F417740

General Info

Members Datasets Scaffolds Average Seq Length
348 243 697 216

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606982|2811847758
Length 245
Sequence RAAIASFPVPIGPRRPALDATTTSGTPFSTVIRVASHAQHTEAETSTFMSDLLGGRLGVEAYARYTEQLWFVYRALEDGAASLRDDPVAGPFIQPELMRTAELERDLAHLRGASWHDGLAPLPATAAYAERVARCARDWPAGYVAHHYTRYLGDLSGGQIIRDKAEKTWGFARKGDGVRFYVFEQIPNPAAFKRGYRELLDAVNADDLEKQRIVDECKRAFDYNGAVFRELGAATKSSRRGPLSA

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
14 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
15 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
17 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
18 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
25 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
26 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
27 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
28 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
29 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
32 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
33 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
34 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
35 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
36 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
37 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
38 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
39 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
40 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
41 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
42 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
43 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
44 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
45 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
46 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
47 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
48 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
63 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
64 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
77 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
148 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
149 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
150 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
151 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
152 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
158 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
159 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
160 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
164 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
165 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
166 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
167 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
168 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
169 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
170 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
171 2643221548 Streptomyces sp. Root55 Isolate Unclassified
172 2643221578 Streptomyces sp. Root63 Isolate Unclassified
173 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
174 2643221670 Streptomyces sp. Root431 Isolate Unclassified
175 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
176 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
177 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
178 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
179 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
180 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
181 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
182 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
183 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
184 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
185 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
186 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
187 2808606448 Streptomyces sp. 193411 Isolate Unclassified
188 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
