria 4892
308 Ga0501046_0007258 3300049580 Bacteria 9745
309 Ga0501047_0003056 3300049581 Bacteria 15875
310 Ga0501048_0013926 3300049582 Bacteria 5963
311 Ga0501048_0027605 3300049582 Bacteria 4123
312 Ga0501068_0044692 3300049584 Bacteria 2667
313 Ga0501069_0026009 3300049585 Bacteria 3204
314 Ga0501071_0019224 3300049587 Bacteria 4739
315 Ga0501071_0116770 3300049587 Bacteria 1976
316 Ga0501072_0072070 3300049588 Bacteria 2730
317 Ga0501073_0001600 3300049589 Bacteria 16770
318 Ga0501075_0015032 3300049591 Bacteria 5552
319 Ga0501075_0023709 3300049591 Bacteria 4494
320 Ga0501076_0007146 3300049592 Bacteria 8114
321 Ga0501235_001045 3300049669 Bacteria 5765
322 Ga0501080_0032193 3300049742 Bacteria 4888
323 Ga0501080_0085558 3300049742 Bacteria 2930
324 Ga0501081_0004082 3300049743 Bacteria 9356
325 Ga0501083_0007578 3300049744 Bacteria 7690
326 Ga0501265_000933 3300049762 Bacteria 3274
327 nmdc:mga05p37_200242_c1 3300050507 Bacteria 2419
328 nmdc:mga05p37_244338_c1 3300050507 Bacteria 2156
329 nmdc:mga08y16_3055_c1 3300050511 Bacteria 17296
330 nmdc:mga08y16_79423_c1 3300050511 Bacteria 3419
331 nmdc:mga08y16_7995_c1 3300050511 Bacteria 11067
332 nmdc:mga0n895_279_c1 3300050512 Bacteria 33669
333 nmdc:mga0rr50_267_c1 3300050513 Bacteria 28320
334 nmdc:mga0rr50_27850_c1 3300050513 Bacteria 3964
335 nmdc:mga08x19_3045_c1 3300050514 Bacteria 10075
336 nmdc:mga08x19_504_c1 3300050514 Bacteria 25890
337 nmdc:mga08x19_54798_c1 3300050514 Bacteria 2568
338 nmdc:mga08x19_916_c1 3300050514 Bacteria 18626
339 nmdc:mga0a205_379_c1 3300050515 Bacteria 33748
340 Ga0500592_002601 3300053116 Bacteria 2898
341 Ga0500607_054668 3300053121 Bacteria 2113
342 Ga0500586_012909 3300053145 Bacteria 2445
343 Ga0501084_0092675 3300054114 Bacteria 2536
344 Ga0501082_0002667 3300060353 Bacteria 15590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100032097 Ga0070708_1000320974 458
2 3300046538 Ga0495609_0008275 Ga0495609_0008275_1403_2929 465
3 3300046499 Ga0495594_0001294 Ga0495594_0001294_9891_11486 468
4 3300046499 Ga0495594_0042258 Ga0495594_0042258_819_2414 468
5 3300046558 Ga0495633_0032949 Ga0495633_0032949_504_2096 471
6 3300047318 Ga0495636_0001192 Ga0495636_0001192_6281_7873 471
7 3300033180 Ga0307510_10011738 Ga0307510_100117383 474
8 3300053121 Ga0500607_054668 Ga0500607_054668_416_1987 474
9 3300046500 Ga0495596_0005926 Ga0495596_0005926_1018_2598 480
10 3300036401 Ga0373937_0119549 Ga0373937_0119549_212_1723 481
11 3300009147 Ga0114129_10296569 Ga0114129_102965691 482
12 3300031456 Ga0307513_10013415 Ga0307513_100134153 482
13 3300050507 nmdc:mga05p37_244338_c1 nmdc:mga05p37_244338_c1_463_2085 482
14 3300053145 Ga0500586_012909 Ga0500586_012909_545_2080 482
15 3300005340 Ga0070689_100002242 Ga0070689_1000022425 483
16 3300005365 Ga0070688_100025742 Ga0070688_1000257421 483
17 3300005367 Ga0070667_100012612 Ga0070667_1000126122 483
18 3300025936 Ga0207670_10124437 Ga0207670_101244371 483
19 3300031824 Ga0307413_10001673 Ga0307413_100016736 483
20 3300031995 Ga0307409_100059467 Ga0307409_1000594672 483
