F417763

General Info

Members Datasets Scaffolds Average Seq Length
349 159 698 353

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10015019|JGI25406J46586_100150192
Length 407
Sequence MRRPAGDTRDSFLRLNCMSTNDQLQFTPKPAYMPATASIPAQVKAFLLILVALGASACSTISGKETTGVIIARRAQVRSSIAVVAADLSEVLRGDVVDILDSAAAENGERWLRVRAHDAERTEGWIEARNVMPQELLERSRKLAEEDKDTPAQATGQIRASTNLRSSPDRSNNDDILLKLESGSVFEIVGWKRVPRPKSLETAESDDAPKTGAVPQGAGRRKAETEAPKMPEEPNELWYKVRLDPSFSPAPAGWVYGRQVELTVPSDIIFYRTGREFVAWRRLDDVNAGDAGAAKDKNAGREAQPGSWVILEKSNTDEPKPDEPDFDRIYVLGYDKSRQEHYTAYRXPDLKGRLPLKVESGGGDKFFTVRAEENGQVKELKYKTYRDDRGVLRVEPQGEAARSGRKK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
145 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
146 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
147 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
151 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
152 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
153 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.15
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015019 3300003203 Unclassified 3276
2 JGI24751J29686_10000124 3300002459 Bacteria 38798
3 rootL2_10022041 3300003322 Unclassified 2339
4 Ga0065714_10064699 3300005288 Bacteria 22868
5 Ga0065704_10114592 3300005289 Unclassified 1888
6 Ga0065712_10000190 3300005290 Bacteria 22861
7 Ga0065712_10006655 3300005290 Bacteria 3151
8 Ga0065712_10009218 3300005290 Bacteria 2454
9 Ga0065712_10089420 3300005290 Bacteria 2471
10 Ga0065715_10004159 3300005293 Bacteria 3972
11 Ga0065715_10094760 3300005293 Bacteria 4250
12 Ga0065715_10096821 3300005293 Bacteria 3813
13 Ga0065715_10131679 3300005293 Bacteria 2003
14 Ga0065707_10008284 3300005295 Bacteria 4211
15 Ga0065707_10114565 3300005295 Bacteria 2293
16 Ga0070690_100012920 3300005330 Bacteria 4923
17 Ga0070690_100046621 3300005330 Bacteria 2756
18 Ga0070670_100002011 3300005331 Bacteria 16631
19 Ga0070670_100028464 3300005331 Bacteria 4809
20 Ga0070670_100296375 3300005331 Bacteria 1414
21 Ga0068869_100040052 3300005334 Bacteria 3349
22 Ga0068869_100052326 3300005334 Unclassified 2965
23 Ga0068869_100053562 3300005334 Bacteria 2934
24 Ga0068869_100104895 3300005334 Bacteria 2143
25 Ga0068869_100128990 3300005334 Bacteria 1942
26 Ga0070680_100015233 3300005336 Bacteria 6024
27 Ga0070680_100026992 3300005336 Bacteria 4597
28 Ga0070680_100079715 3300005336 Bacteria 2699
29 Ga0070682_100016927 3300005337 Bacteria 4243
30 Ga0070661_100043308 3300005344 Bacteria 3288
31 Ga0070692_10034204 3300005345 Bacteria 2565
32 Ga0070692_10061547 3300005345 Bacteria 1979
33 Ga0070669_100056617 3300005353 Unclassified 2875
34 Ga0070669_100069106 3300005353 Bacteria 2608
35 Ga0070673_100028260 3300005364 Bacteria 4168
36 Ga0070673_100046153 3300005364 Bacteria 3383
37 Ga0070673_100066927 3300005364 Bacteria 2871
38 Ga0070667_100105904 3300005367 Bacteria 2434
39 Ga0070709_10131885 3300005434 Unclassified 1707
40 Ga0070701_10024946 3300005438 Bacteria 2897
41 Ga0070701_10034952 3300005438 Unclassified 2521
42 Ga0070705_100007011 3300005440 Bacteria 5540
43 Ga0070705_100026079 3300005440 Bacteria 3178
44 Ga0070705_100059064 3300005440 Bacteria 2269
45 Ga0070705_100096343 3300005440 Unclassified 1857
46 Ga0070700_100000173 3300005441 Bacteria 36530
47 Ga0070700_100038294 3300005441 Bacteria 2921
48 Ga0070700_100095191 3300005441 Bacteria 1951
49 Ga0070694_100010128 3300005444 Bacteria 5800
50 Ga0070694_100069920 3300005444 Bacteria 2416
51 Ga0070694_100102371 3300005444 Bacteria 2028
