F417730

General Info

Members Datasets Scaffolds Average Seq Length
348 190 696 171

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0266317|Ga0466962_0266317_10_615
Length 201
Sequence MVGTAGCSRVPQRRVNGVVLSLCLASAVHESSAEIAALQELLDRSYARAGAHLLSIHTPERRAFAEDVVARLSGMCLLVLATVTADGRPIGGPVDGIFYRGAFHFGSAPDSIRFRHIRARPQVSATHLRGEAMAITVHGRAVPVDVRADTGFRRTVLDIYVPRYGPEWEHDFLDSGPVYARIEAEKFFTFAVDSAAARSSQ

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 15.23
Rhizosphere 81.61
Stem 0
Stem Tuber 0
Unclassified 14.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0266317 3300061719 Unclassified 844
2 Ga0070670_100096809 3300005331 Bacteria 2539
3 Ga0070689_100528231 3300005340 Bacteria 1014
4 Ga0070669_100023689 3300005353 Bacteria 4398
5 Ga0070673_100400561 3300005364 Bacteria 1227
6 Ga0070667_100578115 3300005367 Unclassified 1034
7 Ga0070709_10023066 3300005434 Bacteria 3649
8 Ga0070714_100039261 3300005435 Bacteria 3984
9 Ga0070714_100048410 3300005435 Bacteria 3615
10 Ga0070714_100089567 3300005435 Bacteria 2694
11 Ga0070714_100132147 3300005435 Bacteria 2231
12 Ga0070713_100140808 3300005436 Bacteria 2136
13 Ga0070701_10646801 3300005438 Bacteria 705
14 Ga0070711_100311855 3300005439 Bacteria 1254
15 Ga0070711_100550519 3300005439 Unclassified 957
16 Ga0070705_100000619 3300005440 Bacteria 20518
17 Ga0070705_100468335 3300005440 Bacteria 949
18 Ga0070700_100341585 3300005441 Bacteria 1107
19 Ga0070694_100052005 3300005444 Bacteria 2768
20 Ga0070694_100410838 3300005444 Bacteria 1062
21 Ga0068867_100917544 3300005459 Bacteria 789
22 Ga0070697_100785709 3300005536 Unclassified 842
23 Ga0070695_100058135 3300005545 Unclassified 2500
24 Ga0070695_100953482 3300005545 Bacteria 695
25 Ga0070695_101425182 3300005545 Bacteria 575
26 Ga0070693_100364979 3300005547 Unclassified 992
27 Ga0070704_100132352 3300005549 Bacteria 1935
28 Ga0070704_100210023 3300005549 Bacteria 1577
29 Ga0068855_100123683 3300005563 Unclassified 2959
30 Ga0068854_100298790 3300005578 Unclassified 1302
31 Ga0068856_100857010 3300005614 Unclassified 928
32 Ga0068852_100183884 3300005616 Bacteria 1967
33 Ga0068859_100820829 3300005617 Bacteria 1017
34 Ga0068864_100637129 3300005618 Bacteria 1037
35 Ga0068864_100653381 3300005618 Bacteria 1024
36 Ga0068866_10878871 3300005718 Unclassified 629
37 Ga0068861_100478675 3300005719 Unclassified 1121
38 Ga0068858_100755068 3300005842 Unclassified 948
39 Ga0068860_100292574 3300005843 Bacteria 1594
40 Ga0081540_1000463 3300005983 Bacteria 40235
41 Ga0070717_10123546 3300006028 Unclassified 2220
42 Ga0070717_11590089 3300006028 Unclassified 592
43 Ga0075365_10270401 3300006038 Bacteria 1195
44 Ga0070716_100913771 3300006173 Bacteria 688
45 Ga0070712_100003030 3300006175 Bacteria 10391
46 Ga0075428_100036071 3300006844 Bacteria 5449
47 Ga0075428_100120048 3300006844 Bacteria 2862
48 Ga0075428_100235222 3300006844 Bacteria 1977
49 Ga0075428_100925389 3300006844 Unclassified 924
50 Ga0075430_100715943 3300006846 Bacteria 825
51 Ga0075431_100150269 3300006847 Bacteria 2399
52 Ga0075431_100259117 3300006847 Bacteria 1765
53 Ga0075431_100834815 3300006847 Unclassified 893
54 Ga0075433_10008305 3300006852 Bacteria 8277
55 Ga0075433_10274031 3300006852 Bacteria 1495
56 Ga0075434_100031132 3300006871 Bacteria 5259
57 Ga0075429_100003759 3300006880 Bacteria 12941
