F417579

General Info

Members Datasets Scaffolds Average Seq Length
348 180 696 162

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10385529|Ga0265338_103855292
Length 193
Sequence MAHRRSRKMIRRKEFYTLCAIACLGGMATARRIWGGEVLQLRVAEIQDAEAIVSVINAAFRQAESFLIDRDRIDMEKVRELLQTGIFLVADDLGFLRGCVYVELRGERSYLGLLSVDPQRQKSGLGSNLMDAAEDYCAKAGSRFMDLQIVNLRKELPDFYHRRGYVETGTAPFTPGLNPKLPCHFVKMSKALT

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
167 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
168 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
169 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
172 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
173 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
174 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
175 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
176 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
177 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 35.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10385529 3300028800 Unclassified 1002
2 JGI24751J29686_10000032 3300002459 Bacteria 87712
3 JGI25406J46586_10035713 3300003203 Bacteria 1812
4 Ga0065704_10263904 3300005289 Bacteria 959
5 Ga0065712_10001298 3300005290 Bacteria 8975
6 Ga0065712_10142007 3300005290 Bacteria 1431
7 Ga0065712_10546484 3300005290 Unclassified 620
8 Ga0065715_10003534 3300005293 Bacteria 7412
9 Ga0065715_10245941 3300005293 Bacteria 1183
10 Ga0065715_10791678 3300005293 Unclassified 613
11 Ga0065707_10048381 3300005295 Bacteria 927
12 Ga0065707_10083493 3300005295 Bacteria 8959
13 Ga0070676_10250838 3300005328 Unclassified 1181
14 Ga0070670_100000071 3300005331 Bacteria 102454
15 Ga0070670_100064411 3300005331 Bacteria 3145
16 Ga0068869_100079956 3300005334 Bacteria 2437
17 Ga0068869_100336846 3300005334 Unclassified 1227
18 Ga0068869_100378810 3300005334 Bacteria 1159
19 Ga0070666_10069015 3300005335 Unclassified 2403
20 Ga0070682_100041399 3300005337 Bacteria 2839
21 Ga0068868_100043876 3300005338 Bacteria 3494
22 Ga0068868_100509625 3300005338 Unclassified 1055
23 Ga0070687_100536416 3300005343 Bacteria 794
24 Ga0070692_10090553 3300005345 Bacteria 1662
25 Ga0070692_10364570 3300005345 Unclassified 902
26 Ga0070669_100032413 3300005353 Bacteria 3774
27 Ga0070669_100137459 3300005353 Bacteria 1881
28 Ga0070669_100934528 3300005353 Unclassified 742
29 Ga0070675_100084537 3300005354 Unclassified 2650
30 Ga0070675_100891665 3300005354 Bacteria 815
31 Ga0070675_101483250 3300005354 Bacteria 625
32 Ga0070671_100085158 3300005355 Bacteria 2644
33 Ga0070671_100370054 3300005355 Unclassified 1224
34 Ga0070673_100100567 3300005364 Unclassified 2380
35 Ga0070673_100114325 3300005364 Unclassified 2243
36 Ga0070673_101241012 3300005364 Unclassified 699
37 Ga0070688_100017608 3300005365 Bacteria 4104
38 Ga0070709_10110952 3300005434 Bacteria 1844
39 Ga0070709_10111156 3300005434 Bacteria 1842
40 Ga0070713_100318336 3300005436 Unclassified 1436
41 Ga0070701_10027381 3300005438 Bacteria 2791
42 Ga0070701_10543862 3300005438 Unclassified 761
43 Ga0070701_10944521 3300005438 Unclassified 598
44 Ga0070705_100023424 3300005440 Bacteria 3316
45 Ga0070705_101371952 3300005440 Unclassified 588
46 Ga0070700_100063821 3300005441 Bacteria 2331
47 Ga0070700_100112300 3300005441 Unclassified 1814
48 Ga0070700_100175052 3300005441 Bacteria 1489
49 Ga0070694_100128980 3300005444 Unclassified 1825
50 Ga0070694_100642793 3300005444 Unclassified 858