189 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
190 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
191 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
192 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
193 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
194 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
195 2862574272 Streptomyces sp. AcE210 Isolate Nodule
196 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
197 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
198 2867369537 Streptomyces sp. Z26 Isolate Unclassified
199 2867428634 Streptomyces sp. RP5T Isolate Unclassified
200 2867475112 Streptomyces sp. TM32 Isolate Unclassified
201 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
202 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
203 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
204 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
205 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
206 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
207 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
208 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
209 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
210 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
211 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
212 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
213 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
214 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
215 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
216 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
217 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
218 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
219 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
220 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
221 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
222 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
223 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
224 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
225 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
226 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
227 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
228 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
229 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
230 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
231 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
232 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
233 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
234 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
235 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
236 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
237 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
238 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
239 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
240 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
241 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
242 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
243 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.86
Metatranscriptomes 0.86
Isolates 23.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0.57
Rhizoplane 0.86
Rhizosphere 70.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10029759 3300002075 Bacteria 1116
2 rootH1_10001735 3300003316 Bacteria 8403
3 rootH1_10081507 3300003316 Bacteria 1003
4 rootH2_10067067 3300003320 Bacteria 4139
5 rootL2_10018533 3300003322 Bacteria 8027
6 rootL2_10272837 3300003322 Bacteria 1231
7 rootH1_10055859 3300003316 Bacteria 4271
8 rootH1_10055859 3300003323 Bacteria 4451
9 Ga0006562J51391_1096460 3300003578 Bacteria 3198
10 Ga0006562J51391_1162781 3300003578 Bacteria 4140
11 Ga0058863_11782628 3300004799 Bacteria 942
12 Ga0070685_10116408 3300005466 Bacteria 1654
13 Ga0070707_100798032 3300005468 Bacteria 908
14 Ga0068855_100528601 3300005563 Bacteria 1279
15 Ga0075363_100008545 3300006048 Bacteria 4775