21 3300014497 Ga0182008_10036820 Ga0182008_100368201 485
22 3300015261 Ga0182006_1018262 Ga0182006_10182622 485
23 3300049762 Ga0501265_000933 Ga0501265_000933_1274_2788 486
24 3300050513 nmdc:mga0rr50_27850_c1 nmdc:mga0rr50_27850_c1_2154_3878 486
25 3300005841 Ga0068863_100051161 Ga0068863_1000511613 487
26 3300026088 Ga0207641_10052640 Ga0207641_100526403 487
27 3300031507 Ga0307509_10060348 Ga0307509_100603483 487
28 3300005617 Ga0068859_100137485 Ga0068859_1001374852 488
29 3300005618 Ga0068864_100003169 Ga0068864_1000031693 488
30 3300005841 Ga0068863_100031639 Ga0068863_1000316396 488
31 3300005843 Ga0068860_100111468 Ga0068860_1001114682 488
32 3300006931 Ga0097620_100137486 Ga0097620_1001374862 488
33 3300013306 Ga0163162_10087032 Ga0163162_100870322 488
34 3300014968 Ga0157379_10150044 Ga0157379_101500442 488
35 3300028786 Ga0307517_10001109 Ga0307517_1000110937 488
36 3300028786 Ga0307517_10112987 Ga0307517_101129872 488
37 3300028794 Ga0307515_10144882 Ga0307515_101448822 488
38 3300031456 Ga0307513_10081821 Ga0307513_100818212 488
39 3300031507 Ga0307509_10003145 Ga0307509_100031454 488
40 3300031616 Ga0307508_10004351 Ga0307508_1000435111 488
41 3300031616 Ga0307508_10004696 Ga0307508_100046963 488
42 3300044712 Ga0453684_0000263 Ga0453684_0000263_19860_21359 488
43 3300046454 Ga0495592_0000131 Ga0495592_0000131_17334_18893 489
44 3300006038 Ga0075365_10009762 Ga0075365_100097623 490
45 3300031507 Ga0307509_10004938 Ga0307509_1000493815 490
46 3300031649 Ga0307514_10085067 Ga0307514_100850671 490
47 3300033180 Ga0307510_10020438 Ga0307510_100204384 490
48 3300034817 Ga0373948_0000512 Ga0373948_0000512_1779_3386 491
49 3300035084 Ga0373928_0000193 Ga0373928_0000193_5227_6834 491
50 3300035085 Ga0373929_0000350 Ga0373929_0000350_899_2506 491
51 3300035088 Ga0373940_0000908 Ga0373940_0000908_1713_3320 491
52 3300035090 Ga0373949_0002810 Ga0373949_0002810_864_2471 491
53 3300035091 Ga0373951_0001357 Ga0373951_0001357_2775_4382 491
54 3300035092 Ga0373952_0000168 Ga0373952_0000168_105_1712 491
55 3300035112 Ga0373932_0000676 Ga0373932_0000676_6461_8068 491
56 3300035114 Ga0373939_0000207 Ga0373939_0000207_12835_14442 491
57 3300035115 Ga0373941_0001215 Ga0373941_0001215_1335_2942 491
58 3300035121 Ga0373960_0000066 Ga0373960_0000066_3061_4668 491
59 3300035691 Ga0373931_0000370 Ga0373931_0000370_3883_5490 491
60 3300045051 Ga0451576_0036804 Ga0451576_0036804_1739_3346 491
61 3300045051 Ga0451576_0062990 Ga0451576_0062990_202_1758 492
62 3300047320 Ga0495672_0005921 Ga0495672_0005921_4481_6118 492
63 3300021361 Ga0213872_10000290 Ga0213872_1000029020 493
64 3300039447 Ga0436361_1196706 Ga0436361_1196706_32856_34529 493
65 3300046491 Ga0495584_0000006 Ga0495584_0000006_173713_175305 493
66 3300009147 Ga0114129_10106698 Ga0114129_101066982 494
67 3300050507 nmdc:mga05p37_200242_c1 nmdc:mga05p37_200242_c1_76_1659 494
68 3300009551 Ga0105238_10050931 Ga0105238_100509315 495
69 3300006871 Ga0075434_100072610 Ga0075434_1000726103 496
70 3300048906 Ga0496103_0048889 Ga0496103_0048889_195_1805 496