51 Ga0070694_100756548 3300005444 Unclassified 794
52 Ga0070708_100834224 3300005445 Bacteria 866
53 Ga0070708_101269741 3300005445 Unclassified 688
54 Ga0070663_100479313 3300005455 Bacteria 1030
55 Ga0070678_100169531 3300005456 Bacteria 1776
56 Ga0068867_100574535 3300005459 Bacteria 980
57 Ga0068867_100982058 3300005459 Unclassified 765
58 Ga0070685_10440850 3300005466 Bacteria 910
59 Ga0070706_100054449 3300005467 Bacteria 3692
60 Ga0070706_100469894 3300005467 Unclassified 1170
61 Ga0070698_100135647 3300005471 Unclassified 2415
62 Ga0070698_100418608 3300005471 Unclassified 1274
63 Ga0070699_100245008 3300005518 Bacteria 1601
64 Ga0068853_100021673 3300005539 Bacteria 5360
65 Ga0068853_100598426 3300005539 Bacteria 1047
66 Ga0070695_100042011 3300005545 Bacteria 2901
67 Ga0070696_101104178 3300005546 Unclassified 667
68 Ga0070693_100022334 3300005547 Bacteria 3363
69 Ga0070693_100092814 3300005547 Bacteria 1823
70 Ga0070704_100250283 3300005549 Bacteria 1455
71 Ga0070664_100465640 3300005564 Bacteria 1162
72 Ga0070664_100534141 3300005564 Unclassified 1083
73 Ga0070664_100565940 3300005564 Bacteria 1052
74 Ga0068857_100194986 3300005577 Bacteria 1846
75 Ga0068857_100377987 3300005577 Bacteria 1315
76 Ga0068857_101464974 3300005577 Unclassified 665
77 Ga0068854_100032843 3300005578 Bacteria 3614
78 Ga0068854_100480571 3300005578 Bacteria 1043
79 Ga0070702_100003373 3300005615 Bacteria 7132
80 Ga0070702_100084432 3300005615 Bacteria 1909
81 Ga0070702_100146341 3300005615 Bacteria 1511
82 Ga0070702_100329943 3300005615 Bacteria 1066
83 Ga0068852_100203381 3300005616 Bacteria 1875
84 Ga0068852_100204457 3300005616 Unclassified 1870
85 Ga0068852_101048286 3300005616 Bacteria 835
86 Ga0068859_100040522 3300005617 Bacteria 4675
87 Ga0068859_100067535 3300005617 Bacteria 3609
88 Ga0068859_100074862 3300005617 Bacteria 3425
89 Ga0068859_100155894 3300005617 Bacteria 2361
90 Ga0068859_100192930 3300005617 Bacteria 2121
91 Ga0068859_100297742 3300005617 Bacteria 1706
92 Ga0068859_100513350 3300005617 Bacteria 1293
93 Ga0068859_100823964 3300005617 Unclassified 1015
94 Ga0068859_100929967 3300005617 Unclassified 953
95 Ga0068859_101616983 3300005617 Unclassified 716
96 Ga0068859_101617023 3300005617 Unclassified 715
97 Ga0068864_100089289 3300005618 Unclassified 2715
98 Ga0068864_100459688 3300005618 Unclassified 1218
99 Ga0068864_100992123 3300005618 Unclassified 833
100 Ga0068864_101123050 3300005618 Unclassified 783
101 Ga0068864_101915510 3300005618 Unclassified 599
102 Ga0068861_100035544 3300005719 Bacteria 3691
103 Ga0068861_100329180 3300005719 Bacteria 1333
104 Ga0068870_10253537 3300005840 Bacteria 1092
105 Ga0068863_100056327 3300005841 Bacteria 3722
106 Ga0068863_100168484 3300005841 Bacteria 2100
107 Ga0068863_101052343 3300005841 Bacteria 817
108 Ga0068863_101111869 3300005841 Unclassified 795
109 Ga0068858_100051229 3300005842 Bacteria 3819
110 Ga0068858_100159820 3300005842 Bacteria 2121
111 Ga0068858_100226477 3300005842 Bacteria 1772
112 Ga0068858_100537028 3300005842 Bacteria 1132
113 Ga0068858_100546161 3300005842 Unclassified 1122
114 Ga0068858_101934798 3300005842 Unclassified 583
115 Ga0068860_100012744 3300005843 Bacteria 8267
116 Ga0068860_100016252 3300005843 Bacteria 7255
117 Ga0068860_100182306 3300005843 Bacteria 2029
118 Ga0068860_100199597 3300005843 Bacteria 1938
119 Ga0068860_100431950 3300005843 Bacteria 1307
120 Ga0068860_100519263 3300005843 Bacteria 1191