58 Ga0097620_100820828 3300006931 Bacteria 1017
59 Ga0075435_100015281 3300007076 Bacteria 5768
60 Ga0111539_10015830 3300009094 Bacteria 9368
61 Ga0111539_10034849 3300009094 Bacteria 6098
62 Ga0111539_10242295 3300009094 Bacteria 2099
63 Ga0111539_10570609 3300009094 Bacteria 1318
64 Ga0105247_10458052 3300009101 Bacteria 921
65 Ga0105247_10899961 3300009101 Bacteria 683
66 Ga0114129_10008907 3300009147 Bacteria 14309
67 Ga0114129_10011261 3300009147 Bacteria 12748
68 Ga0114129_10021691 3300009147 Bacteria 9115
69 Ga0114129_10455470 3300009147 Bacteria 1677
70 Ga0105243_10090540 3300009148 Bacteria 2517
71 Ga0105243_10377308 3300009148 Bacteria 1310
72 Ga0105249_10180475 3300009553 Bacteria 2053
73 Ga0105249_10866673 3300009553 Unclassified 969
74 Ga0105239_10033106 3300010375 Bacteria 5677
75 Ga0157374_10620240 3300013296 Unclassified 1092
76 Ga0157378_11756655 3300013297 Unclassified 668
77 Ga0157375_10241024 3300013308 Bacteria 1968
78 Ga0157375_11759192 3300013308 Bacteria 734
79 Ga0157375_12623578 3300013308 Unclassified 602
80 Ga0163163_10448883 3300014325 Bacteria 1349
81 Ga0163163_10600883 3300014325 Bacteria 1163
82 Ga0206353_10464659 3300020082 Bacteria 2335
83 Ga0213876_10074091 3300021384 Bacteria 1798
84 Ga0213875_10000060 3300021388 Bacteria 135020
85 Ga0207692_10063582 3300025898 Bacteria 1918
86 Ga0207688_10277284 3300025901 Bacteria 1021
87 Ga0207699_10083099 3300025906 Bacteria 1991
88 Ga0207693_10005193 3300025915 Bacteria 10902
89 Ga0207662_10687578 3300025918 Bacteria 716
90 Ga0207657_10492078 3300025919 Bacteria 961
91 Ga0207681_10018190 3300025923 Bacteria 4425
92 Ga0207650_10463819 3300025925 Bacteria 1055
93 Ga0207664_10721752 3300025929 Unclassified 896
94 Ga0207706_10358245 3300025933 Bacteria 1267
95 Ga0207709_10141068 3300025935 Unclassified 1656
96 Ga0207667_10356505 3300025949 Bacteria 1491
97 Ga0207667_11174166 3300025949 Unclassified 748
98 Ga0207668_11009948 3300025972 Bacteria 744
99 Ga0207658_10180888 3300025986 Bacteria 1745
100 Ga0207677_10110721 3300026023 Bacteria 2044
101 Ga0207677_10248038 3300026023 Bacteria 1444
102 Ga0207678_11522943 3300026067 Bacteria 590
103 Ga0207702_10182283 3300026078 Unclassified 1935
104 Ga0207641_11354075 3300026088 Bacteria 713
105 Ga0207676_10633646 3300026095 Bacteria 1030
106 Ga0207674_10318207 3300026116 Bacteria 1505
107 Ga0207698_10226916 3300026142 Bacteria 1692
108 Ga0207698_11126734 3300026142 Bacteria 798
109 Ga0207428_10062051 3300027907 Bacteria 2957
110 Ga0207428_10259191 3300027907 Bacteria 1295
111 Ga0268264_10221654 3300028381 Bacteria 1741
112 Ga0265319_1000664 3300028563 Bacteria 22595
113 Ga0307405_10374249 3300031731 Bacteria 1107
114 Ga0307405_10750546 3300031731 Bacteria 813
115 Ga0307413_10095475 3300031824 Bacteria 1949
116 Ga0307410_10175215 3300031852 Bacteria 1620
117 Ga0307410_10182581 3300031852 Bacteria 1589
118 Ga0307406_10014632 3300031901 Bacteria 4518
119 Ga0307406_10200830 3300031901 Bacteria 1467
120 Ga0307407_10067951 3300031903 Bacteria 2109
121 Ga0307412_10449168 3300031911 Bacteria 1062
122 Ga0307409_100053346 3300031995 Bacteria 3106
123 Ga0307409_100703700 3300031995 Bacteria 1010
124 Ga0307409_101621875 3300031995 Bacteria 675
125 Ga0307416_100009367 3300032002 Bacteria 6404
126 Ga0307414_10375916 3300032004 Bacteria 1227
127 Ga0307411_10909372 3300032005 Bacteria 782