71 3300046665 Ga0495661_0022168 Ga0495661_0022168_1910_3505 497
72 3300049585 Ga0501069_0026009 Ga0501069_0026009_1399_3033 497
73 3300013307 Ga0157372_10250181 Ga0157372_102501812 499
74 3300032002 Ga0307416_100008280 Ga0307416_1000082803 499
75 3300046522 Ga0495643_0000648 Ga0495643_0000648_19688_21286 500
76 3300047472 Ga0495686_0001746 Ga0495686_0001746_8832_10484 500
77 3300005445 Ga0070708_100089526 Ga0070708_1000895262 501
78 3300005467 Ga0070706_100121818 Ga0070706_1001218182 501
79 3300005471 Ga0070698_100130000 Ga0070698_1001300002 501
80 3300005518 Ga0070699_100053892 Ga0070699_1000538922 501
81 3300006844 Ga0075428_100012544 Ga0075428_1000125443 501
82 3300009094 Ga0111539_10011554 Ga0111539_100115547 501
83 3300037312 Ga0395899_0013155 Ga0395899_0013155_3760_5382 501
84 3300037418 Ga0395900_0004877 Ga0395900_0004877_7501_9123 501
85 3300037471 Ga0395905_0031621 Ga0395905_0031621_2602_4224 501
86 3300050511 nmdc:mga08y16_3055_c1 nmdc:mga08y16_3055_c1_10393_11991 501
87 3300005330 Ga0070690_100000023 Ga0070690_10000002319 503
88 3300005335 Ga0070666_10000919 Ga0070666_100009194 503
89 3300005367 Ga0070667_100001919 Ga0070667_10000191911 503
90 3300005440 Ga0070705_100031383 Ga0070705_1000313832 503
91 3300005455 Ga0070663_100002426 Ga0070663_1000024265 503
92 3300005456 Ga0070678_100046911 Ga0070678_1000469112 503
93 3300005548 Ga0070665_100003822 Ga0070665_1000038228 503
94 3300005564 Ga0070664_100018612 Ga0070664_1000186122 503
95 3300005614 Ga0068856_100001522 Ga0068856_1000015229 503
96 3300005617 Ga0068859_100002820 Ga0068859_1000028208 503
97 3300005841 Ga0068863_100009207 Ga0068863_1000092073 503
98 3300005842 Ga0068858_100003481 Ga0068858_1000034814 503
99 3300005843 Ga0068860_100000594 Ga0068860_10000059414 503
100 3300006881 Ga0068865_100023164 Ga0068865_1000231644 503
101 3300006931 Ga0097620_100002820 Ga0097620_1000028209 503
102 3300009177 Ga0105248_10005831 Ga0105248_100058312 503
103 3300013297 Ga0157378_10002286 Ga0157378_1000228613 503
104 3300014968 Ga0157379_10000740 Ga0157379_1000074015 503
105 3300014969 Ga0157376_10001132 Ga0157376_1000113211 503
106 3300025903 Ga0207680_10007414 Ga0207680_100074142 503
107 3300025938 Ga0207704_10013447 Ga0207704_100134472 503
108 3300025940 Ga0207691_10002220 Ga0207691_100022204 503
109 3300025941 Ga0207711_10000623 Ga0207711_1000062318 503
110 3300025945 Ga0207679_10085964 Ga0207679_100859642 503
111 3300025960 Ga0207651_10042273 Ga0207651_100422732 503
112 3300025986 Ga0207658_10001949 Ga0207658_100019497 503
113 3300026035 Ga0207703_10000889 Ga0207703_1000088915 503
114 3300026067 Ga0207678_10007797 Ga0207678_100077974 503
115 3300026078 Ga0207702_10005410 Ga0207702_100054102 503
116 3300026089 Ga0207648_10007545 Ga0207648_100075453 503
117 3300026121 Ga0207683_10062325 Ga0207683_100623252 503
118 3300028379 Ga0268266_10010465 Ga0268266_100104657 503
119 3300046499 Ga0495594_0056732 Ga0495594_0056732_115_1803 503
120 3300048904 Ga0496101_0007120 Ga0496101_0007120_5544_7196 503
121 3300048905 Ga0496102_0010229 Ga0496102_0010229_5837_7489 503