121 Ga0068860_101803055 3300005843 Unclassified 634
122 Ga0068862_100037282 3300005844 Bacteria 4120
123 Ga0068862_100151338 3300005844 Bacteria 2065
124 Ga0081539_10000980 3300005985 Bacteria 53183
125 Ga0081539_10072742 3300005985 Bacteria 1836
126 Ga0070717_10159516 3300006028 Bacteria 1956
127 Ga0097621_100005736 3300006237 Bacteria 8763
128 Ga0097621_100044794 3300006237 Bacteria 3571
129 Ga0068871_100002728 3300006358 Bacteria 12047
130 Ga0068871_100003115 3300006358 Bacteria 11383
131 Ga0075434_102030667 3300006871 Unclassified 580
132 Ga0068865_100312870 3300006881 Bacteria 1261
133 Ga0097620_100040522 3300006931 Bacteria 4675
134 Ga0097620_100067537 3300006931 Bacteria 3609
135 Ga0097620_100074854 3300006931 Bacteria 3425
136 Ga0097620_100155899 3300006931 Bacteria 2361
137 Ga0097620_100192926 3300006931 Bacteria 2121
138 Ga0097620_100297744 3300006931 Bacteria 1706
139 Ga0097620_100513383 3300006931 Bacteria 1293
140 Ga0097620_100824020 3300006931 Unclassified 1015
141 Ga0097620_100929960 3300006931 Unclassified 953
142 Ga0097620_101616928 3300006931 Unclassified 716
143 Ga0097620_101617090 3300006931 Unclassified 715
144 Ga0111539_10002546 3300009094 Bacteria 24141
145 Ga0105245_10032371 3300009098 Bacteria 4628
146 Ga0105247_10000481 3300009101 Bacteria 33300
147 Ga0105247_10064945 3300009101 Bacteria 2269
148 Ga0105247_10201774 3300009101 Bacteria 1337
149 Ga0105247_10215749 3300009101 Bacteria 1296
150 Ga0114129_10426336 3300009147 Bacteria 1744
151 Ga0105243_10008863 3300009148 Bacteria 7698
152 Ga0105243_10053089 3300009148 Bacteria 3214
153 Ga0105243_10222847 3300009148 Bacteria 1668
154 Ga0105243_10259913 3300009148 Bacteria 1554
155 Ga0105243_10302767 3300009148 Bacteria 1450
156 Ga0105243_10395078 3300009148 Unclassified 1283
157 Ga0105243_10403439 3300009148 Bacteria 1271
158 Ga0105243_11414922 3300009148 Unclassified 716
159 Ga0105241_10112815 3300009174 Bacteria 2178
160 Ga0105241_10120038 3300009174 Bacteria 2116
161 Ga0105241_10238607 3300009174 Bacteria 1536
162 Ga0105242_10152213 3300009176 Bacteria 2018
163 Ga0105248_10042868 3300009177 Bacteria 5074
164 Ga0105248_10162194 3300009177 Bacteria 2521
165 Ga0105248_10179811 3300009177 Bacteria 2383
166 Ga0105248_10218985 3300009177 Bacteria 2143
167 Ga0105248_11070130 3300009177 Bacteria 911
168 Ga0105237_10346635 3300009545 Bacteria 1489
169 Ga0105238_10011531 3300009551 Bacteria 8904
170 Ga0105238_10026351 3300009551 Bacteria 5926
171 Ga0105249_10066776 3300009553 Bacteria 3312
172 Ga0105249_10622221 3300009553 Unclassified 1136
173 Ga0105246_10924812 3300011119 Unclassified 784
174 Ga0157373_10015275 3300013100 Bacteria 5612
175 Ga0157373_10399041 3300013100 Bacteria 985
176 Ga0157371_10278566 3300013102 Bacteria 1208
177 Ga0157374_11041990 3300013296 Unclassified 838
178 Ga0157378_10006743 3300013297 Bacteria 10031
179 Ga0163162_10014497 3300013306 Bacteria 7702
180 Ga0163162_10210831 3300013306 Bacteria 2072
181 Ga0163162_10438857 3300013306 Unclassified 1438
182 Ga0163162_11323583 3300013306 Unclassified 819
183 Ga0163162_11894568 3300013306 Unclassified 682
184 Ga0157375_10400233 3300013308 Unclassified 1540
185 Ga0157375_11343562 3300013308 Unclassified 841
186 Ga0163163_10000062 3300014325 Bacteria 119109
187 Ga0163163_10578120 3300014325 Bacteria 1186
188 Ga0157380_10121649 3300014326 Unclassified 2212
189 Ga0157377_10178899 3300014745 Bacteria 1332
190 Ga0157377_10275606 3300014745 Bacteria 1100
191 Ga0157377_10402053 3300014745 Bacteria 933