52 Ga0070708_100002555 3300005445 Bacteria 14076
53 Ga0070681_10000208 3300005458 Bacteria 45856
54 Ga0070681_10008664 3300005458 Bacteria 9976
55 Ga0070681_10012914 3300005458 Bacteria 8294
56 Ga0068867_100022612 3300005459 Bacteria 4495
57 Ga0068867_100150095 3300005459 Bacteria 1830
58 Ga0070685_10031321 3300005466 Bacteria 2970
59 Ga0070706_100000300 3300005467 Bacteria 60347
60 Ga0070706_100006356 3300005467 Bacteria 11162
61 Ga0070706_100058432 3300005467 Bacteria 3559
62 Ga0070707_100059853 3300005468 Bacteria 3653
63 Ga0070707_100118689 3300005468 Bacteria 2567
64 Ga0070707_100447332 3300005468 Bacteria 1253
65 Ga0070698_100005047 3300005471 Bacteria 14468
66 Ga0070698_100024071 3300005471 Bacteria 6355
67 Ga0070698_100036000 3300005471 Bacteria 5116
68 Ga0070698_100058878 3300005471 Bacteria 3882
69 Ga0070699_100023566 3300005518 Bacteria 5302
70 Ga0070699_100025273 3300005518 Bacteria 5121
71 Ga0070699_100054317 3300005518 Bacteria 3467
72 Ga0070699_100105862 3300005518 Bacteria 2467
73 Ga0070679_100000234 3300005530 Bacteria 45861
74 Ga0070697_100000462 3300005536 Bacteria 31136
75 Ga0070697_100000629 3300005536 Bacteria 26760
76 Ga0070697_100013506 3300005536 Bacteria 6407
77 Ga0070697_100163443 3300005536 Bacteria 1881
78 Ga0070697_100290868 3300005536 Bacteria 1403
79 Ga0068853_100055041 3300005539 Bacteria 3429
80 Ga0070672_100010989 3300005543 Bacteria 6300
81 Ga0070686_100034633 3300005544 Bacteria 3113
82 Ga0070695_100016465 3300005545 Bacteria 4476
83 Ga0070695_100048634 3300005545 Bacteria 2713
84 Ga0070695_100051302 3300005545 Bacteria 2647
85 Ga0070696_100022738 3300005546 Bacteria 4261
86 Ga0070696_100075535 3300005546 Unclassified 2378
87 Ga0070696_100083978 3300005546 Bacteria 2259
88 Ga0070696_100105305 3300005546 Bacteria 2026
89 Ga0070693_100004711 3300005547 Bacteria 6485
90 Ga0070693_100007584 3300005547 Bacteria 5310
91 Ga0070693_100044920 3300005547 Bacteria 2501
92 Ga0070704_100044401 3300005549 Bacteria 3088
93 Ga0070704_100095912 3300005549 Bacteria 2222
94 Ga0070704_100119580 3300005549 Bacteria 2021
95 Ga0070664_100004823 3300005564 Bacteria 10801
96 Ga0068857_100023081 3300005577 Bacteria 5472
97 Ga0068854_100063416 3300005578 Bacteria 2682
98 Ga0068859_100016576 3300005617 Bacteria 7398
99 Ga0068859_100020151 3300005617 Bacteria 6696
100 Ga0068859_100032930 3300005617 Bacteria 5206
101 Ga0068859_100110731 3300005617 Bacteria 2807
102 Ga0068859_100111899 3300005617 Bacteria 2793
103 Ga0068859_100113624 3300005617 Unclassified 2772
104 Ga0068859_100151138 3300005617 Bacteria 2397
105 Ga0068859_100220736 3300005617 Bacteria 1983
106 Ga0068859_100220764 3300005617 Bacteria 1983
107 Ga0068864_100008991 3300005618 Bacteria 8238
108 Ga0068864_100278487 3300005618 Unclassified 1561
109 Ga0068861_100104326 3300005719 Bacteria 2261
110 Ga0068861_100185365 3300005719 Unclassified 1735
111 Ga0068851_10008690 3300005834 Bacteria 4705
112 Ga0068870_10176757 3300005840 Unclassified 1278
113 Ga0068863_100047451 3300005841 Bacteria 4073
114 Ga0068858_100126496 3300005842 Bacteria 2393
115 Ga0068858_100135419 3300005842 Bacteria 2311
116 Ga0068860_100042050 3300005843 Bacteria 4367
117 Ga0068860_100242947 3300005843 Unclassified 1751
118 Ga0068862_100066311 3300005844 Bacteria 3110
119 Ga0068862_100195982 3300005844 Bacteria 1820
120 Ga0068862_100206594 3300005844 Bacteria 1773
121 Ga0081539_10000022 3300005985 Bacteria 356710
122 Ga0081539_10002822 3300005985 Bacteria 23214