122 3300048906 Ga0496103_0009307 Ga0496103_0009307_616_2268 503
123 3300048909 Ga0496106_0000196 Ga0496106_0000196_5556_7211 503
124 3300048910 Ga0496107_0022031 Ga0496107_0022031_656_2308 503
125 3300005354 Ga0070675_100008302 Ga0070675_1000083025 504
126 3300006852 Ga0075433_10010265 Ga0075433_100102657 504
127 3300006871 Ga0075434_100005120 Ga0075434_1000051205 504
128 3300009147 Ga0114129_10006304 Ga0114129_1000630416 504
129 3300025926 Ga0207659_10000180 Ga0207659_1000018018 504
130 3300046506 Ga0495583_0000878 Ga0495583_0000878_34296_35894 504
131 3300046513 Ga0495616_0000361 Ga0495616_0000361_6469_8067 504
132 3300003771 Ga0055526_1002188 Ga0055526_10021887 505
133 3300003773 Ga0055537_1001018 Ga0055537_10010188 505
134 3300003775 Ga0055524_1001196 Ga0055524_100119610 505
135 3300003784 Ga0055534_1000515 Ga0055534_100051523 505
136 3300003790 Ga0055528_1000337 Ga0055528_100033723 505
137 3300025263 Ga0209565_1000001 Ga0209565_10000011174 505
138 3300025273 Ga0209673_1000001 Ga0209673_10000011174 505
139 3300025291 Ga0209675_1000001 Ga0209675_10000011359 505
140 3300025295 Ga0209564_1000001 Ga0209564_10000011521 505
141 3300025299 Ga0209256_1000002 Ga0209256_100000232 505
142 3300026088 Ga0207641_10034644 Ga0207641_100346442 505
143 3300013307 Ga0157372_10013933 Ga0157372_100139333 506
144 3300035241 Ga0373961_0000881 Ga0373961_0000881_7530_9194 506
145 3300009551 Ga0105238_10096088 Ga0105238_100960882 507
146 3300037471 Ga0395905_0051544 Ga0395905_0051544_1963_3573 508
147 3300046616 Ga0495668_0003266 Ga0495668_0003266_5932_7578 508
148 3300047319 Ga0495674_0101507 Ga0495674_0101507_113_1723 508
149 3300005518 Ga0070699_100037575 Ga0070699_1000375753 509
150 3300005546 Ga0070696_100007208 Ga0070696_1000072084 509
151 3300044712 Ga0453684_0000444 Ga0453684_0000444_71885_73525 509
152 3300005456 Ga0070678_100069880 Ga0070678_1000698801 510
153 3300005544 Ga0070686_100058023 Ga0070686_1000580231 510
154 3300031616 Ga0307508_10009523 Ga0307508_100095231 510
155 3300049574 Ga0501038_0035100 Ga0501038_0035100_862_2472 510
156 3300049582 Ga0501048_0027605 Ga0501048_0027605_232_1842 510
157 3300049587 Ga0501071_0019224 Ga0501071_0019224_1007_2617 510
158 3300049588 Ga0501072_0072070 Ga0501072_0072070_316_1926 510
159 3300049742 Ga0501080_0085558 Ga0501080_0085558_476_2086 510
160 3300050514 nmdc:mga08x19_3045_c1 nmdc:mga08x19_3045_c1_7140_8714 510
161 3300054114 Ga0501084_0092675 Ga0501084_0092675_255_1865 510
162 3300005617 Ga0068859_100095777 Ga0068859_1000957773 511
163 3300006931 Ga0097620_100095769 Ga0097620_1000957692 511
164 3300045051 Ga0451576_0163473 Ga0451576_0163473_337_1962 511
165 3300026118 Ga0207675_100048623 Ga0207675_1000486233 512
166 3300031727 Ga0316576_10000918 Ga0316576_100009189 512
167 3300036712 Ga0316584_0087079 Ga0316584_0087079_546_2207 512
168 3300046472 Ga0495580_0020045 Ga0495580_0020045_2424_4040 512
169 3300005336 Ga0070680_100014180 Ga0070680_1000141803 513
170 3300005458 Ga0070681_10005411 Ga0070681_100054114 513
171 3300005530 Ga0070679_100001679 Ga0070679_1000016793 513