128 Ga0373952_0082131 3300035092 Unclassified 824
129 Ga0373923_0103322 3300035111 Unclassified 1259
130 Ga0373936_0095360 3300035113 Bacteria 1251
131 Ga0373936_0137933 3300035113 Unclassified 1052
132 Ga0373945_0082925 3300035116 Bacteria 1231
133 Ga0373953_0030606 3300035117 Bacteria 2088
134 Ga0373955_0075298 3300035172 Bacteria 1897
135 Ga0373931_0187015 3300035691 Bacteria 1230
136 Ga0373935_0026609 3300035692 Bacteria 3572
137 Ga0373935_0471596 3300035692 Bacteria 909
138 Ga0373927_0058186 3300035695 Bacteria 2500
139 Ga0373933_0058464 3300035724 Bacteria 2319
140 Ga0373947_0016290 3300035725 Bacteria 4272
141 Ga0373947_0302050 3300035725 Bacteria 1068
142 Ga0373937_0401833 3300036401 Bacteria 1300
143 Ga0373925_0803670 3300037068 Bacteria 775
144 Ga0395899_0125316 3300037312 Bacteria 1837
145 Ga0395900_0039819 3300037418 Bacteria 4843
146 Ga0395898_0004846 3300037466 Bacteria 14623
147 Ga0395898_0435227 3300037466 Bacteria 1250
148 Ga0395905_0010951 3300037471 Bacteria 8778
149 Ga0436364_0022317 3300037853 Bacteria 87829
150 Ga0436364_0384575 3300037853 Bacteria 1090
151 Ga0395901_0013724 3300038443 Bacteria 8233
152 Ga0395901_0258221 3300038443 Bacteria 1814
153 Ga0395901_1079227 3300038443 Bacteria 774
154 Ga0436365_0135657 3300039437 Bacteria 2786
155 Ga0436365_0407924 3300039437 Bacteria 907
156 Ga0436365_0426998 3300039437 Bacteria 3830
157 Ga0436365_1737094 3300039437 Bacteria 9743
158 Ga0436362_0615433 3300039453 Bacteria 2850
159 Ga0451839_1003500 3300041496 Unclassified 893
160 Ga0466965_0192661 3300044683 Unclassified 1079
161 Ga0466966_0013713 3300044684 Bacteria 5363
162 Ga0466966_0029884 3300044684 Bacteria 3543
163 Ga0466966_0459530 3300044684 Bacteria 765
164 Ga0466961_0127597 3300044693 Bacteria 1595
165 Ga0466961_0313058 3300044693 Bacteria 958
166 Ga0466963_0001712 3300044694 Bacteria 11940
167 Ga0466963_0131748 3300044694 Bacteria 1728
168 Ga0466963_0159835 3300044694 Bacteria 1568
169 Ga0466963_0267599 3300044694 Bacteria 1201
170 Ga0466963_0467206 3300044694 Bacteria 890
171 Ga0466963_0584704 3300044694 Unclassified 789
172 Ga0466964_0187890 3300044706 Bacteria 984
173 Ga0466964_0328482 3300044706 Bacteria 779
174 Ga0466971_0014381 3300044719 Bacteria 3481
175 Ga0466971_0366689 3300044719 Bacteria 699
176 Ga0466968_0141663 3300044735 Bacteria 1100
177 Ga0466968_0309489 3300044735 Bacteria 761
178 Ga0466968_0406404 3300044735 Bacteria 668
179 Ga0466957_0003909 3300044842 Bacteria 8240
180 Ga0466957_0607183 3300044842 Bacteria 766
181 Ga0466959_0518860 3300045049 Bacteria 805
182 Ga0466958_0003797 3300045836 Bacteria 7886
183 Ga0466958_0108577 3300045836 Bacteria 1731
184 Ga0466958_0132806 3300045836 Bacteria 1564
185 Ga0466958_0831402 3300045836 Unclassified 602
186 Ga0466967_0033976 3300045976 Bacteria 4322
187 Ga0466967_0068602 3300045976 Bacteria 3167
188 Ga0466967_0120286 3300045976 Bacteria 2425
189 Ga0466967_0146999 3300045976 Bacteria 2199
190 Ga0466967_0173277 3300045976 Bacteria 2031
191 Ga0466967_0278761 3300045976 Bacteria 1603
192 Ga0466967_0290620 3300045976 Bacteria 1570
193 Ga0466967_0377989 3300045976 Bacteria 1375
194 Ga0466967_0579719 3300045976 Bacteria 1106
195 Ga0466967_0707487 3300045976 Unclassified 998
196 Ga0466967_1184559 3300045976 Bacteria 761
197 Ga0466967_2124672 3300045976 Bacteria 558
198 Ga0495592_0383800 3300046454 Bacteria 893