123 Ga0081539_10020348 3300005985 Bacteria 4492
124 Ga0097621_100030066 3300006237 Bacteria 4297
125 Ga0068871_100027773 3300006358 Bacteria 4429
126 Ga0068871_100051081 3300006358 Bacteria 3346
127 Ga0068871_100081400 3300006358 Bacteria 2682
128 Ga0075430_100122889 3300006846 Bacteria 2164
129 Ga0075431_100032351 3300006847 Bacteria 5390
130 Ga0075433_10100551 3300006852 Bacteria 2560
131 Ga0075433_10129117 3300006852 Unclassified 2246
132 Ga0075433_10181414 3300006852 Bacteria 1873
133 Ga0075434_100050296 3300006871 Bacteria 4140
134 Ga0075434_100075963 3300006871 Bacteria 3354
135 Ga0075434_100089294 3300006871 Bacteria 3083
136 Ga0075434_100190474 3300006871 Bacteria 2071
137 Ga0075429_100053941 3300006880 Bacteria 3497
138 Ga0097620_100016576 3300006931 Bacteria 7398
139 Ga0097620_100020150 3300006931 Bacteria 6696
140 Ga0097620_100032929 3300006931 Bacteria 5206
141 Ga0097620_100110730 3300006931 Bacteria 2807
142 Ga0097620_100111901 3300006931 Bacteria 2793
143 Ga0097620_100113619 3300006931 Unclassified 2772
144 Ga0097620_100151157 3300006931 Bacteria 2397
145 Ga0097620_100220739 3300006931 Bacteria 1983
146 Ga0097620_100220762 3300006931 Bacteria 1983
147 Ga0075435_100023961 3300007076 Bacteria 4729
148 Ga0105240_10059271 3300009093 Bacteria 4778
149 Ga0111539_10204657 3300009094 Bacteria 2301
150 Ga0111539_10219622 3300009094 Bacteria 2214
151 Ga0111539_10571006 3300009094 Bacteria 1317
152 Ga0105245_10055677 3300009098 Bacteria 3553
153 Ga0105247_10002754 3300009101 Bacteria 11769
154 Ga0114129_10021714 3300009147 Bacteria 9109
155 Ga0114129_10026759 3300009147 Bacteria 8169
156 Ga0114129_10094382 3300009147 Bacteria 4143
157 Ga0114129_10103664 3300009147 Bacteria 3933
158 Ga0114129_10108049 3300009147 Bacteria 3842
159 Ga0114129_10111886 3300009147 Bacteria 3767
160 Ga0114129_10115811 3300009147 Bacteria 3694
161 Ga0114129_10127058 3300009147 Unclassified 3505
162 Ga0114129_10241958 3300009147 Bacteria 2425
163 Ga0114129_10580425 3300009147 Unclassified 1455
164 Ga0105243_10004448 3300009148 Bacteria 11088
165 Ga0105243_10038296 3300009148 Bacteria 3734
166 Ga0105243_10056078 3300009148 Unclassified 3132
167 Ga0105243_10441067 3300009148 Unclassified 1219
168 Ga0105241_10040321 3300009174 Bacteria 3525
169 Ga0105241_10108515 3300009174 Unclassified 2219
170 Ga0105241_10216741 3300009174 Bacteria 1606
171 Ga0105241_10219760 3300009174 Bacteria 1596
172 Ga0105241_10341728 3300009174 Bacteria 1297
173 Ga0105242_10001130 3300009176 Bacteria 21021
174 Ga0105242_10036008 3300009176 Bacteria 3969
175 Ga0105248_10016493 3300009177 Bacteria 8132
176 Ga0105248_10028767 3300009177 Bacteria 6194
177 Ga0105248_10062709 3300009177 Bacteria 4173
178 Ga0105248_10229926 3300009177 Bacteria 2088
179 Ga0105248_10257339 3300009177 Bacteria 1965
180 Ga0105237_10015469 3300009545 Bacteria 7939
181 Ga0105238_10028503 3300009551 Bacteria 5689
182 Ga0105238_10031518 3300009551 Bacteria 5398
183 Ga0105249_10033042 3300009553 Bacteria 4684
184 Ga0105249_10224342 3300009553 Bacteria 1851
185 Ga0105239_10013865 3300010375 Bacteria 8944
186 Ga0105239_10109127 3300010375 Bacteria 3066
187 Ga0105239_10252944 3300010375 Bacteria 1979
188 Ga0157373_10036034 3300013100 Bacteria 3551
189 Ga0157374_10056814 3300013296 Unclassified 3654
190 Ga0157378_10000105 3300013297 Bacteria 79945
191 Ga0157378_10015186 3300013297 Bacteria 6743
192 Ga0157378_10016850 3300013297 Bacteria 6406
193 Ga0157378_10110376 3300013297 Bacteria 2521