172 3300006914 Ga0075436_100063378 Ga0075436_1000633782 513
173 3300009093 Ga0105240_10002404 Ga0105240_1000240425 513
174 3300025250 Ga0209026_1002468 Ga0209026_10024684 513
175 3300025912 Ga0207707_10002022 Ga0207707_1000202218 513
176 3300025917 Ga0207660_10028081 Ga0207660_100280813 513
177 3300025921 Ga0207652_10004588 Ga0207652_100045883 513
178 3300049584 Ga0501068_0044692 Ga0501068_0044692_905_2563 513
179 3300049591 Ga0501075_0015032 Ga0501075_0015032_2692_4350 513
180 3300050514 nmdc:mga08x19_54798_c1 nmdc:mga08x19_54798_c1_738_2444 513
181 3300053116 Ga0500592_002601 Ga0500592_002601_937_2547 513
182 3300060353 Ga0501082_0002667 Ga0501082_0002667_12305_13963 513
183 3300003187 JGI25151J46595_10000875 JGI25151J46595_1000087513 514
184 3300005435 Ga0070714_100047433 Ga0070714_1000474333 514
185 3300005577 Ga0068857_100147661 Ga0068857_1001476611 514
186 3300009094 Ga0111539_10003269 Ga0111539_1000326911 514
187 3300025294 Ga0209025_1000036 Ga0209025_10000368 514
188 3300025911 Ga0207654_10028024 Ga0207654_100280243 514
189 3300025919 Ga0207657_10086807 Ga0207657_100868072 514
190 3300025921 Ga0207652_10101272 Ga0207652_101012722 514
191 3300026116 Ga0207674_10074536 Ga0207674_100745362 514
192 3300027907 Ga0207428_10024917 Ga0207428_100249172 514
193 3300035692 Ga0373935_0004586 Ga0373935_0004586_2094_3767 514
194 3300050511 nmdc:mga08y16_7995_c1 nmdc:mga08y16_7995_c1_8782_10479 514
195 3300005341 Ga0070691_10028789 Ga0070691_100287892 515
196 3300006846 Ga0075430_100010086 Ga0075430_1000100867 515
197 3300006914 Ga0075436_100006434 Ga0075436_1000064342 515
198 3300025924 Ga0207694_10074476 Ga0207694_100744762 515
199 3300050514 nmdc:mga08x19_504_c1 nmdc:mga08x19_504_c1_20123_21784 515
200 3300006237 Ga0097621_100130042 Ga0097621_1001300422 516
201 3300045051 Ga0451576_0096259 Ga0451576_0096259_132_1733 516
202 3300049587 Ga0501071_0116770 Ga0501071_0116770_245_1894 516
203 3300005340 Ga0070689_100084197 Ga0070689_1000841971 517
204 3300025906 Ga0207699_10005063 Ga0207699_100050634 518
205 3300025915 Ga0207693_10077949 Ga0207693_100779492 518
206 3300037853 Ga0436364_0682900 Ga0436364_0682900_3476_5161 518
207 3300049592 Ga0501076_0007146 Ga0501076_0007146_2033_3652 518
208 3300049743 Ga0501081_0004082 Ga0501081_0004082_1713_3332 518
209 3300005340 Ga0070689_100006297 Ga0070689_1000062972 520
210 3300005355 Ga0070671_100104584 Ga0070671_1001045842 520
211 3300005364 Ga0070673_100043715 Ga0070673_1000437152 520
212 3300041407 Ga0439447_002245 Ga0439447_002245_5033_6673 520
213 3300042876 Ga0451577_0000070 Ga0451577_0000070_143467_145092 520
214 3300044712 Ga0453684_0026671 Ga0453684_0026671_792_2417 520
215 3300045976 Ga0466967_0126721 Ga0466967_0126721_166_1809 521
216 3300046517 Ga0495630_0010385 Ga0495630_0010385_711_2324 521
217 3300048908 Ga0496105_0107142 Ga0496105_0107142_246_1919 521
218 3300048917 Ga0496114_0000678 Ga0496114_0000678_3022_4695 521
219 3300005458 Ga0070681_10210117 Ga0070681_102101171 522
220 3300005530 Ga0070679_100077271 Ga0070679_1000772712 522