199 Ga0495629_0003661 3300046459 Bacteria 11620
200 Ga0495641_0011567 3300046461 Bacteria 5014
201 Ga0495641_0015606 3300046461 Bacteria 4044
202 Ga0495651_0017514 3300046462 Bacteria 5549
203 Ga0495651_0200950 3300046462 Bacteria 1395
204 Ga0495651_0661131 3300046462 Bacteria 654
205 Ga0495653_0004721 3300046463 Bacteria 11031
206 Ga0495653_0358694 3300046463 Bacteria 936
207 Ga0495580_0066433 3300046472 Bacteria 2524
208 Ga0495582_0093696 3300046473 Bacteria 1676
209 Ga0495639_0112806 3300046475 Bacteria 1291
210 Ga0495662_0034499 3300046476 Bacteria 2442
211 Ga0495662_0222266 3300046476 Unclassified 931
212 Ga0495664_0161137 3300046477 Unclassified 1361
213 Ga0495664_0206576 3300046477 Bacteria 1190
214 Ga0495584_0512212 3300046491 Bacteria 611
215 Ga0495608_0002572 3300046511 Bacteria 13029
216 Ga0495608_0330003 3300046511 Bacteria 941
217 Ga0495608_0368895 3300046511 Bacteria 881
218 Ga0495608_0471383 3300046511 Bacteria 762
219 Ga0495618_0021222 3300046514 Bacteria 4004
220 Ga0495618_0067522 3300046514 Bacteria 2274
221 Ga0495628_0486104 3300046516 Bacteria 893
222 Ga0495628_0493300 3300046516 Unclassified 885
223 Ga0495630_0100285 3300046517 Bacteria 2191
224 Ga0495630_0229693 3300046517 Bacteria 1417
225 Ga0495630_0633714 3300046517 Bacteria 819
226 Ga0495652_0301097 3300046529 Bacteria 1165
227 Ga0495652_0965135 3300046529 Bacteria 559
228 Ga0495665_0003576 3300046531 Bacteria 8437
229 Ga0495640_0017104 3300046533 Bacteria 5411
230 Ga0495640_0025621 3300046533 Bacteria 4274
231 Ga0495640_0071683 3300046533 Bacteria 2324
232 Ga0495640_0346495 3300046533 Bacteria 917
233 Ga0495587_0089803 3300046536 Unclassified 1775
234 Ga0495667_0013028 3300046559 Bacteria 5632
235 Ga0495667_0034647 3300046559 Bacteria 3376
236 Ga0495634_0018780 3300046642 Bacteria 4916
237 Ga0495634_0096592 3300046642 Bacteria 1913
238 Ga0495635_0001845 3300046663 Bacteria 14336
239 Ga0495635_0378901 3300046663 Unclassified 941
240 Ga0495657_0040246 3300046675 Bacteria 3207
241 Ga0495657_0191774 3300046675 Bacteria 1249
242 Ga0495623_0108242 3300046679 Bacteria 1687
243 Ga0495646_0016990 3300046680 Bacteria 4620
244 Ga0495613_0021444 3300046689 Bacteria 4814
245 Ga0495624_0031420 3300046690 Bacteria 3452
246 Ga0495600_0017914 3300046809 Bacteria 4508
247 Ga0495581_0183880 3300047315 Bacteria 1222
248 Ga0495581_0442436 3300047315 Bacteria 757
249 Ga0495604_0100588 3300047317 Bacteria 2125
250 Ga0495674_0006513 3300047319 Bacteria 11206
251 Ga0495674_0180636 3300047319 Bacteria 1757
252 Ga0495674_0193347 3300047319 Bacteria 1690
253 Ga0495674_0490684 3300047319 Unclassified 983
254 Ga0495676_0013032 3300047321 Bacteria 7482
255 Ga0495680_0011732 3300047322 Bacteria 7740
256 Ga0495680_0017973 3300047322 Bacteria 6015
257 Ga0495680_0131447 3300047322 Bacteria 1839
258 Ga0495675_0072779 3300047444 Bacteria 2168
259 Ga0495684_0017017 3300047471 Bacteria 5601
260 Ga0495684_0072609 3300047471 Bacteria 2614
261 Ga0495684_0480173 3300047471 Bacteria 858
262 Ga0495593_0002417 3300047673 Bacteria 11229
263 Ga0495602_0481213 3300048088 Bacteria 871
264 Ga0495602_0538929 3300048088 Unclassified 810
265 Ga0496100_0014694 3300048903 Bacteria 4553
266 Ga0496100_0042245 3300048903 Bacteria 2911
267 Ga0496101_0009921 3300048904 Bacteria 6275
268 Ga0496101_0011753 3300048904 Bacteria 5820