16 Ga0075363_100213425 3300006048 Bacteria 1105
17 Ga0183367_1009 3300015688 Bacteria 484598
18 Ga0209758_1003585 3300025297 Bacteria 13890
19 Ga0207426_1005736 3300025302 Bacteria 5594
20 Ga0207426_1010184 3300025302 Bacteria 3667
21 Ga0207426_1053114 3300025302 Bacteria 1197
22 Ga0268266_10727054 3300028379 Bacteria 957
23 Ga0307517_10018788 3300028786 Bacteria 8915
24 Ga0307517_10136733 3300028786 Bacteria 1739
25 Ga0307515_10000140 3300028794 Bacteria 172330
26 Ga0307515_10117342 3300028794 Bacteria 3047
27 Ga0307511_10004554 3300030521 Bacteria 14136
28 Ga0307512_10003329 3300030522 Bacteria 18851
29 Ga0307512_10007411 3300030522 Bacteria 10889
30 Ga0307513_10067525 3300031456 Bacteria 3750
31 Ga0307513_10104297 3300031456 Bacteria 2849
32 Ga0307509_10037142 3300031507 Bacteria 5326
33 Ga0307509_10079193 3300031507 Bacteria 3402
34 Ga0307509_10313430 3300031507 Bacteria 1310
35 Ga0307508_10005900 3300031616 Bacteria 11558
36 Ga0307508_10063314 3300031616 Bacteria 3263
37 Ga0307508_10169465 3300031616 Bacteria 1787
38 Ga0307514_10156830 3300031649 Bacteria 1515
39 Ga0307514_10186513 3300031649 Bacteria 1328
40 Ga0307514_10201139 3300031649 Bacteria 1252
41 Ga0307514_10270478 3300031649 Bacteria 984
42 Ga0307516_10053414 3300031730 Bacteria 3951
43 Ga0307516_10521621 3300031730 Bacteria 842
44 Ga0307518_10082234 3300031838 Bacteria 2324
45 Ga0307518_10114095 3300031838 Bacteria 1921
46 Ga0307518_10182428 3300031838 Bacteria 1417
47 Ga0307409_100282773 3300031995 Bacteria 1534
48 Ga0307416_100429847 3300032002 Bacteria 1367
49 Ga0307507_10031125 3300033179 Bacteria 5607
50 Ga0307507_10064148 3300033179 Bacteria 3393
51 Ga0307507_10065881 3300033179 Bacteria 3326
52 Ga0307510_10011425 3300033180 Bacteria 10548
53 Ga0307510_10119159 3300033180 Bacteria 2350
54 Ga0395898_0002712 3300037466 Bacteria 20438
55 Ga0395898_0017323 3300037466 Bacteria 7360
56 Ga0395901_0252259 3300038443 Bacteria 1838
57 Ga0451802_0576795 3300041460 Bacteria 837
58 Ga0451841_1091765 3300041498 Bacteria 1326
59 Ga0451853_0107251 3300041512 Bacteria 7153
60 Ga0451853_1930286 3300041512 Bacteria 4584
61 Ga0439433_0010925 3300041999 Bacteria 1985
62 Ga0439448_0001118 3300042005 Bacteria 6758
63 Ga0439449_0022333 3300042007 Bacteria 2369
64 Ga0439449_0042524 3300042007 Bacteria 1687
65 Ga0439455_0000460 3300042012 Bacteria 5577
66 Ga0439457_000204 3300042014 Bacteria 15672
67 Ga0439462_0020205 3300042015 Bacteria 1736
68 Ga0450895_001606 3300042132 Bacteria 1587
69 Ga0450896_001086 3300042133 Bacteria 3213
70 Ga0450898_000366 3300042134 Bacteria 5193
71 Ga0450903_001314 3300042138 Bacteria 4650
72 Ga0450906_001982 3300042145 Bacteria 4477
73 Ga0450910_013636 3300042147 Bacteria 1184
74 Ga0439458_0003868 3300042157 Bacteria 3462
75 Ga0450901_011468 3300042533 Bacteria 921
76 Ga0466972_0065302 3300044658 Bacteria 1741
77 Ga0466963_0001072 3300044694 Bacteria 14270
78 Ga0466970_0004462 3300044765 Bacteria 6897
79 Ga0466960_0050808 3300044901 Bacteria 2000
80 Ga0466959_0343976 3300045049 Bacteria 1017
81 Ga0466967_0032928 3300045976 Bacteria 4382
82 Ga0495603_0016619 3300046455 Bacteria 4452
83 Ga0495603_0027987 3300046455 Bacteria 3399
84 Ga0495590_0034271 3300046457 Bacteria 1773
85 Ga0495629_0013919 3300046459 Bacteria 5799
86 Ga0495629_0049124 3300046459 Bacteria 2957
87 Ga0495629_0083976 3300046459 Bacteria 2222
88 Ga0495629_0115392 3300046459 Bacteria 1871
89 Ga0495638_0013716 3300046460 Bacteria 5506
90 Ga0495638_0082634 3300046460 Bacteria 1948
91 Ga0495651_0030189 3300046462 Bacteria 4226
92 Ga0495582_0226945 3300046473 Bacteria 1069
93 Ga0495605_0008830 3300046474 Bacteria 5683
94 Ga0495639_0025096 3300046475 Bacteria 2627
95 Ga0495639_0435082 3300046475 Bacteria 665
96 Ga0495662_0023500 3300046476 Bacteria 2976
97 Ga0495662_0023741 3300046476 Bacteria 2961
98 Ga0495662_0070514 3300046476 Bacteria 1694
99 Ga0495664_0001867 3300046477 Bacteria 11190
100 Ga0495585_0128654 3300046492 Bacteria 1334
101 Ga0495585_0138687 3300046492 Bacteria 1275
102 Ga0495594_0001665 3300046499 Bacteria 11553
103 Ga0495594_0049233 3300046499 Bacteria 2316