221 3300005547 Ga0070693_100013342 Ga0070693_1000133422 522
222 3300009093 Ga0105240_10007054 Ga0105240_100070545 522
223 3300013307 Ga0157372_10047215 Ga0157372_100472153 522
224 3300025912 Ga0207707_10079863 Ga0207707_100798632 522
225 3300025913 Ga0207695_10002822 Ga0207695_1000282217 522
226 3300005436 Ga0070713_100000072 Ga0070713_10000007230 523
227 3300005437 Ga0070710_10074662 Ga0070710_100746622 523
228 3300006028 Ga0070717_10089395 Ga0070717_100893952 523
229 3300006871 Ga0075434_100013749 Ga0075434_1000137492 523
230 3300025906 Ga0207699_10012420 Ga0207699_100124202 523
231 3300025915 Ga0207693_10012678 Ga0207693_100126785 523
232 3300025928 Ga0207700_10041731 Ga0207700_100417312 523
233 3300049569 Ga0501032_0032582 Ga0501032_0032582_1433_3073 523
234 3300049580 Ga0501046_0007258 Ga0501046_0007258_3629_5269 523
235 3300049744 Ga0501083_0007578 Ga0501083_0007578_5896_7536 523
236 3300050511 nmdc:mga08y16_79423_c1 nmdc:mga08y16_79423_c1_1419_3050 523
237 iso_pu_bacteria 2643221559 2643816157 523
238 iso_pu_bacteria 2643221586 2643938185 523
239 iso_pu_bacteria 2643221612 2644077757 523
240 iso_pu_bacteria 2643221727 2644695950 523
241 3300005331 Ga0070670_100100510 Ga0070670_1001005102 524
242 3300005844 Ga0068862_100066019 Ga0068862_1000660193 524
243 3300013306 Ga0163162_10097823 Ga0163162_100978233 524
244 3300014325 Ga0163163_10039032 Ga0163163_100390323 524
245 3300049571 Ga0501034_0015132 Ga0501034_0015132_1223_2863 524
246 3300049579 Ga0501043_0022953 Ga0501043_0022953_2113_3753 524
247 3300049581 Ga0501047_0003056 Ga0501047_0003056_5868_7508 524
248 3300049589 Ga0501073_0001600 Ga0501073_0001600_11910_13550 524
249 3300049742 Ga0501080_0032193 Ga0501080_0032193_724_2364 524
250 3300025907 Ga0207645_10034014 Ga0207645_100340143 525
251 3300027543 Ga0209999_1000443 Ga0209999_10004436 525
252 3300049578 Ga0501042_0024146 Ga0501042_0024146_1722_3353 525
253 3300049582 Ga0501048_0013926 Ga0501048_0013926_724_2355 525
254 3300049591 Ga0501075_0023709 Ga0501075_0023709_884_2515 525
255 3300009098 Ga0105245_10185454 Ga0105245_101854542 526
256 3300009101 Ga0105247_10032832 Ga0105247_100328323 526
257 3300009174 Ga0105241_10005642 Ga0105241_100056425 526
258 3300009553 Ga0105249_10002253 Ga0105249_1000225313 526
259 3300010375 Ga0105239_10066384 Ga0105239_100663843 526
260 3300011119 Ga0105246_10000779 Ga0105246_100007794 526
261 3300013100 Ga0157373_10120250 Ga0157373_101202502 526
262 3300013102 Ga0157371_10096515 Ga0157371_100965152 526
263 3300013105 Ga0157369_10027358 Ga0157369_100273584 526
264 3300014325 Ga0163163_10002960 Ga0163163_100029607 526
265 3300014745 Ga0157377_10000192 Ga0157377_1000019213 526
266 3300014969 Ga0157376_10018508 Ga0157376_100185084 526
267 3300048911 Ga0496108_0000893 Ga0496108_0000893_18022_19602 526
268 3300048912 Ga0496109_0000055 Ga0496109_0000055_94791_96371 526
269 3300048913 Ga0496110_0002537 Ga0496110_0002537_8690_10270 526
270 3300048914 Ga0496111_0052206 Ga0496111_0052206_672_2252 526
271 3300048915 Ga0496112_0000107 Ga0496112_0000107_8583_10163 526