192 Ga0157379_10226591 3300014968 Bacteria 1694
193 Ga0157379_10697104 3300014968 Bacteria 953
194 Ga0157379_11109464 3300014968 Unclassified 758
195 Ga0157376_10004346 3300014969 Bacteria 9853
196 Ga0163161_10415752 3300017792 Bacteria 1081
197 Ga0224572_1003826 3300024225 Bacteria 2569
198 Ga0207710_10001393 3300025900 Bacteria 12107
199 Ga0207688_10536685 3300025901 Unclassified 734
200 Ga0207647_10005927 3300025904 Bacteria 8912
201 Ga0207647_10110069 3300025904 Unclassified 1629
202 Ga0207699_10034732 3300025906 Bacteria 2863
203 Ga0207699_10114697 3300025906 Bacteria 1733
204 Ga0207645_10130423 3300025907 Unclassified 1636
205 Ga0207643_10099160 3300025908 Bacteria 1707
206 Ga0207684_10100349 3300025910 Unclassified 2474
207 Ga0207654_10165944 3300025911 Bacteria 1430
208 Ga0207671_10336135 3300025914 Unclassified 1196
209 Ga0207662_10054649 3300025918 Unclassified 2382
210 Ga0207649_10508706 3300025920 Unclassified 917
211 Ga0207681_10112560 3300025923 Bacteria 1982
212 Ga0207681_10159682 3300025923 Bacteria 1698
213 Ga0207681_10541882 3300025923 Unclassified 957
214 Ga0207681_10731236 3300025923 Unclassified 824
215 Ga0207694_10033907 3300025924 Bacteria 3913
216 Ga0207694_10651596 3300025924 Bacteria 887
217 Ga0207650_10000006 3300025925 Bacteria 544730
218 Ga0207650_10041042 3300025925 Unclassified 3389
219 Ga0207650_10278159 3300025925 Bacteria 1362
220 Ga0207659_10507702 3300025926 Bacteria 1021
221 Ga0207687_10023501 3300025927 Bacteria 4110
222 Ga0207700_10172571 3300025928 Unclassified 1805
223 Ga0207644_10050669 3300025931 Bacteria 2977
224 Ga0207686_10114732 3300025934 Bacteria 1823
225 Ga0207686_10304226 3300025934 Bacteria 1185
226 Ga0207709_10004776 3300025935 Bacteria 7773
227 Ga0207709_10169167 3300025935 Bacteria 1532
228 Ga0207709_10223008 3300025935 Bacteria 1361
229 Ga0207709_10779736 3300025935 Unclassified 770
230 Ga0207709_10861950 3300025935 Unclassified 734
231 Ga0207709_11107862 3300025935 Unclassified 650
232 Ga0207669_10933232 3300025937 Unclassified 727
233 Ga0207691_10302767 3300025940 Bacteria 1373
234 Ga0207689_10028211 3300025942 Bacteria 4695
235 Ga0207689_10167989 3300025942 Bacteria 1807
236 Ga0207679_10334296 3300025945 Bacteria 1316
237 Ga0207651_10087150 3300025960 Bacteria 2272
238 Ga0207651_10172479 3300025960 Bacteria 1707
239 Ga0207712_10001556 3300025961 Bacteria 15455
240 Ga0207712_10338660 3300025961 Unclassified 1247
241 Ga0207712_10630371 3300025961 Unclassified 930
242 Ga0207668_10776482 3300025972 Unclassified 847
243 Ga0207640_11179123 3300025981 Unclassified 680
244 Ga0207677_10200130 3300026023 Bacteria 1587
245 Ga0207703_10038209 3300026035 Bacteria 3830
246 Ga0207703_10054523 3300026035 Bacteria 3251
247 Ga0207703_10220153 3300026035 Bacteria 1697
248 Ga0207703_10547329 3300026035 Bacteria 1091
249 Ga0207703_10598485 3300026035 Unclassified 1043
250 Ga0207703_10682270 3300026035 Bacteria 976
251 Ga0207703_11448848 3300026035 Unclassified 661
252 Ga0207639_10420492 3300026041 Bacteria 1208
253 Ga0207639_10463580 3300026041 Unclassified 1152
254 Ga0207708_10047820 3300026075 Bacteria 3256
255 Ga0207708_10095561 3300026075 Bacteria 2295
256 Ga0207708_10146405 3300026075 Unclassified 1857
257 Ga0207708_10215066 3300026075 Bacteria 1538
258 Ga0207708_10956279 3300026075 Unclassified 743
259 Ga0207641_10092422 3300026088 Bacteria 2650
260 Ga0207641_10125561 3300026088 Bacteria 2297
261 Ga0207641_10229482 3300026088 Unclassified 1725