194 Ga0157378_10246087 3300013297 Bacteria 1710
195 Ga0157378_10307987 3300013297 Bacteria 1535
196 Ga0163162_10028900 3300013306 Bacteria 5488
197 Ga0163162_10096576 3300013306 Bacteria 3043
198 Ga0163162_10102547 3300013306 Bacteria 2955
199 Ga0163162_10154305 3300013306 Unclassified 2415
200 Ga0163162_10464325 3300013306 Bacteria 1397
201 Ga0157372_10008096 3300013307 Bacteria 11181
202 Ga0157372_10369531 3300013307 Bacteria 1671
203 Ga0157375_10004819 3300013308 Bacteria 11718
204 Ga0157375_10026296 3300013308 Bacteria 5420
205 Ga0157375_10068279 3300013308 Bacteria 3556
206 Ga0157375_10380001 3300013308 Bacteria 1579
207 Ga0163163_10014128 3300014325 Bacteria 7333
208 Ga0163163_10015695 3300014325 Bacteria 7012
209 Ga0163163_10078659 3300014325 Bacteria 3295
210 Ga0163163_10145359 3300014325 Bacteria 2415
211 Ga0163163_10160675 3300014325 Bacteria 2292
212 Ga0163163_10211178 3300014325 Bacteria 1990
213 Ga0157380_10048043 3300014326 Bacteria 3359
214 Ga0157380_10115965 3300014326 Bacteria 2260
215 Ga0157380_10157996 3300014326 Bacteria 1967
216 Ga0157380_10407775 3300014326 Bacteria 1292
217 Ga0157377_10017571 3300014745 Bacteria 3700
218 Ga0157377_10035708 3300014745 Bacteria 2729
219 Ga0157379_10185820 3300014968 Bacteria 1878
220 Ga0157376_10042648 3300014969 Bacteria 3719
221 Ga0213876_10000241 3300021384 Bacteria 52167
222 Ga0207656_10004857 3300025321 Bacteria 4718
223 Ga0207710_10001315 3300025900 Bacteria 12550
224 Ga0207688_10057038 3300025901 Bacteria 2195
225 Ga0207647_10011372 3300025904 Bacteria 6244
226 Ga0207645_10088644 3300025907 Bacteria 1989
227 Ga0207643_10010905 3300025908 Bacteria 4901
228 Ga0207684_10000367 3300025910 Bacteria 60978
229 Ga0207684_10016681 3300025910 Bacteria 6307
230 Ga0207684_10044533 3300025910 Bacteria 3764
231 Ga0207654_10023110 3300025911 Unclassified 3326
232 Ga0207707_10000031 3300025912 Bacteria 159505
233 Ga0207707_10054395 3300025912 Bacteria 3484
234 Ga0207707_10059730 3300025912 Bacteria 3317
235 Ga0207707_10409066 3300025912 Bacteria 1164
236 Ga0207671_10016690 3300025914 Bacteria 5699
237 Ga0207660_10001163 3300025917 Bacteria 17581
238 Ga0207660_10051838 3300025917 Bacteria 2919
239 Ga0207660_10057776 3300025917 Bacteria 2779
240 Ga0207649_10251181 3300025920 Unclassified 1274
241 Ga0207652_10000063 3300025921 Bacteria 113213
242 Ga0207646_10148733 3300025922 Unclassified 2112
243 Ga0207646_10273373 3300025922 Bacteria 1527
244 Ga0207646_10344709 3300025922 Unclassified 1346
245 Ga0207681_10036101 3300025923 Unclassified 3259
246 Ga0207694_10020216 3300025924 Bacteria 5035
247 Ga0207694_10065596 3300025924 Bacteria 2831
248 Ga0207650_10000022 3300025925 Bacteria 318878
249 Ga0207650_10033990 3300025925 Bacteria 3696
250 Ga0207650_10102502 3300025925 Bacteria 2205
251 Ga0207650_10179851 3300025925 Bacteria 1685
252 Ga0207690_10114675 3300025932 Bacteria 1946
253 Ga0207706_10143099 3300025933 Bacteria 2104
254 Ga0207686_10007032 3300025934 Bacteria 6054
255 Ga0207686_10024728 3300025934 Bacteria 3484
256 Ga0207709_10031965 3300025935 Bacteria 3079
257 Ga0207709_10050490 3300025935 Bacteria 2544
258 Ga0207669_10084279 3300025937 Bacteria 2048
259 Ga0207691_10035547 3300025940 Bacteria 4623
260 Ga0207711_10011141 3300025941 Bacteria 7473
261 Ga0207711_10046033 3300025941 Bacteria 3727
262 Ga0207711_10075959 3300025941 Bacteria 2925
263 Ga0207689_10003891 3300025942 Bacteria 13603
264 Ga0207689_10034587 3300025942 Bacteria 4197
265 Ga0207689_10058879 3300025942 Bacteria 3160