272 3300048916 Ga0496113_0015432 Ga0496113_0015432_2244_3824 526
273 iso_pu_bacteria 2643221593 2643975389 526
274 3300005471 Ga0070698_100033125 Ga0070698_1000331255 529
275 3300044712 Ga0453684_0091845 Ga0453684_0091845_792_2417 529
276 3300048912 Ga0496109_0077590 Ga0496109_0077590_1199_2854 530
277 3300048913 Ga0496110_0008231 Ga0496110_0008231_4699_6354 530
278 3300048915 Ga0496112_0025715 Ga0496112_0025715_1047_2702 530
279 3300048916 Ga0496113_0016734 Ga0496113_0016734_3196_4851 530
280 3300046472 Ga0495580_0027695 Ga0495580_0027695_2188_3840 533
281 3300005444 Ga0070694_100005187 Ga0070694_1000051873 534
282 3300005842 Ga0068858_100089310 Ga0068858_1000893102 534
283 3300013296 Ga0157374_10168291 Ga0157374_101682912 534
284 3300049669 Ga0501235_001045 Ga0501235_001045_2025_3644 534
285 3300050512 nmdc:mga0n895_279_c1 nmdc:mga0n895_279_c1_11784_13400 536
286 3300050513 nmdc:mga0rr50_267_c1 nmdc:mga0rr50_267_c1_13335_14951 536
287 3300050514 nmdc:mga08x19_916_c1 nmdc:mga08x19_916_c1_11069_12685 536
288 3300050515 nmdc:mga0a205_379_c1 nmdc:mga0a205_379_c1_3468_5084 536
289 3300005338 Ga0068868_100024312 Ga0068868_1000243123 542
290 3300006871 Ga0075434_100000104 Ga0075434_10000010423 543
291 3300006914 Ga0075436_100002230 Ga0075436_1000022306 543
292 3300007076 Ga0075435_100000354 Ga0075435_1000003547 543
293 3300005434 Ga0070709_10000312 Ga0070709_1000031212 544
294 3300005436 Ga0070713_100000162 Ga0070713_10000016233 544
295 3300006173 Ga0070716_100001254 Ga0070716_1000012544 544
296 3300006175 Ga0070712_100011418 Ga0070712_1000114185 544
297 3300025906 Ga0207699_10000541 Ga0207699_100005418 544
298 3300025915 Ga0207693_10000119 Ga0207693_1000011954 544
299 3300025928 Ga0207700_10001695 Ga0207700_100016954 544
300 3300025939 Ga0207665_10028456 Ga0207665_100284564 544
301 3300048918 Ga0496115_0120365 Ga0496115_0120365_129_1772 544
302 3300001976 JGI24752J21851_1001720 JGI24752J21851_10017201 545
303 3300005293 Ga0065715_10000384 Ga0065715_1000038410 545
304 3300005327 Ga0070658_10111221 Ga0070658_101112212 545
305 3300005329 Ga0070683_100000306 Ga0070683_1000003068 545
306 3300005333 Ga0070677_10021601 Ga0070677_100216013 545
307 3300005337 Ga0070682_100011325 Ga0070682_1000113252 545
308 3300005339 Ga0070660_100005093 Ga0070660_1000050932 545
309 3300005344 Ga0070661_100002838 Ga0070661_1000028385 545
310 3300005364 Ga0070673_100013939 Ga0070673_1000139393 545
311 3300005365 Ga0070688_100002847 Ga0070688_1000028471 545
312 3300005366 Ga0070659_100016667 Ga0070659_1000166671 545
313 3300005455 Ga0070663_100003587 Ga0070663_1000035875 545
314 3300005459 Ga0068867_100005078 Ga0068867_1000050781 545
315 3300005466 Ga0070685_10006430 Ga0070685_100064305 545
316 3300005535 Ga0070684_100000680 Ga0070684_1000006809 545
317 3300005544 Ga0070686_100012634 Ga0070686_1000126346 545
318 3300005564 Ga0070664_100003218 Ga0070664_1000032185 545
319 3300005577 Ga0068857_100001275 Ga0068857_1000012757 545
320 3300005616 Ga0068852_100080230 Ga0068852_1000802301 545
321 3300005718 Ga0068866_10006580 Ga0068866_100065804 545