262 Ga0207641_10291700 3300026088 Bacteria 1538
263 Ga0207641_10565334 3300026088 Bacteria 1110
264 Ga0207641_10817929 3300026088 Unclassified 922
265 Ga0207648_10077790 3300026089 Bacteria 2893
266 Ga0207648_10568667 3300026089 Bacteria 1043
267 Ga0207676_10111505 3300026095 Bacteria 2289
268 Ga0207676_10166575 3300026095 Unclassified 1915
269 Ga0207676_10212300 3300026095 Bacteria 1718
270 Ga0207676_10316198 3300026095 Bacteria 1431
271 Ga0207676_10451454 3300026095 Bacteria 1212
272 Ga0207676_11012681 3300026095 Unclassified 819
273 Ga0207674_10100332 3300026116 Unclassified 2876
274 Ga0207674_10145639 3300026116 Bacteria 2327
275 Ga0207674_10208636 3300026116 Bacteria 1903
276 Ga0207675_100040509 3300026118 Bacteria 4350
277 Ga0207675_100092403 3300026118 Bacteria 2846
278 Ga0207683_10232142 3300026121 Bacteria 1683
279 Ga0207698_10252568 3300026142 Bacteria 1614
280 Ga0207698_10920021 3300026142 Bacteria 882
281 Ga0207428_10004829 3300027907 Bacteria 12725
282 Ga0265356_1000415 3300028017 Bacteria 7719
283 Ga0268265_10102327 3300028380 Bacteria 2317
284 Ga0268264_10022700 3300028381 Bacteria 5121
285 Ga0268264_10065040 3300028381 Bacteria 3071
286 Ga0268264_10074996 3300028381 Bacteria 2875
287 Ga0268264_10184506 3300028381 Bacteria 1897
288 Ga0268264_10570417 3300028381 Bacteria 1112
289 Ga0265338_10098695 3300028800 Unclassified 2388
290 Ga0265338_10143425 3300028800 Bacteria 1867
291 Ga0265762_1006465 3300030760 Bacteria 2096
292 Ga0265762_1012465 3300030760 Bacteria 1525
293 Ga0265760_10000214 3300031090 Bacteria 15581
294 Ga0265325_10377956 3300031241 Unclassified 623
295 Ga0265340_10138261 3300031247 Bacteria 1115
296 Ga0265339_10103136 3300031249 Unclassified 1482
297 Ga0265316_10134522 3300031344 Unclassified 1860
298 Ga0265314_10054577 3300031711 Unclassified 2765
299 Ga0307413_10543471 3300031824 Unclassified 941
300 Ga0307406_11419176 3300031901 Unclassified 609
301 Ga0307416_100567822 3300032002 Unclassified 1210
302 Ga0307414_10267084 3300032004 Bacteria 1431
303 Ga0307415_100570431 3300032126 Unclassified 1002
304 Ga0316214_1023655 3300033545 Unclassified 863
305 Ga0373928_0111585 3300035084 Unclassified 724
306 Ga0373951_0000990 3300035091 Bacteria 7622
307 Ga0373936_0001376 3300035113 Bacteria 8824
308 Ga0373953_0005730 3300035117 Unclassified 4050
309 Ga0373956_0117021 3300035119 Bacteria 1243
310 Ga0373943_0002083 3300035170 Bacteria 9081
311 Ga0373942_0009101 3300035207 Unclassified 2320
312 Ga0373924_0034248 3300035410 Bacteria 2055
313 Ga0373935_0013182 3300035692 Unclassified 4984
314 Ga0373927_0001136 3300035695 Bacteria 20149
315 Ga0373933_0168681 3300035724 Bacteria 1392
316 Ga0373947_0001191 3300035725 Bacteria 16011
317 Ga0373937_0062467 3300036401 Unclassified 3424
318 Ga0373937_0640079 3300036401 Unclassified 1008
319 Ga0373925_0001387 3300037068 Bacteria 21090
320 Ga0395900_1008580 3300037418 Unclassified 752
321 Ga0242420_032287 3300038996 Bacteria 975
322 Ga0451576_0297788 3300045051 Bacteria 1687
323 Ga0451576_1646828 3300045051 Unclassified 665
324 Ga0495665_0097016 3300046531 Unclassified 1548
325 Ga0495645_0268407 3300046543 Bacteria 1127
326 Ga0495646_0149180 3300046680 Bacteria 1302
327 Ga0495674_0040101 3300047319 Unclassified 4191
328 Ga0496103_0579935 3300048906 Unclassified 715
329 Ga0496103_0658903 3300048906 Unclassified 665
330 Ga0496108_0420545 3300048911 Bacteria 1167
331 Ga0496111_1091356 3300048914 Unclassified 569
332 Ga0496112_0254850 3300048915 Bacteria 1705