266 Ga0207689_10120249 3300025942 Bacteria 2161
267 Ga0207689_10144566 3300025942 Bacteria 1959
268 Ga0207651_10041450 3300025960 Bacteria 3056
269 Ga0207651_10101334 3300025960 Bacteria 2137
270 Ga0207651_10131935 3300025960 Bacteria 1914
271 Ga0207712_10031289 3300025961 Unclassified 3583
272 Ga0207640_10105847 3300025981 Bacteria 1983
273 Ga0207640_10110107 3300025981 Bacteria 1950
274 Ga0207677_10029007 3300026023 Bacteria 3510
275 Ga0207703_10012101 3300026035 Bacteria 6723
276 Ga0207703_10160601 3300026035 Bacteria 1968
277 Ga0207708_10000475 3300026075 Bacteria 31007
278 Ga0207708_10056115 3300026075 Bacteria 3004
279 Ga0207708_10117430 3300026075 Bacteria 2070
280 Ga0207648_10013330 3300026089 Bacteria 7654
281 Ga0207648_10146206 3300026089 Bacteria 2085
282 Ga0207676_10027559 3300026095 Bacteria 4232
283 Ga0207676_10126035 3300026095 Bacteria 2169
284 Ga0207674_10000129 3300026116 Bacteria 88458
285 Ga0207674_10063101 3300026116 Bacteria 3741
286 Ga0207674_10184578 3300026116 Bacteria 2036
287 Ga0207675_100027053 3300026118 Bacteria 5340
288 Ga0207675_100037749 3300026118 Bacteria 4506
289 Ga0207675_100045513 3300026118 Bacteria 4099
290 Ga0207675_100115207 3300026118 Unclassified 2539
291 Ga0207675_100369082 3300026118 Bacteria 1409
292 Ga0207428_10034501 3300027907 Bacteria 4145
293 Ga0207428_10063644 3300027907 Bacteria 2913
294 Ga0207428_10096610 3300027907 Bacteria 2287
295 Ga0268265_10095617 3300028380 Bacteria 2386
296 Ga0268264_10117911 3300028381 Unclassified 2335
297 Ga0268264_10144503 3300028381 Bacteria 2125
298 Ga0268264_10156953 3300028381 Bacteria 2046
299 Ga0307513_10028907 3300031456 Bacteria 6330
300 Ga0307405_10092182 3300031731 Unclassified 2009
301 Ga0307405_10114942 3300031731 Bacteria 1830
302 Ga0307412_10184742 3300031911 Bacteria 1571
303 Ga0307416_100289268 3300032002 Bacteria 1621
304 Ga0307416_100564936 3300032002 Unclassified 1213
305 Ga0307411_10039678 3300032005 Bacteria 2980
306 Ga0307415_100011961 3300032126 Bacteria 4996
307 Ga0373951_0003248 3300035091 Bacteria 3978
308 Ga0395898_0311434 3300037466 Bacteria 1502
309 Ga0395901_0264363 3300038443 Bacteria 1790
310 Ga0436365_1125551 3300039437 Bacteria 52249
311 Ga0436365_1648690 3300039437 Bacteria 4124
312 Ga0439448_0039887 3300042005 Bacteria 1515
313 Ga0453683_0041409 3300044673 Unclassified 2893
314 Ga0453684_0226234 3300044712 Bacteria 2163
315 Ga0451576_0090360 3300045051 Unclassified 3185
316 Ga0496100_0142194 3300048903 Bacteria 1702
317 Ga0496106_0099216 3300048909 Bacteria 2257
318 Ga0496112_0317734 3300048915 Bacteria 1502
319 Ga0496113_0250476 3300048916 Bacteria 1414
320 Ga0501296_001339 3300049519 Bacteria 2488
321 Ga0501296_003305 3300049519 Unclassified 1715
322 Ga0501297_004517 3300049520 Unclassified 1427
323 Ga0501299_001324 3300049522 Bacteria 3153
324 Ga0501303_004841 3300049526 Unclassified 1125
325 Ga0501038_0007268 3300049574 Bacteria 10224
326 Ga0501202_004307 3300049652 Bacteria 2490
327 Ga0501216_007997 3300049660 Unclassified 1656
328 Ga0501227_001394 3300049665 Bacteria 5405
329 Ga0501225_0045446 3300049705 Bacteria 1216
330 Ga0501283_000885 3300049779 Bacteria 3960
331 nmdc:mga05p37_200132_c1 3300050507 Bacteria 2420
332 nmdc:mga05p37_252544_c1 3300050507 Bacteria 2114
333 nmdc:mga05p37_52150_c1 3300050507 Bacteria 5031
334 nmdc:mga05p37_577829_c1 3300050507 Unclassified 1273
335 nmdc:mga05p37_64077_c1 3300050507 Bacteria 4523
336 nmdc:mga06r32_234680_c1 3300050510 Unclassified 1822