104 Ga0495594_0049855 3300046499 Bacteria 2302
105 Ga0495594_0255457 3300046499 Bacteria 998
106 Ga0495596_0014574 3300046500 Bacteria 3312
107 Ga0495607_0267074 3300046501 Bacteria 817
108 Ga0495583_0067005 3300046506 Bacteria 1587
109 Ga0495583_0069167 3300046506 Bacteria 1555
110 Ga0495583_0084351 3300046506 Bacteria 1376
111 Ga0495606_0007959 3300046507 Bacteria 9329
112 Ga0495608_0327937 3300046511 Bacteria 945
113 Ga0495610_0024314 3300046512 Bacteria 3272
114 Ga0495616_0163758 3300046513 Bacteria 998
115 Ga0495620_0017793 3300046515 Bacteria 3534
116 Ga0495620_0031481 3300046515 Bacteria 2431
117 Ga0495620_0088675 3300046515 Bacteria 1243
118 Ga0495628_0028246 3300046516 Bacteria 4560
119 Ga0495628_0199198 3300046516 Bacteria 1509
120 Ga0495632_0036520 3300046519 Bacteria 2499
121 Ga0495637_0169264 3300046520 Bacteria 816
122 Ga0495643_0002335 3300046522 Bacteria 15239
123 Ga0495648_0073742 3300046524 Bacteria 1969
124 Ga0495666_0022712 3300046526 Bacteria 3105
125 Ga0495666_0159570 3300046526 Bacteria 1046
126 Ga0495652_0030033 3300046529 Bacteria 4769
127 Ga0495654_0158058 3300046530 Bacteria 997
128 Ga0495640_0083784 3300046533 Bacteria 2116
129 Ga0495586_0276150 3300046535 Bacteria 961
130 Ga0495587_0003687 3300046536 Bacteria 10191
131 Ga0495597_0017810 3300046542 Bacteria 3338
132 Ga0495645_0176227 3300046543 Bacteria 1468
133 Ga0495622_0004026 3300046557 Bacteria 6861
134 Ga0495622_0058546 3300046557 Bacteria 1784
135 Ga0495622_0206115 3300046557 Bacteria 875
136 Ga0495633_0107667 3300046558 Bacteria 1293
137 Ga0495668_0038726 3300046616 Bacteria 2663
138 Ga0495668_0104500 3300046616 Bacteria 1549
139 Ga0495634_0005860 3300046642 Bacteria 9385
140 Ga0495634_0019876 3300046642 Bacteria 4767
141 Ga0495611_0038759 3300046648 Bacteria 2121
142 Ga0495611_0066993 3300046648 Bacteria 1638
143 Ga0495625_0052219 3300046660 Bacteria 2927
144 Ga0495625_0149053 3300046660 Bacteria 1573
145 Ga0495625_0372724 3300046660 Bacteria 897
146 Ga0495635_0000395 3300046663 Bacteria 27854
147 Ga0495588_0000972 3300046674 Bacteria 12533
148 Ga0495588_0004381 3300046674 Bacteria 6236
149 Ga0495657_0003755 3300046675 Bacteria 12291
150 Ga0495657_0005704 3300046675 Bacteria 9804
151 Ga0495657_0061254 3300046675 Bacteria 2489
152 Ga0495657_0142200 3300046675 Bacteria 1495
153 Ga0495646_0000781 3300046680 Bacteria 17791
154 Ga0495646_0150309 3300046680 Bacteria 1296
155 Ga0495658_0023409 3300046683 Bacteria 3278
156 Ga0495613_0003739 3300046689 Bacteria 11403
157 Ga0495613_0006235 3300046689 Bacteria 8920
158 Ga0495613_0147525 3300046689 Bacteria 1678
159 Ga0495613_0181422 3300046689 Bacteria 1490
160 Ga0495613_0350130 3300046689 Bacteria 1014
161 Ga0495624_0208302 3300046690 Bacteria 1186
162 Ga0495624_0246713 3300046690 Bacteria 1080
163 Ga0495671_0011539 3300046692 Bacteria 4856
164 Ga0495649_0045396 3300046694 Bacteria 2395
165 Ga0495649_0180452 3300046694 Bacteria 1101
166 Ga0495649_0188261 3300046694 Bacteria 1075
167 Ga0495589_0023137 3300046794 Bacteria 3166
168 Ga0495589_0028091 3300046794 Bacteria 2841
169 Ga0495589_0028764 3300046794 Bacteria 2803
170 Ga0495589_0069499 3300046794 Bacteria 1722
171 Ga0495600_0008150 3300046809 Bacteria 6431
172 Ga0495660_0109472 3300046810 Bacteria 1411
173 Ga0495581_0129837 3300047315 Bacteria 1468
174 Ga0495604_0000156 3300047317 Bacteria 59760
175 Ga0495604_0087787 3300047317 Bacteria 2315
176 Ga0495636_0015609 3300047318 Bacteria 3027
177 Ga0495636_0025572 3300047318 Bacteria 2398
178 Ga0495636_0030166 3300047318 Bacteria 2216
179 Ga0495636_0077416 3300047318 Bacteria 1428
180 Ga0495636_0079275 3300047318 Bacteria 1412
181 Ga0495674_0234136 3300047319 Bacteria 1515
182 Ga0495672_0259047 3300047320 Bacteria 840
183 Ga0495676_0002568 3300047321 Bacteria 16167
184 Ga0495676_0018610 3300047321 Bacteria 6124
185 Ga0495676_0023452 3300047321 Bacteria 5357
186 Ga0495676_0062019 3300047321 Bacteria 2921
187 Ga0495676_0062816 3300047321 Bacteria 2897
188 Ga0495676_0075678 3300047321 Bacteria 2573
189 Ga0495680_0507914 3300047322 Bacteria 817