269 Ga0496101_0117869 3300048904 Bacteria 2005
270 Ga0496101_0951579 3300048904 Bacteria 676
271 Ga0496102_0047106 3300048905 Bacteria 3917
272 Ga0496102_0422702 3300048905 Unclassified 1252
273 Ga0496102_0761873 3300048905 Bacteria 891
274 Ga0496104_0090182 3300048907 Bacteria 2929
275 Ga0496104_0521812 3300048907 Bacteria 1099
276 Ga0496104_0599345 3300048907 Bacteria 1012
277 Ga0496104_0812387 3300048907 Bacteria 841
278 Ga0496104_0832200 3300048907 Bacteria 829
279 Ga0496104_1158506 3300048907 Bacteria 676
280 Ga0496105_0045698 3300048908 Bacteria 3614
281 Ga0496105_0071796 3300048908 Bacteria 2861
282 Ga0496106_0000572 3300048909 Bacteria 26262
283 Ga0496106_0288602 3300048909 Unclassified 1315
284 Ga0496106_0373552 3300048909 Unclassified 1146
285 Ga0496106_1009064 3300048909 Bacteria 654
286 Ga0496107_0024601 3300048910 Bacteria 4260
287 Ga0496107_0129560 3300048910 Bacteria 1862
288 Ga0496108_0080643 3300048911 Bacteria 2757
289 Ga0496108_0219832 3300048911 Bacteria 1650
290 Ga0496108_0321303 3300048911 Bacteria 1350
291 Ga0496109_0031998 3300048912 Bacteria 4725
292 Ga0496109_0135287 3300048912 Bacteria 2302
293 Ga0496109_0542809 3300048912 Bacteria 1097
294 Ga0496109_0547605 3300048912 Unclassified 1091
295 Ga0496110_0025563 3300048913 Bacteria 5047
296 Ga0496110_0075774 3300048913 Bacteria 2990
297 Ga0496110_0270592 3300048913 Bacteria 1547
298 Ga0496111_0031482 3300048914 Bacteria 3779
299 Ga0496111_0205238 3300048914 Bacteria 1464
300 Ga0496111_0622100 3300048914 Bacteria 789
301 Ga0496112_0018475 3300048915 Bacteria 6565
302 Ga0496112_0036198 3300048915 Bacteria 4813
303 Ga0496112_0072661 3300048915 Bacteria 3400
304 Ga0496112_0210683 3300048915 Bacteria 1901
305 Ga0496112_0637223 3300048915 Bacteria 996
306 Ga0496112_0641284 3300048915 Bacteria 992
307 Ga0496113_0033249 3300048916 Bacteria 3754
308 Ga0496113_0043637 3300048916 Bacteria 3319
309 Ga0496113_0106494 3300048916 Bacteria 2178
310 Ga0496113_0229600 3300048916 Bacteria 1480
311 Ga0496113_1104702 3300048916 Bacteria 622
312 Ga0496114_0031819 3300048917 Bacteria 4340
313 Ga0496114_0853651 3300048917 Unclassified 791
314 Ga0496114_1216292 3300048917 Bacteria 639
315 Ga0496115_0038083 3300048918 Bacteria 3814
316 Ga0496115_0202833 3300048918 Bacteria 1638
317 Ga0496115_0554844 3300048918 Bacteria 918
318 Ga0501067_0118011 3300049583 Bacteria 1476
319 Ga0501067_0298356 3300049583 Unclassified 897
320 Ga0501225_0169794 3300049705 Bacteria 676
321 Ga0501045_0278218 3300049824 Bacteria 1246
322 nmdc:mga0yw44_540070_c1 3300050492 Bacteria 791
323 nmdc:mga05p37_123838_c1 3300050507 Bacteria 3176
324 nmdc:mga05p37_312551_c1 3300050507 Bacteria 1862
325 nmdc:mga05p37_357069_c1 3300050507 Bacteria 1719
326 nmdc:mga05p37_69162_c1 3300050507 Bacteria 4343
327 nmdc:mga09592_12744_c1 3300050508 Bacteria 6854
328 nmdc:mga09592_254404_c1 3300050508 Bacteria 1522
329 nmdc:mga0qj67_553705_c1 3300050509 Bacteria 922
330 nmdc:mga06r32_1162291_c1 3300050510 Unclassified 719
331 nmdc:mga06r32_182394_c1 3300050510 Bacteria 2085
332 nmdc:mga08y16_29954_c1 3300050511 Bacteria 5731
333 nmdc:mga08y16_58538_c1 3300050511 Bacteria 4026
334 nmdc:mga08y16_807876_c1 3300050511 Bacteria 930
335 nmdc:mga0n895_5813_c1 3300050512 Bacteria 10362
336 nmdc:mga0rr50_183205_c1 3300050513 Bacteria 1713
337 nmdc:mga08x19_159026_c1 3300050514 Bacteria 1534