337 nmdc:mga06r32_434876_c1 3300050510 Unclassified 1293
338 nmdc:mga08y16_125530_c1 3300050511 Bacteria 2670
339 nmdc:mga08y16_165037_c1 3300050511 Bacteria 2301
340 nmdc:mga08y16_27781_c1 3300050511 Bacteria 5963
341 nmdc:mga0n895_192876_c1 3300050512 Unclassified 2068
342 nmdc:mga0n895_213944_c1 3300050512 Bacteria 1957
343 nmdc:mga0n895_71069_c1 3300050512 Bacteria 3450
344 nmdc:mga0rr50_185305_c1 3300050513 Bacteria 1703
345 nmdc:mga0a205_121931_c1 3300050515 Bacteria 2506
346 nmdc:mga0a205_127702_c1 3300050515 Bacteria 2442
347 nmdc:mga0a205_183040_c1 3300050515 Bacteria 1989
348 nmdc:mga0a205_391603_c1 3300050515 Unclassified 1254
349 nmdc:mga0a205_7172_c1 3300050515 Bacteria 10072
350 JGI25406J46586_10015019
351 JGI24751J29686_10000124
352 rootL2_10022041
353 Ga0065714_10064699
354 Ga0065704_10114592
355 Ga0065712_10000190
356 Ga0065712_10006655
357 Ga0065712_10009218
358 Ga0065712_10089420
359 Ga0065715_10004159
360 Ga0065715_10094760
361 Ga0065715_10096821
362 Ga0065715_10131679
363 Ga0065707_10008284
364 Ga0065707_10114565
365 Ga0070690_100012920
366 Ga0070690_100046621
367 Ga0070670_100002011
368 Ga0070670_100028464
369 Ga0070670_100296375
370 Ga0068869_100040052
371 Ga0068869_100052326
372 Ga0068869_100053562
373 Ga0068869_100104895
374 Ga0068869_100128990
375 Ga0070680_100015233
376 Ga0070680_100026992
377 Ga0070680_100079715
378 Ga0070682_100016927
379 Ga0070661_100043308
380 Ga0070692_10034204
381 Ga0070692_10061547
382 Ga0070669_100056617
383 Ga0070669_100069106
384 Ga0070673_100028260
385 Ga0070673_100046153
386 Ga0070673_100066927
387 Ga0070667_100105904
388 Ga0070709_10131885
389 Ga0070701_10024946
390 Ga0070701_10034952
391 Ga0070705_100007011
392 Ga0070705_100026079
393 Ga0070705_100059064
394 Ga0070705_100096343
395 Ga0070700_100000173
396 Ga0070700_100038294
397 Ga0070700_100095191
398 Ga0070694_100010128
399 Ga0070694_100069920
400 Ga0070694_100102371
401 Ga0070708_100002555
402 Ga0070681_10000208
403 Ga0070681_10008664
404 Ga0070681_10012914
405 Ga0068867_100022612
406 Ga0068867_100150095
407 Ga0070685_10031321
408 Ga0070706_100000300
409 Ga0070706_100006356
410 Ga0070706_100058432
411 Ga0070707_100059853
412 Ga0070707_100118689
413 Ga0070707_100447332
414 Ga0070698_100005047
415 Ga0070698_100024071
416 Ga0070698_100036000
417 Ga0070698_100058878
418 Ga0070699_100023566
419 Ga0070699_100025273
420 Ga0070699_100054317
421 Ga0070699_100105862
422 Ga0070679_100000234
423 Ga0070697_100000462
424 Ga0070697_100000629
425 Ga0070697_100013506
426 Ga0070697_100163443
427 Ga0070697_100290868
428 Ga0068853_100055041
429 Ga0070672_100010989
430 Ga0070686_100034633
431 Ga0070695_100016465
432 Ga0070695_100048634
433 Ga0070695_100051302
434 Ga0070696_100022738
435 Ga0070696_100075535
436 Ga0070696_100083978
437 Ga0070696_100105305
438 Ga0070693_100004711
439 Ga0070693_100007584
440 Ga0070693_100044920
441 Ga0070704_100044401
442 Ga0070704_100095912
443 Ga0070704_100119580
444 Ga0070664_100004823
445 Ga0068857_100023081
446 Ga0068854_100063416
447 Ga0068859_100016576
448 Ga0068859_100020151
449 Ga0068859_100032930
450 Ga0068859_100110731
451 Ga0068859_100111899
452 Ga0068859_100113624
453 Ga0068859_100151138
454 Ga0068859_100220736
455 Ga0068859_100220764
456 Ga0068864_100008991
457 Ga0068864_100278487
458 Ga0068861_100104326
459 Ga0068861_100185365
460 Ga0068851_10008690
461 Ga0068870_10176757
462 Ga0068863_100047451
463 Ga0068858_100126496
464 Ga0068858_100135419
465 Ga0068860_100042050
466 Ga0068860_100242947