190 Ga0495683_0111004 3300047323 Bacteria 1309
191 Ga0495683_0151236 3300047323 Bacteria 1080
192 Ga0495687_000786 3300047443 Bacteria 34092
193 Ga0495687_061418 3300047443 Bacteria 1545
194 Ga0495687_074117 3300047443 Bacteria 1354
195 Ga0495687_092407 3300047443 Bacteria 1155
196 Ga0495675_0163376 3300047444 Bacteria 1370
197 Ga0495677_0054520 3300047445 Bacteria 1475
198 Ga0495685_001812 3300047447 Bacteria 6593
199 Ga0495685_009834 3300047447 Bacteria 3201
200 Ga0495685_011563 3300047447 Bacteria 2981
201 Ga0495685_014816 3300047447 Bacteria 2654
202 Ga0495685_048768 3300047447 Bacteria 1439
203 Ga0495685_082201 3300047447 Bacteria 1072
204 Ga0495681_0007111 3300047470 Bacteria 7218
205 Ga0495681_0019023 3300047470 Bacteria 3764
206 Ga0495681_0125157 3300047470 Bacteria 1099
207 Ga0495684_0055792 3300047471 Bacteria 3013
208 Ga0495686_0283973 3300047472 Bacteria 919
209 Ga0495686_0399117 3300047472 Bacteria 738
210 Ga0495593_0004586 3300047673 Bacteria 8216
211 Ga0495593_0147943 3300047673 Bacteria 1188
212 Ga0495593_0183888 3300047673 Bacteria 1052
213 Ga0495602_0046571 3300048088 Bacteria 3916
214 Ga0495614_0019650 3300048089 Bacteria 2923
215 Ga0495614_0029866 3300048089 Bacteria 2345
216 Ga0495614_0097508 3300048089 Bacteria 1282
217 Ga0495626_0007599 3300048091 Bacteria 6011
218 Ga0496111_0286840 3300048914 Bacteria 1221
219 Ga0495678_045918 3300049459 Bacteria 1720
220 Ga0501031_0176370 3300049568 Bacteria 1396
221 Ga0501032_0047260 3300049569 Bacteria 2906
222 Ga0501032_0084106 3300049569 Bacteria 2115
223 Ga0501033_0065435 3300049570 Bacteria 2675
224 Ga0501034_0006539 3300049571 Bacteria 12523
225 Ga0501034_0071692 3300049571 Bacteria 3474
226 Ga0501036_0020955 3300049572 Bacteria 5490
227 Ga0501037_0045915 3300049573 Bacteria 3205
228 Ga0501037_0074544 3300049573 Bacteria 2466
229 Ga0501038_0045867 3300049574 Bacteria 3792
230 Ga0501042_0221273 3300049578 Bacteria 1365
231 Ga0501043_0016923 3300049579 Bacteria 5714
232 Ga0501043_0047886 3300049579 Bacteria 3361
233 Ga0501046_0043572 3300049580 Bacteria 3572
234 Ga0501047_0002353 3300049581 Bacteria 18076
235 Ga0501047_0085125 3300049581 Bacteria 3037
236 Ga0501047_0501585 3300049581 Bacteria 1040
237 Ga0501048_0027139 3300049582 Bacteria 4164
238 Ga0501223_059301 3300049663 Bacteria 747
239 Ga0501035_0015008 3300049822 Bacteria 7149
240 Ga0501035_0057930 3300049822 Bacteria 3453
241 Ga0501035_0097788 3300049822 Bacteria 2577
242 Ga0501044_0000770 3300049823 Bacteria 38854
243 Ga0501044_0005343 3300049823 Bacteria 14277
244 Ga0501044_0248714 3300049823 Bacteria 1720
245 Ga0501044_0281757 3300049823 Bacteria 1596
246 Ga0501045_0363083 3300049824 Bacteria 1078
247 Ga0500610_0170120 3300053079 Bacteria 1076
248 Ga0495619_0022413 3300053085 Bacteria 4042
249 Ga0500644_0009211 3300053088 Bacteria 2634
250 Ga0500566_0059187 3300053094 Bacteria 2173
251 Ga0500640_006859 3300053095 Bacteria 4387
252 Ga0500650_0161282 3300053098 Bacteria 1034
253 Ga0500660_078410 3300053100 Bacteria 1522
254 Ga0500560_010976 3300053107 Bacteria 2292
255 Ga0500560_074361 3300053107 Bacteria 1123
256 Ga0500569_095364 3300053109 Bacteria 969
257 Ga0500572_067710 3300053111 Bacteria 1097
258 Ga0500608_179255 3300053122 Bacteria 899
259 Ga0500658_0003021 3300053134 Bacteria 6452
260 Ga0500600_0159928 3300053149 Bacteria 1109
261 Ga0500616_0005088 3300053153 Bacteria 9075
262 Ga0500616_0012774 3300053153 Bacteria 4902
263 Ga0500624_014018 3300053157 Bacteria 1207
264 Ga0500633_0022253 3300053160 Bacteria 1940
265 Ga0500634_0006862 3300053161 Bacteria 5550
266 Ga0500565_025385 3300053734 Bacteria 745
267 Ga0501084_0277086 3300054114 Bacteria 1416
268 Ga0466962_0258338 3300061719 Bacteria 857
269 2811847758 2808606982 Bacteria 7791042
270 2547407692 2547132111 Bacteria 8013147
271 2554258838 2554235005 Bacteria 6457341
272 2585300093 2582581312 Bacteria 7308206
273 2585311496 2582581313 Bacteria 10042643
274 2585317973 2582581314 Bacteria 11452267
275 2616694438 2616644814 Bacteria 11555299
276 2616899570 2616644941 Bacteria 8510691