322 3300005834 Ga0068851_10038272 Ga0068851_100382721 545
323 3300005841 Ga0068863_100149789 Ga0068863_1001497892 545
324 3300005844 Ga0068862_100020117 Ga0068862_1000201171 545
325 3300014969 Ga0157376_10003919 Ga0157376_100039196 545
326 3300025893 Ga0207682_10025899 Ga0207682_100258991 545
327 3300025899 Ga0207642_10008477 Ga0207642_100084772 545
328 3300025904 Ga0207647_10035768 Ga0207647_100357681 545
329 3300025907 Ga0207645_10001871 Ga0207645_1000187113 545
330 3300025918 Ga0207662_10009257 Ga0207662_100092571 545
331 3300025919 Ga0207657_10003048 Ga0207657_100030483 545
332 3300025920 Ga0207649_10000167 Ga0207649_1000016733 545
333 3300025925 Ga0207650_10000168 Ga0207650_1000016813 545
334 3300025927 Ga0207687_10097812 Ga0207687_100978123 545
335 3300025940 Ga0207691_10011778 Ga0207691_100117786 545
336 3300025941 Ga0207711_10022159 Ga0207711_100221593 545
337 3300025942 Ga0207689_10001725 Ga0207689_1000172513 545
338 3300025944 Ga0207661_10000169 Ga0207661_1000016922 545
339 3300025945 Ga0207679_10000857 Ga0207679_1000085713 545
340 3300025960 Ga0207651_10003083 Ga0207651_100030834 545
341 3300025972 Ga0207668_10018683 Ga0207668_100186832 545
342 3300026067 Ga0207678_10002274 Ga0207678_1000227413 545
343 3300026088 Ga0207641_10000149 Ga0207641_1000014956 545
344 3300026089 Ga0207648_10001480 Ga0207648_1000148019 545
345 3300026095 Ga0207676_10003789 Ga0207676_100037894 545
346 3300026116 Ga0207674_10002394 Ga0207674_1000239415 545
347 3300026118 Ga0207675_100053160 Ga0207675_1000531603 545
348 3300026121 Ga0207683_10002200 Ga0207683_100022004 545
349 3300028379 Ga0268266_10012874 Ga0268266_100128742 545

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

120

570

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.9837 47 536
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.9777 47 536
5ac3-assembly1.cif.gz_A crystal structure of pam12a 0.9716 46 538
1m22-assembly2.cif.gz_B x-ray structure of native peptide amidase from stenotrophomonas maltophilia at 1.4 a 0.967 46 536
5ac3-assembly1.cif.gz_A crystal structure of pam12a 0.9658 46 538
ID Description Score Start End Superfamily
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.967 46 536 3.90.1300.10
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9572 46 536 3.90.1300.10
af_A0A0P0XRM7_54_372_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9464 45 343 3.90.1300.10
af_A0A0P0WV09_96_533_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9419 120 536 3.90.1300.10
af_A0A1P8B760_22_510_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9408 45 536 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A3M0Z6X4-F1-model_v4 deleted 0.9932 51 265
AF-A0A836VI75-F1-model_v4 Amidase (EC 3.5.1.4) 0.9881 61 211 GO:0016787
AF-A0A6L8JK38-F1-model_v4 deleted 0.9874 69 232
AF-A0A7V8VWX2-F1-model_v4 Amidase domain-containing protein 0.9803 304 536
AF-A0A3B9LUU2-F1-model_v4 Amidase (EC 3.5.1.4) 0.9785 79 212 GO:0004040

Feature Viewer

pLDDT pTM Quality
90.72 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map