467 Ga0068862_100066311
468 Ga0068862_100195982
469 Ga0068862_100206594
470 Ga0081539_10000022
471 Ga0081539_10002822
472 Ga0081539_10020348
473 Ga0097621_100030066
474 Ga0068871_100027773
475 Ga0068871_100051081
476 Ga0068871_100081400
477 Ga0075430_100122889
478 Ga0075431_100032351
479 Ga0075433_10100551
480 Ga0075433_10129117
481 Ga0075433_10181414
482 Ga0075434_100050296
483 Ga0075434_100075963
484 Ga0075434_100089294
485 Ga0075434_100190474
486 Ga0075429_100053941
487 Ga0097620_100016576
488 Ga0097620_100020150
489 Ga0097620_100032929
490 Ga0097620_100110730
491 Ga0097620_100111901
492 Ga0097620_100113619
493 Ga0097620_100151157
494 Ga0097620_100220739
495 Ga0097620_100220762
496 Ga0075435_100023961
497 Ga0105240_10059271
498 Ga0111539_10204657
499 Ga0111539_10219622
500 Ga0111539_10571006
501 Ga0105245_10055677
502 Ga0105247_10002754
503 Ga0114129_10021714
504 Ga0114129_10026759
505 Ga0114129_10094382
506 Ga0114129_10103664
507 Ga0114129_10108049
508 Ga0114129_10111886
509 Ga0114129_10115811
510 Ga0114129_10127058
511 Ga0114129_10241958
512 Ga0114129_10580425
513 Ga0105243_10004448
514 Ga0105243_10038296
515 Ga0105243_10056078
516 Ga0105243_10441067
517 Ga0105241_10040321
518 Ga0105241_10108515
519 Ga0105241_10216741
520 Ga0105241_10219760
521 Ga0105241_10341728
522 Ga0105242_10001130
523 Ga0105242_10036008
524 Ga0105248_10016493
525 Ga0105248_10028767
526 Ga0105248_10062709
527 Ga0105248_10229926
528 Ga0105248_10257339
529 Ga0105237_10015469
530 Ga0105238_10028503
531 Ga0105238_10031518
532 Ga0105249_10033042
533 Ga0105249_10224342
534 Ga0105239_10013865
535 Ga0105239_10109127
536 Ga0105239_10252944
537 Ga0157373_10036034
538 Ga0157374_10056814
539 Ga0157378_10000105
540 Ga0157378_10015186
541 Ga0157378_10016850
542 Ga0157378_10110376
543 Ga0157378_10246087
544 Ga0157378_10307987
545 Ga0163162_10028900
546 Ga0163162_10096576
547 Ga0163162_10102547
548 Ga0163162_10154305
549 Ga0163162_10464325
550 Ga0157372_10008096
551 Ga0157372_10369531
552 Ga0157375_10004819
553 Ga0157375_10026296
554 Ga0157375_10068279
555 Ga0157375_10380001
556 Ga0163163_10014128
557 Ga0163163_10015695
558 Ga0163163_10078659
559 Ga0163163_10145359
560 Ga0163163_10160675
561 Ga0163163_10211178
562 Ga0157380_10048043
563 Ga0157380_10115965
564 Ga0157380_10157996
565 Ga0157380_10407775
566 Ga0157377_10017571
567 Ga0157377_10035708
568 Ga0157379_10185820
569 Ga0157376_10042648
570 Ga0213876_10000241
571 Ga0207656_10004857
572 Ga0207710_10001315
573 Ga0207688_10057038
574 Ga0207647_10011372
575 Ga0207645_10088644
576 Ga0207643_10010905
577 Ga0207684_10000367
578 Ga0207684_10016681
579 Ga0207684_10044533
580 Ga0207654_10023110
581 Ga0207707_10000031
582 Ga0207707_10054395
583 Ga0207707_10059730
584 Ga0207707_10409066
585 Ga0207671_10016690
586 Ga0207660_10001163
587 Ga0207660_10051838
588 Ga0207660_10057776
589 Ga0207649_10251181
590 Ga0207652_10000063
591 Ga0207646_10148733
592 Ga0207646_10273373
593 Ga0207646_10344709
594 Ga0207681_10036101
595 Ga0207694_10020216
596 Ga0207694_10065596
597 Ga0207650_10000022
598 Ga0207650_10033990
599 Ga0207650_10102502
600 Ga0207650_10179851
601 Ga0207690_10114675
602 Ga0207706_10143099
603 Ga0207686_10007032
604 Ga0207686_10024728
605 Ga0207709_10031965
606 Ga0207709_10050490
607 Ga0207669_10084279
608 Ga0207691_10035547
609 Ga0207711_10011141
610 Ga0207711_10046033
611 Ga0207711_10075959
612 Ga0207689_10003891
613 Ga0207689_10034587
614 Ga0207689_10058879
615 Ga0207689_10120249
616 Ga0207689_10144566