338 nmdc:mga0a205_110780_c1 3300050515 Unclassified 2644
339 nmdc:mga0a205_454832_c1 3300050515 Bacteria 1140
340 Ga0495601_0085111 3300053077 Bacteria 2031
341 Ga0495601_0180140 3300053077 Unclassified 1382
342 Ga0495601_0304459 3300053077 Unclassified 1038
343 Ga0495601_0710218 3300053077 Bacteria 641
344 Ga0495595_0031992 3300053084 Bacteria 2367
345 Ga0495595_0131150 3300053084 Bacteria 1225
346 Ga0495619_0102419 3300053085 Bacteria 1950
347 Ga0495619_0111546 3300053085 Bacteria 1869
348 Ga0466962_0495659 3300061719 Unclassified 618
349 Ga0466962_0266317
350 Ga0070670_100096809
351 Ga0070689_100528231
352 Ga0070669_100023689
353 Ga0070673_100400561
354 Ga0070667_100578115
355 Ga0070709_10023066
356 Ga0070714_100039261
357 Ga0070714_100048410
358 Ga0070714_100089567
359 Ga0070714_100132147
360 Ga0070713_100140808
361 Ga0070701_10646801
362 Ga0070711_100311855
363 Ga0070711_100550519
364 Ga0070705_100000619
365 Ga0070705_100468335
366 Ga0070700_100341585
367 Ga0070694_100052005
368 Ga0070694_100410838
369 Ga0068867_100917544
370 Ga0070697_100785709
371 Ga0070695_100058135
372 Ga0070695_100953482
373 Ga0070695_101425182
374 Ga0070693_100364979
375 Ga0070704_100132352
376 Ga0070704_100210023
377 Ga0068855_100123683
378 Ga0068854_100298790
379 Ga0068856_100857010
380 Ga0068852_100183884
381 Ga0068859_100820829
382 Ga0068864_100637129
383 Ga0068864_100653381
384 Ga0068866_10878871
385 Ga0068861_100478675
386 Ga0068858_100755068
387 Ga0068860_100292574
388 Ga0081540_1000463
389 Ga0070717_10123546
390 Ga0070717_11590089
391 Ga0075365_10270401
392 Ga0070716_100913771
393 Ga0070712_100003030
394 Ga0075428_100036071
395 Ga0075428_100120048
396 Ga0075428_100235222
397 Ga0075428_100925389
398 Ga0075430_100715943
399 Ga0075431_100150269
400 Ga0075431_100259117
401 Ga0075431_100834815
402 Ga0075433_10008305
403 Ga0075433_10274031
404 Ga0075434_100031132
405 Ga0075429_100003759
406 Ga0097620_100820828
407 Ga0075435_100015281
408 Ga0111539_10015830
409 Ga0111539_10034849
410 Ga0111539_10242295
411 Ga0111539_10570609
412 Ga0105247_10458052
413 Ga0105247_10899961
414 Ga0114129_10008907
415 Ga0114129_10011261
416 Ga0114129_10021691
417 Ga0114129_10455470
418 Ga0105243_10090540
419 Ga0105243_10377308
420 Ga0105249_10180475
421 Ga0105249_10866673
422 Ga0105239_10033106
423 Ga0157374_10620240
424 Ga0157378_11756655
425 Ga0157375_10241024
426 Ga0157375_11759192
427 Ga0157375_12623578
428 Ga0163163_10448883
429 Ga0163163_10600883
430 Ga0206353_10464659
431 Ga0213876_10074091
432 Ga0213875_10000060
433 Ga0207692_10063582
434 Ga0207688_10277284
435 Ga0207699_10083099
436 Ga0207693_10005193
437 Ga0207662_10687578
438 Ga0207657_10492078
439 Ga0207681_10018190
440 Ga0207650_10463819
441 Ga0207664_10721752
442 Ga0207706_10358245
443 Ga0207709_10141068
444 Ga0207667_10356505
445 Ga0207667_11174166
446 Ga0207668_11009948
447 Ga0207658_10180888
448 Ga0207677_10110721
449 Ga0207677_10248038
450 Ga0207678_11522943
451 Ga0207702_10182283
452 Ga0207641_11354075
453 Ga0207676_10633646
454 Ga0207674_10318207
455 Ga0207698_10226916
456 Ga0207698_11126734
457 Ga0207428_10062051
458 Ga0207428_10259191
459 Ga0268264_10221654
460 Ga0265319_1000664
461 Ga0307405_10374249
462 Ga0307405_10750546
463 Ga0307413_10095475
464 Ga0307410_10175215
465 Ga0307410_10182581
466 Ga0307406_10014632
467 Ga0307406_10200830