333 Ga0496112_0859121 3300048915 Unclassified 830
334 Ga0501296_007701 3300049519 Bacteria 1239
335 Ga0501298_006910 3300049521 Bacteria 1870
336 Ga0501198_006867 3300049649 Unclassified 1629
337 Ga0501217_012146 3300049661 Unclassified 1916
338 Ga0501223_012937 3300049663 Bacteria 1665
339 Ga0501227_025299 3300049665 Unclassified 1392
340 Ga0501239_012487 3300049672 Unclassified 962
341 Ga0501225_0008786 3300049705 Bacteria 2892
342 Ga0501267_019776 3300049764 Unclassified 737
343 Ga0501268_047820 3300049765 Unclassified 821
344 Ga0501279_037031 3300049775 Unclassified 738
345 Ga0501283_096118 3300049779 Unclassified 572
346 nmdc:mga05p37_91740_c1 3300050507 Bacteria 3743
347 nmdc:mga08y16_3528_c1 3300050511 Bacteria 16241
348 nmdc:mga0a205_357528_c1 3300050515 Unclassified 1327
349 Ga0265338_10385529
350 JGI24751J29686_10000032
351 JGI25406J46586_10035713
352 Ga0065704_10263904
353 Ga0065712_10001298
354 Ga0065712_10142007
355 Ga0065712_10546484
356 Ga0065715_10003534
357 Ga0065715_10245941
358 Ga0065715_10791678
359 Ga0065707_10048381
360 Ga0065707_10083493
361 Ga0070676_10250838
362 Ga0070670_100000071
363 Ga0070670_100064411
364 Ga0068869_100079956
365 Ga0068869_100336846
366 Ga0068869_100378810
367 Ga0070666_10069015
368 Ga0070682_100041399
369 Ga0068868_100043876
370 Ga0068868_100509625
371 Ga0070687_100536416
372 Ga0070692_10090553
373 Ga0070692_10364570
374 Ga0070669_100032413
375 Ga0070669_100137459
376 Ga0070669_100934528
377 Ga0070675_100084537
378 Ga0070675_100891665
379 Ga0070675_101483250
380 Ga0070671_100085158
381 Ga0070671_100370054
382 Ga0070673_100100567
383 Ga0070673_100114325
384 Ga0070673_101241012
385 Ga0070688_100017608
386 Ga0070709_10110952
387 Ga0070709_10111156
388 Ga0070713_100318336
389 Ga0070701_10027381
390 Ga0070701_10543862
391 Ga0070701_10944521
392 Ga0070705_100023424
393 Ga0070705_101371952
394 Ga0070700_100063821
395 Ga0070700_100112300
396 Ga0070700_100175052
397 Ga0070694_100128980
398 Ga0070694_100642793
399 Ga0070694_100756548
400 Ga0070708_100834224
401 Ga0070708_101269741
402 Ga0070663_100479313
403 Ga0070678_100169531
404 Ga0068867_100574535
405 Ga0068867_100982058
406 Ga0070685_10440850
407 Ga0070706_100054449
408 Ga0070706_100469894
409 Ga0070698_100135647
410 Ga0070698_100418608
411 Ga0070699_100245008
412 Ga0068853_100021673
413 Ga0068853_100598426
414 Ga0070695_100042011
415 Ga0070696_101104178
416 Ga0070693_100022334
417 Ga0070693_100092814
418 Ga0070704_100250283
419 Ga0070664_100465640
420 Ga0070664_100534141
421 Ga0070664_100565940
422 Ga0068857_100194986
423 Ga0068857_100377987
424 Ga0068857_101464974
425 Ga0068854_100032843
426 Ga0068854_100480571
427 Ga0070702_100003373
428 Ga0070702_100084432
429 Ga0070702_100146341
430 Ga0070702_100329943
431 Ga0068852_100203381
432 Ga0068852_100204457
433 Ga0068852_101048286
434 Ga0068859_100040522
435 Ga0068859_100067535
436 Ga0068859_100074862
437 Ga0068859_100155894
438 Ga0068859_100192930
439 Ga0068859_100297742
440 Ga0068859_100513350
441 Ga0068859_100823964
442 Ga0068859_100929967
443 Ga0068859_101616983
444 Ga0068859_101617023
445 Ga0068864_100089289
446 Ga0068864_100459688
447 Ga0068864_100992123
448 Ga0068864_101123050
449 Ga0068864_101915510
450 Ga0068861_100035544
451 Ga0068861_100329180
452 Ga0068870_10253537
453 Ga0068863_100056327
454 Ga0068863_100168484
455 Ga0068863_101052343
456 Ga0068863_101111869
457 Ga0068858_100051229
458 Ga0068858_100159820
459 Ga0068858_100226477