277 2643759445 2643221548 Bacteria 8053412
278 2643897525 2643221578 Bacteria 9213798
279 2643945002 2643221587 Bacteria 7586415
280 2644385838 2643221670 Bacteria 6497041
281 2644408669 2643221673 Bacteria 9196637
282 2644431901 2643221677 Bacteria 7584031
283 2644435945 2643221678 Bacteria 9540101
284 2644463139 2643221682 Bacteria 6743283
285 2768644420 2767802112 Bacteria 6465194
286 2784587542 2784132148 Bacteria 8627943
287 2785344804 2784746763 Bacteria 9783172
288 2785368084 2784746768 Bacteria 10036182
289 2786669138 2786546132 Bacteria 10419719
290 2804844580 2802429296 Bacteria 7227771
291 2808840742 2808606359 Bacteria 9866990
292 2808919340 2808606375 Bacteria 9466072
293 2809231106 2808606448 Bacteria 8656184
294 2812481581 2811994917 Bacteria 7761064
295 2819693966 2818991463 Bacteria 7948711
296 2831940598 2831935698 Bacteria 5963223
297 2832005050 2832004796 Bacteria 6538017
298 2862182785 2862178590 Bacteria 8583590
299 2862288524 2862281513 Bacteria 9621493
300 2862295451 2862290372 Bacteria 7471434
301 2862582744 2862574272 Bacteria 10567477
302 2863406033 2863404153 Bacteria 9672205
303 2866068308 2866065130 Bacteria 6518152
304 2867370782 2867369537 Bacteria 6501581
305 2867433108 2867428634 Bacteria 9590268
306 2867481303 2867475112 Bacteria 6909112
307 2875393476 2875391855 Bacteria 7600475
308 2877682451 2877676314 Bacteria 9512378
309 2912721478 2912715099 Bacteria 9460473
310 2912725331 2912723979 Bacteria 8557534
311 2912759666 2912757875 Bacteria 7940295
312 2918503370 2918501144 Bacteria 8668083
313 2919468292 2919468124 Bacteria 9133025
314 2935395805 2935390628 Bacteria 7043367
315 2946051226 2946045630 Bacteria 8527308
316 2954675436 2954673503 Bacteria 9685905
317 2954688696 2954682443 Bacteria 9862841
318 2954698467 2954691527 Bacteria 10720516
319 2954703755 2954701450 Bacteria 10834262
320 2954717448 2954711539 Bacteria 10867210
321 2954727411 2954721474 Bacteria 10456478
322 2954734388 2954731030 Bacteria 10243860
323 2954746307 2954740390 Bacteria 10229294
324 2954753272 2954749733 Bacteria 10366972
325 2954765420 2954759201 Bacteria 9358192
326 2966603596 2966598605 Bacteria 7676064
327 2990062522 2990059506 Bacteria 9321252
328 2990093209 2990088156 Bacteria 6657676
329 2997456176 2997451912 Bacteria 8492419
330 3006322254 3006321560 Bacteria 8247479
331 3006427585 3006425503 Bacteria 6491253
332 3006487258 3006486233 Bacteria 8157040
333 3006501999 3006493962 Bacteria 8825450
334 8008562256 8008558824 Bacteria 10610750
335 8023626236 8023623736 Bacteria 8593882
336 8025418752 8025413630 Bacteria 7014048
337 8025479316 8025478263 Bacteria 8209203
338 8025533674 8025530807 Bacteria 8495698
339 8033688947 8033684223 Bacteria 6906479
340 8047899458 8047893842 Bacteria 11723082
341 8048136097 8048127548 Bacteria 11053136
342 8048359472 8048356638 Bacteria 11044339
343 8048376406 8048369669 Bacteria 11666822
344 8048385461 8048379754 Bacteria 11877923
345 8048408908 8048406513 Bacteria 8936924
346 8054167647 8054160619 Bacteria 7783213
347 8056450414 8056447290 Bacteria 7680491
348 8056668784 8056667051 Bacteria 6953971
349 8056836590 8056829672 Bacteria 9045328
350 JGI24738J21930_10029759
351 rootH1_10001735
352 rootH1_10081507
353 rootH2_10067067
354 rootL2_10018533
355 rootL2_10272837
356 rootH1_10055859
357 Ga0006562J51391_1096460
358 Ga0006562J51391_1162781
359 Ga0058863_11782628
360 Ga0070685_10116408
361 Ga0070707_100798032
362 Ga0068855_100528601
363 Ga0075363_100008545
364 Ga0075363_100213425
365 Ga0183367_1009
366 Ga0209758_1003585
367 Ga0207426_1005736
368 Ga0207426_1010184
369 Ga0207426_1053114
370 Ga0268266_10727054
371 Ga0307517_10018788
372 Ga0307517_10136733
373 Ga0307515_10000140
374 Ga0307515_10117342
375 Ga0307511_10004554
376 Ga0307512_10003329
377 Ga0307512_10007411
378 Ga0307513_10067525
379 Ga0307513_10104297
380 Ga0307509_10037142
381 Ga0307509_10079193
382 Ga0307509_10313430
383 Ga0307508_10005900
384 Ga0307508_10063314
385 Ga0307508_10169465
386 Ga0307514_10156830
387 Ga0307514_10186513
388 Ga0307514_10201139
389 Ga0307514_10270478