468 Ga0307407_10067951
469 Ga0307412_10449168
470 Ga0307409_100053346
471 Ga0307409_100703700
472 Ga0307409_101621875
473 Ga0307416_100009367
474 Ga0307414_10375916
475 Ga0307411_10909372
476 Ga0373952_0082131
477 Ga0373923_0103322
478 Ga0373936_0095360
479 Ga0373936_0137933
480 Ga0373945_0082925
481 Ga0373953_0030606
482 Ga0373955_0075298
483 Ga0373931_0187015
484 Ga0373935_0026609
485 Ga0373935_0471596
486 Ga0373927_0058186
487 Ga0373933_0058464
488 Ga0373947_0016290
489 Ga0373947_0302050
490 Ga0373937_0401833
491 Ga0373925_0803670
492 Ga0395899_0125316
493 Ga0395900_0039819
494 Ga0395898_0004846
495 Ga0395898_0435227
496 Ga0395905_0010951
497 Ga0436364_0022317
498 Ga0436364_0384575
499 Ga0395901_0013724
500 Ga0395901_0258221
501 Ga0395901_1079227
502 Ga0436365_0135657
503 Ga0436365_0407924
504 Ga0436365_0426998
505 Ga0436365_1737094
506 Ga0436362_0615433
507 Ga0451839_1003500
508 Ga0466965_0192661
509 Ga0466966_0013713
510 Ga0466966_0029884
511 Ga0466966_0459530
512 Ga0466961_0127597
513 Ga0466961_0313058
514 Ga0466963_0001712
515 Ga0466963_0131748
516 Ga0466963_0159835
517 Ga0466963_0267599
518 Ga0466963_0467206
519 Ga0466963_0584704
520 Ga0466964_0187890
521 Ga0466964_0328482
522 Ga0466971_0014381
523 Ga0466971_0366689
524 Ga0466968_0141663
525 Ga0466968_0309489
526 Ga0466968_0406404
527 Ga0466957_0003909
528 Ga0466957_0607183
529 Ga0466959_0518860
530 Ga0466958_0003797
531 Ga0466958_0108577
532 Ga0466958_0132806
533 Ga0466958_0831402
534 Ga0466967_0033976
535 Ga0466967_0068602
536 Ga0466967_0120286
537 Ga0466967_0146999
538 Ga0466967_0173277
539 Ga0466967_0278761
540 Ga0466967_0290620
541 Ga0466967_0377989
542 Ga0466967_0579719
543 Ga0466967_0707487
544 Ga0466967_1184559
545 Ga0466967_2124672
546 Ga0495592_0383800
547 Ga0495629_0003661
548 Ga0495641_0011567
549 Ga0495641_0015606
550 Ga0495651_0017514
551 Ga0495651_0200950
552 Ga0495651_0661131
553 Ga0495653_0004721
554 Ga0495653_0358694
555 Ga0495580_0066433
556 Ga0495582_0093696
557 Ga0495639_0112806
558 Ga0495662_0034499
559 Ga0495662_0222266
560 Ga0495664_0161137
561 Ga0495664_0206576
562 Ga0495584_0512212
563 Ga0495608_0002572
564 Ga0495608_0330003
565 Ga0495608_0368895
566 Ga0495608_0471383
567 Ga0495618_0021222
568 Ga0495618_0067522
569 Ga0495628_0486104
570 Ga0495628_0493300
571 Ga0495630_0100285
572 Ga0495630_0229693
573 Ga0495630_0633714
574 Ga0495652_0301097
575 Ga0495652_0965135
576 Ga0495665_0003576
577 Ga0495640_0017104
578 Ga0495640_0025621
579 Ga0495640_0071683
580 Ga0495640_0346495
581 Ga0495587_0089803
582 Ga0495667_0013028
583 Ga0495667_0034647
584 Ga0495634_0018780
585 Ga0495634_0096592
586 Ga0495635_0001845
587 Ga0495635_0378901
588 Ga0495657_0040246
589 Ga0495657_0191774
590 Ga0495623_0108242
591 Ga0495646_0016990
592 Ga0495613_0021444
593 Ga0495624_0031420
594 Ga0495600_0017914
595 Ga0495581_0183880
596 Ga0495581_0442436
597 Ga0495604_0100588
598 Ga0495674_0006513
599 Ga0495674_0180636
600 Ga0495674_0193347
601 Ga0495674_0490684
602 Ga0495676_0013032
603 Ga0495680_0011732
604 Ga0495680_0017973
605 Ga0495680_0131447
606 Ga0495675_0072779
607 Ga0495684_0017017
608 Ga0495684_0072609
609 Ga0495684_0480173
610 Ga0495593_0002417
611 Ga0495602_0481213
612 Ga0495602_0538929
613 Ga0496100_0014694
614 Ga0496100_0042245
615 Ga0496101_0009921
616 Ga0496101_0011753
617 Ga0496101_0117869
618 Ga0496101_0951579