460 Ga0068858_100537028
461 Ga0068858_100546161
462 Ga0068858_101934798
463 Ga0068860_100012744
464 Ga0068860_100016252
465 Ga0068860_100182306
466 Ga0068860_100199597
467 Ga0068860_100431950
468 Ga0068860_100519263
469 Ga0068860_101803055
470 Ga0068862_100037282
471 Ga0068862_100151338
472 Ga0081539_10000980
473 Ga0081539_10072742
474 Ga0070717_10159516
475 Ga0097621_100005736
476 Ga0097621_100044794
477 Ga0068871_100002728
478 Ga0068871_100003115
479 Ga0075434_102030667
480 Ga0068865_100312870
481 Ga0097620_100040522
482 Ga0097620_100067537
483 Ga0097620_100074854
484 Ga0097620_100155899
485 Ga0097620_100192926
486 Ga0097620_100297744
487 Ga0097620_100513383
488 Ga0097620_100824020
489 Ga0097620_100929960
490 Ga0097620_101616928
491 Ga0097620_101617090
492 Ga0111539_10002546
493 Ga0105245_10032371
494 Ga0105247_10000481
495 Ga0105247_10064945
496 Ga0105247_10201774
497 Ga0105247_10215749
498 Ga0114129_10426336
499 Ga0105243_10008863
500 Ga0105243_10053089
501 Ga0105243_10222847
502 Ga0105243_10259913
503 Ga0105243_10302767
504 Ga0105243_10395078
505 Ga0105243_10403439
506 Ga0105243_11414922
507 Ga0105241_10112815
508 Ga0105241_10120038
509 Ga0105241_10238607
510 Ga0105242_10152213
511 Ga0105248_10042868
512 Ga0105248_10162194
513 Ga0105248_10179811
514 Ga0105248_10218985
515 Ga0105248_11070130
516 Ga0105237_10346635
517 Ga0105238_10011531
518 Ga0105238_10026351
519 Ga0105249_10066776
520 Ga0105249_10622221
521 Ga0105246_10924812
522 Ga0157373_10015275
523 Ga0157373_10399041
524 Ga0157371_10278566
525 Ga0157374_11041990
526 Ga0157378_10006743
527 Ga0163162_10014497
528 Ga0163162_10210831
529 Ga0163162_10438857
530 Ga0163162_11323583
531 Ga0163162_11894568
532 Ga0157375_10400233
533 Ga0157375_11343562
534 Ga0163163_10000062
535 Ga0163163_10578120
536 Ga0157380_10121649
537 Ga0157377_10178899
538 Ga0157377_10275606
539 Ga0157377_10402053
540 Ga0157379_10226591
541 Ga0157379_10697104
542 Ga0157379_11109464
543 Ga0157376_10004346
544 Ga0163161_10415752
545 Ga0224572_1003826
546 Ga0207710_10001393
547 Ga0207688_10536685
548 Ga0207647_10005927
549 Ga0207647_10110069
550 Ga0207699_10034732
551 Ga0207699_10114697
552 Ga0207645_10130423
553 Ga0207643_10099160
554 Ga0207684_10100349
555 Ga0207654_10165944
556 Ga0207671_10336135
557 Ga0207662_10054649
558 Ga0207649_10508706
559 Ga0207681_10112560
560 Ga0207681_10159682
561 Ga0207681_10541882
562 Ga0207681_10731236
563 Ga0207694_10033907
564 Ga0207694_10651596
565 Ga0207650_10000006
566 Ga0207650_10041042
567 Ga0207650_10278159
568 Ga0207659_10507702
569 Ga0207687_10023501
570 Ga0207700_10172571
571 Ga0207644_10050669
572 Ga0207686_10114732
573 Ga0207686_10304226
574 Ga0207709_10004776
575 Ga0207709_10169167
576 Ga0207709_10223008
577 Ga0207709_10779736
578 Ga0207709_10861950
579 Ga0207709_11107862
580 Ga0207669_10933232
581 Ga0207691_10302767
582 Ga0207689_10028211
583 Ga0207689_10167989
584 Ga0207679_10334296
585 Ga0207651_10087150
586 Ga0207651_10172479
587 Ga0207712_10001556
588 Ga0207712_10338660
589 Ga0207712_10630371
590 Ga0207668_10776482
591 Ga0207640_11179123
592 Ga0207677_10200130
593 Ga0207703_10038209
594 Ga0207703_10054523
595 Ga0207703_10220153
596 Ga0207703_10547329
597 Ga0207703_10598485
598 Ga0207703_10682270
599 Ga0207703_11448848
600 Ga0207639_10420492
601 Ga0207639_10463580
602 Ga0207708_10047820
603 Ga0207708_10095561
604 Ga0207708_10146405
605 Ga0207708_10215066
606 Ga0207708_10956279
607 Ga0207641_10092422
608 Ga0207641_10125561