390 Ga0307516_10053414
391 Ga0307516_10521621
392 Ga0307518_10082234
393 Ga0307518_10114095
394 Ga0307518_10182428
395 Ga0307409_100282773
396 Ga0307416_100429847
397 Ga0307507_10031125
398 Ga0307507_10064148
399 Ga0307507_10065881
400 Ga0307510_10011425
401 Ga0307510_10119159
402 Ga0395898_0002712
403 Ga0395898_0017323
404 Ga0395901_0252259
405 Ga0451802_0576795
406 Ga0451841_1091765
407 Ga0451853_0107251
408 Ga0451853_1930286
409 Ga0439433_0010925
410 Ga0439448_0001118
411 Ga0439449_0022333
412 Ga0439449_0042524
413 Ga0439455_0000460
414 Ga0439457_000204
415 Ga0439462_0020205
416 Ga0450895_001606
417 Ga0450896_001086
418 Ga0450898_000366
419 Ga0450903_001314
420 Ga0450906_001982
421 Ga0450910_013636
422 Ga0439458_0003868
423 Ga0450901_011468
424 Ga0466972_0065302
425 Ga0466963_0001072
426 Ga0466970_0004462
427 Ga0466960_0050808
428 Ga0466959_0343976
429 Ga0466967_0032928
430 Ga0495603_0016619
431 Ga0495603_0027987
432 Ga0495590_0034271
433 Ga0495629_0013919
434 Ga0495629_0049124
435 Ga0495629_0083976
436 Ga0495629_0115392
437 Ga0495638_0013716
438 Ga0495638_0082634
439 Ga0495651_0030189
440 Ga0495582_0226945
441 Ga0495605_0008830
442 Ga0495639_0025096
443 Ga0495639_0435082
444 Ga0495662_0023500
445 Ga0495662_0023741
446 Ga0495662_0070514
447 Ga0495664_0001867
448 Ga0495585_0128654
449 Ga0495585_0138687
450 Ga0495594_0001665
451 Ga0495594_0049233
452 Ga0495594_0049855
453 Ga0495594_0255457
454 Ga0495596_0014574
455 Ga0495607_0267074
456 Ga0495583_0067005
457 Ga0495583_0069167
458 Ga0495583_0084351
459 Ga0495606_0007959
460 Ga0495608_0327937
461 Ga0495610_0024314
462 Ga0495616_0163758
463 Ga0495620_0017793
464 Ga0495620_0031481
465 Ga0495620_0088675
466 Ga0495628_0028246
467 Ga0495628_0199198
468 Ga0495632_0036520
469 Ga0495637_0169264
470 Ga0495643_0002335
471 Ga0495648_0073742
472 Ga0495666_0022712
473 Ga0495666_0159570
474 Ga0495652_0030033
475 Ga0495654_0158058
476 Ga0495640_0083784
477 Ga0495586_0276150
478 Ga0495587_0003687
479 Ga0495597_0017810
480 Ga0495645_0176227
481 Ga0495622_0004026
482 Ga0495622_0058546
483 Ga0495622_0206115
484 Ga0495633_0107667
485 Ga0495668_0038726
486 Ga0495668_0104500
487 Ga0495634_0005860
488 Ga0495634_0019876
489 Ga0495611_0038759
490 Ga0495611_0066993
491 Ga0495625_0052219
492 Ga0495625_0149053
493 Ga0495625_0372724
494 Ga0495635_0000395
495 Ga0495588_0000972
496 Ga0495588_0004381
497 Ga0495657_0003755
498 Ga0495657_0005704
499 Ga0495657_0061254
500 Ga0495657_0142200
501 Ga0495646_0000781
502 Ga0495646_0150309
503 Ga0495658_0023409
504 Ga0495613_0003739
505 Ga0495613_0006235
506 Ga0495613_0147525
507 Ga0495613_0181422
508 Ga0495613_0350130
509 Ga0495624_0208302
510 Ga0495624_0246713
511 Ga0495671_0011539
512 Ga0495649_0045396
513 Ga0495649_0180452
514 Ga0495649_0188261
515 Ga0495589_0023137
516 Ga0495589_0028091
517 Ga0495589_0028764
518 Ga0495589_0069499
519 Ga0495600_0008150
520 Ga0495660_0109472
521 Ga0495581_0129837
522 Ga0495604_0000156
523 Ga0495604_0087787
524 Ga0495636_0015609
525 Ga0495636_0025572
526 Ga0495636_0030166
527 Ga0495636_0077416
528 Ga0495636_0079275
529 Ga0495674_0234136
530 Ga0495672_0259047
531 Ga0495676_0002568
532 Ga0495676_0018610
533 Ga0495676_0023452
534 Ga0495676_0062019
535 Ga0495676_0062816
536 Ga0495676_0075678
537 Ga0495680_0507914
538 Ga0495683_0111004
539 Ga0495683_0151236
540 Ga0495687_000786
541 Ga0495687_061418
542 Ga0495687_074117
543 Ga0495687_092407
544 Ga0495675_0163376
545 Ga0495677_0054520
546 Ga0495685_001812
547 Ga0495685_009834
548 Ga0495685_011563
549 Ga0495685_014816
550 Ga0495685_048768
551 Ga0495685_082201
552 Ga0495681_0007111
553 Ga0495681_0019023
554 Ga0495681_0125157
555 Ga0495684_0055792
556 Ga0495686_0283973
557 Ga0495686_0399117
558 Ga0495593_0004586
559 Ga0495593_0147943
560 Ga0495593_0183888
561 Ga0495602_0046571
562 Ga0495614_0019650
563 Ga0495614_0029866
564 Ga0495614_0097508
565 Ga0495626_0007599
566 Ga0496111_0286840
567 Ga0495678_045918
568 Ga0501031_0176370
569 Ga0501032_0047260
570 Ga0501032_0084106
571 Ga0501033_0065435
572 Ga0501034_0006539
573 Ga0501034_0071692
574 Ga0501036_0020955