617 Ga0207651_10041450
618 Ga0207651_10101334
619 Ga0207651_10131935
620 Ga0207712_10031289
621 Ga0207640_10105847
622 Ga0207640_10110107
623 Ga0207677_10029007
624 Ga0207703_10012101
625 Ga0207703_10160601
626 Ga0207708_10000475
627 Ga0207708_10056115
628 Ga0207708_10117430
629 Ga0207648_10013330
630 Ga0207648_10146206
631 Ga0207676_10027559
632 Ga0207676_10126035
633 Ga0207674_10000129
634 Ga0207674_10063101
635 Ga0207674_10184578
636 Ga0207675_100027053
637 Ga0207675_100037749
638 Ga0207675_100045513
639 Ga0207675_100115207
640 Ga0207675_100369082
641 Ga0207428_10034501
642 Ga0207428_10063644
643 Ga0207428_10096610
644 Ga0268265_10095617
645 Ga0268264_10117911
646 Ga0268264_10144503
647 Ga0268264_10156953
648 Ga0307513_10028907
649 Ga0307405_10092182
650 Ga0307405_10114942
651 Ga0307412_10184742
652 Ga0307416_100289268
653 Ga0307416_100564936
654 Ga0307411_10039678
655 Ga0307415_100011961
656 Ga0373951_0003248
657 Ga0395898_0311434
658 Ga0395901_0264363
659 Ga0436365_1125551
660 Ga0436365_1648690
661 Ga0439448_0039887
662 Ga0453683_0041409
663 Ga0453684_0226234
664 Ga0451576_0090360
665 Ga0496100_0142194
666 Ga0496106_0099216
667 Ga0496112_0317734
668 Ga0496113_0250476
669 Ga0501296_001339
670 Ga0501296_003305
671 Ga0501297_004517
672 Ga0501299_001324
673 Ga0501303_004841
674 Ga0501038_0007268
675 Ga0501202_004307
676 Ga0501216_007997
677 Ga0501227_001394
678 Ga0501225_0045446
679 Ga0501283_000885
680 nmdc:mga05p37_200132_c1
681 nmdc:mga05p37_252544_c1
682 nmdc:mga05p37_52150_c1
683 nmdc:mga05p37_577829_c1
684 nmdc:mga05p37_64077_c1
685 nmdc:mga06r32_234680_c1
686 nmdc:mga06r32_434876_c1
687 nmdc:mga08y16_125530_c1
688 nmdc:mga08y16_165037_c1
689 nmdc:mga08y16_27781_c1
690 nmdc:mga0n895_192876_c1
691 nmdc:mga0n895_213944_c1
692 nmdc:mga0n895_71069_c1
693 nmdc:mga0rr50_185305_c1
694 nmdc:mga0a205_121931_c1
695 nmdc:mga0a205_127702_c1
696 nmdc:mga0a205_183040_c1
697 nmdc:mga0a205_391603_c1
698 nmdc:mga0a205_7172_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kvp-assembly1.cif.gz_B crystal structure of uncharacterized protein ymzc precursor from bacillus subtilis, northeast structural genomics consortium target sr378a 0.8054 236 280
6ouo-assembly1.cif.gz_q rf2 accommodated state bound 70s complex at long incubation time 0.6699 27 79
2dm0-assembly1.cif.gz_A solution structure of the sh2 domain of human tyrosine-protein kinase txk 0.6685 287 334
3d2l-assembly1.cif.gz_A crystal structure of sam-dependent methyltransferase (zp_00538691.1) from exiguobacterium sp. 255-15 at 1.90 a resolution 0.6418 286 330
3rcd-assembly1.cif.gz_A her2 kinase domain complexed with tak-285 0.6401 285 319
ID Description Score Start End Superfamily
af_P54039_184_239_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7997 26 83 2.30.30.30
af_Q8I318_33_94_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.729 29 79 2.30.30.30
af_E7EZF3_135_201_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.7245 25 85 2.30.30.140
af_Q9P7P9_13_172_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.7134 294 330 3.10.310.10
3m9qA01 Mainly Beta;Roll;SH3 type barrels.; 0.7093 22 85 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A3G2CKF3-F1-model_v4 SH3b domain-containing protein 0.8984 84 340
AF-Q7X2T5-F1-model_v4 SH3b domain-containing protein 0.8588 2 340
AF-A0A136K472-F1-model_v4 deleted 0.8542 38 331
AF-Q7X2T5-F1-model_v4 SH3b domain-containing protein 0.8539 2 340
AF-A0A7W1LW61-F1-model_v4 SH3b domain-containing protein 0.8437 18 340

Map