609 Ga0207641_10229482
610 Ga0207641_10291700
611 Ga0207641_10565334
612 Ga0207641_10817929
613 Ga0207648_10077790
614 Ga0207648_10568667
615 Ga0207676_10111505
616 Ga0207676_10166575
617 Ga0207676_10212300
618 Ga0207676_10316198
619 Ga0207676_10451454
620 Ga0207676_11012681
621 Ga0207674_10100332
622 Ga0207674_10145639
623 Ga0207674_10208636
624 Ga0207675_100040509
625 Ga0207675_100092403
626 Ga0207683_10232142
627 Ga0207698_10252568
628 Ga0207698_10920021
629 Ga0207428_10004829
630 Ga0265356_1000415
631 Ga0268265_10102327
632 Ga0268264_10022700
633 Ga0268264_10065040
634 Ga0268264_10074996
635 Ga0268264_10184506
636 Ga0268264_10570417
637 Ga0265338_10098695
638 Ga0265338_10143425
639 Ga0265762_1006465
640 Ga0265762_1012465
641 Ga0265760_10000214
642 Ga0265325_10377956
643 Ga0265340_10138261
644 Ga0265339_10103136
645 Ga0265316_10134522
646 Ga0265314_10054577
647 Ga0307413_10543471
648 Ga0307406_11419176
649 Ga0307416_100567822
650 Ga0307414_10267084
651 Ga0307415_100570431
652 Ga0316214_1023655
653 Ga0373928_0111585
654 Ga0373951_0000990
655 Ga0373936_0001376
656 Ga0373953_0005730
657 Ga0373956_0117021
658 Ga0373943_0002083
659 Ga0373942_0009101
660 Ga0373924_0034248
661 Ga0373935_0013182
662 Ga0373927_0001136
663 Ga0373933_0168681
664 Ga0373947_0001191
665 Ga0373937_0062467
666 Ga0373937_0640079
667 Ga0373925_0001387
668 Ga0395900_1008580
669 Ga0242420_032287
670 Ga0451576_0297788
671 Ga0451576_1646828
672 Ga0495665_0097016
673 Ga0495645_0268407
674 Ga0495646_0149180
675 Ga0495674_0040101
676 Ga0496103_0579935
677 Ga0496103_0658903
678 Ga0496108_0420545
679 Ga0496111_1091356
680 Ga0496112_0254850
681 Ga0496112_0859121
682 Ga0501296_007701
683 Ga0501298_006910
684 Ga0501198_006867
685 Ga0501217_012146
686 Ga0501223_012937
687 Ga0501227_025299
688 Ga0501239_012487
689 Ga0501225_0008786
690 Ga0501267_019776
691 Ga0501268_047820
692 Ga0501279_037031
693 Ga0501283_096118
694 nmdc:mga05p37_91740_c1
695 nmdc:mga08y16_3528_c1
696 nmdc:mga0a205_357528_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

49

190

0.86

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

49

165

0.73

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

83

167

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.8782 9 161
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.8713 9 161
1wk4-assembly1.cif.gz_A crystal structure of ttk003001606 0.8674 11 161
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.8635 10 162
3e0k-assembly1.cif.gz_A-2 crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus 0.8596 9 140
ID Description Score Start End Superfamily
af_E0CYC6_80_216_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.895 55 140 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8852 55 145 3.40.630.30
1y9kD01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8773 45 140 3.40.630.30
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8736 11 162 3.40.630.30
af_A0A0R0IVX2_54_146_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8709 96 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4V2PV93-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9654 9 161 GO:0016747
AF-A0A2N9MYF7-F1-model_v4 Acetyltransferase, GNAT family 0.9594 11 162 GO:0016747
AF-G8NRP5-F1-model_v4 GCN5-related N-acetyltransferase 0.9497 11 161 GO:0016747
AF-A0A534XR81-F1-model_v4 GNAT family N-acetyltransferase 0.9489 5 162 GO:0016747
AF-A0A534YFJ9-F1-model_v4 GNAT family N-acetyltransferase 0.9481 3 162 GO:0016747

Map