575 Ga0501037_0045915
576 Ga0501037_0074544
577 Ga0501038_0045867
578 Ga0501042_0221273
579 Ga0501043_0016923
580 Ga0501043_0047886
581 Ga0501046_0043572
582 Ga0501047_0002353
583 Ga0501047_0085125
584 Ga0501047_0501585
585 Ga0501048_0027139
586 Ga0501223_059301
587 Ga0501035_0015008
588 Ga0501035_0057930
589 Ga0501035_0097788
590 Ga0501044_0000770
591 Ga0501044_0005343
592 Ga0501044_0248714
593 Ga0501044_0281757
594 Ga0501045_0363083
595 Ga0500610_0170120
596 Ga0495619_0022413
597 Ga0500644_0009211
598 Ga0500566_0059187
599 Ga0500640_006859
600 Ga0500650_0161282
601 Ga0500660_078410
602 Ga0500560_010976
603 Ga0500560_074361
604 Ga0500569_095364
605 Ga0500572_067710
606 Ga0500608_179255
607 Ga0500658_0003021
608 Ga0500600_0159928
609 Ga0500616_0005088
610 Ga0500616_0012774
611 Ga0500624_014018
612 Ga0500633_0022253
613 Ga0500634_0006862
614 Ga0500565_025385
615 Ga0501084_0277086
616 Ga0466962_0258338
617 2811847758
618 2547407692
619 2554258838
620 2585300093
621 2585311496
622 2585317973
623 2616694438
624 2616899570
625 2643759445
626 2643897525
627 2643945002
628 2644385838
629 2644408669
630 2644431901
631 2644435945
632 2644463139
633 2768644420
634 2784587542
635 2785344804
636 2785368084
637 2786669138
638 2804844580
639 2808840742
640 2808919340
641 2809231106
642 2812481581
643 2819693966
644 2831940598
645 2832005050
646 2862182785
647 2862288524
648 2862295451
649 2862582744
650 2863406033
651 2866068308
652 2867370782
653 2867433108
654 2867481303
655 2875393476
656 2877682451
657 2912721478
658 2912725331
659 2912759666
660 2918503370
661 2919468292
662 2935395805
663 2946051226
664 2954675436
665 2954688696
666 2954698467
667 2954703755
668 2954717448
669 2954727411
670 2954734388
671 2954746307
672 2954753272
673 2954765420
674 2966603596
675 2990062522
676 2990093209
677 2997456176
678 3006322254
679 3006427585
680 3006487258
681 3006501999
682 8008562256
683 8023626236
684 8025418752
685 8025479316
686 8025533674
687 8033688947
688 8047899458
689 8048136097
690 8048359472
691 8048376406
692 8048385461
693 8048408908
694 8054167647
695 8056450414
696 8056668784
697 8056836590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01126

Heme_oxygenase

Heme oxygenase

26

230

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uc9-assembly2.cif.gz_B crystal structure of human heme oxygenase-2 in complex with myristate 0.9695 1 208
4g7l-assembly1.cif.gz_A crystal structure of rat heme oxygenase-1 in complex with heme and o2 0.9691 2 212
1dvg-assembly2.cif.gz_B crystal structure of rat heme oxygenase-1 in complex with heme; seleleno-methionine derivative, mutated at m51t,m93l,m155l,m191l. 0.9656 1 212
2qpp-assembly1.cif.gz_B crystal structure of human heme oxygenase-2 c127a (ho-2) with bound heme 0.9643 1 209
6j79-assembly2.cif.gz_B fusion protein of heme oxygenase-1 and nadph-cytochrome p450 reductase (13aa) 0.9603 1 214
ID Description Score Start End Superfamily
af_P09601_1_233_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9744 3 209 1.20.910.10
5uc8B00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9705 2 208 1.20.910.10
4wmhA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9619 2 204 1.20.910.10
2rgzB00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9561 1 209 1.20.910.10
1iw1A00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9552 3 207 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A5P2D850-F1-model_v4 Biliverdin-producing heme oxygenase 1.002 1 214 GO:0004392
GO:0006788
GO:0006979
GO:0020037
GO:0042167
GO:0046872
AF-A0A6I6N2S9-F1-model_v4 Biliverdin-producing heme oxygenase 1.001 1 214 GO:0004392
GO:0006788
GO:0006979
GO:0020037
GO:0042167
GO:0046872
AF-A0A4U0SPT2-F1-model_v4 Biliverdin-producing heme oxygenase 1 2 214 GO:0004392
GO:0006788
GO:0006979
GO:0020037
GO:0042167
AF-A0A239P0X5-F1-model_v4 Heme oxygenase 1 1 214 GO:0004392
GO:0006788
GO:0006979
GO:0020037
GO:0042167
GO:0046872
AF-A0A3Q9FUG8-F1-model_v4 Biliverdin-producing heme oxygenase 0.9991 1 214 GO:0004392
GO:0006788
GO:0006979
GO:0020037
GO:0042167
GO:0046872

Map