619 Ga0496102_0047106
620 Ga0496102_0422702
621 Ga0496102_0761873
622 Ga0496104_0090182
623 Ga0496104_0521812
624 Ga0496104_0599345
625 Ga0496104_0812387
626 Ga0496104_0832200
627 Ga0496104_1158506
628 Ga0496105_0045698
629 Ga0496105_0071796
630 Ga0496106_0000572
631 Ga0496106_0288602
632 Ga0496106_0373552
633 Ga0496106_1009064
634 Ga0496107_0024601
635 Ga0496107_0129560
636 Ga0496108_0080643
637 Ga0496108_0219832
638 Ga0496108_0321303
639 Ga0496109_0031998
640 Ga0496109_0135287
641 Ga0496109_0542809
642 Ga0496109_0547605
643 Ga0496110_0025563
644 Ga0496110_0075774
645 Ga0496110_0270592
646 Ga0496111_0031482
647 Ga0496111_0205238
648 Ga0496111_0622100
649 Ga0496112_0018475
650 Ga0496112_0036198
651 Ga0496112_0072661
652 Ga0496112_0210683
653 Ga0496112_0637223
654 Ga0496112_0641284
655 Ga0496113_0033249
656 Ga0496113_0043637
657 Ga0496113_0106494
658 Ga0496113_0229600
659 Ga0496113_1104702
660 Ga0496114_0031819
661 Ga0496114_0853651
662 Ga0496114_1216292
663 Ga0496115_0038083
664 Ga0496115_0202833
665 Ga0496115_0554844
666 Ga0501067_0118011
667 Ga0501067_0298356
668 Ga0501225_0169794
669 Ga0501045_0278218
670 nmdc:mga0yw44_540070_c1
671 nmdc:mga05p37_123838_c1
672 nmdc:mga05p37_312551_c1
673 nmdc:mga05p37_357069_c1
674 nmdc:mga05p37_69162_c1
675 nmdc:mga09592_12744_c1
676 nmdc:mga09592_254404_c1
677 nmdc:mga0qj67_553705_c1
678 nmdc:mga06r32_1162291_c1
679 nmdc:mga06r32_182394_c1
680 nmdc:mga08y16_29954_c1
681 nmdc:mga08y16_58538_c1
682 nmdc:mga08y16_807876_c1
683 nmdc:mga0n895_5813_c1
684 nmdc:mga0rr50_183205_c1
685 nmdc:mga08x19_159026_c1
686 nmdc:mga0a205_110780_c1
687 nmdc:mga0a205_454832_c1
688 Ga0495601_0085111
689 Ga0495601_0180140
690 Ga0495601_0304459
691 Ga0495601_0710218
692 Ga0495595_0031992
693 Ga0495595_0131150
694 Ga0495619_0102419
695 Ga0495619_0111546
696 Ga0466962_0495659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

64

148

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wv4-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.8249 22 138
2iab-assembly1.cif.gz_A crystal structure of a protein with fmn-binding split barrel fold (np_828636.1) from streptomyces avermitilis at 2.00 a resolution 0.809 13 138
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.7932 20 137
6ymh-assembly1.cif.gz_AAA x-ray structure of the k72i, y129f, r133l, h199a quadruple mutant of pnp-oxidase from e. coli in complex with plp 0.7895 10 137
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.783 8 140
ID Description Score Start End Superfamily
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7907 8 140 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7859 21 135 2.30.110.10
1vl7B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.776 21 140 2.30.110.10
2iabB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7753 16 138 2.30.110.10
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7553 8 140 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A4R7I621-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9764 3 140
AF-A0A7Y3L8L5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9739 2 140
AF-A0A0T5ZJV5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9624 1 140
AF-A0A2W6DR64-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9566 2 140 GO:0005829
GO:0016627
GO:0070967
AF-A0A0T5ZJV5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9557 1 140

Map