F417490

General Info

Members Datasets Scaffolds Average Seq Length
348 186 347 120

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100012769|Ga0075428_1000127696
Length 132
Sequence MTTDTLSTTFAALADPTRRAILARLAKGECSVSDLAAPFDMSLPAVSKHLRVLERAGLIVQRREAQWRPCRIEAAPLKDVADWTAYYRHIWEARLDRLDGYLKELKAQRAKEKTGKSSHKKETSHGRKKHRK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
127 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
147 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.57
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 0
Rhizoplane 2.87
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1858700 2162886011 Bacteria 2659
2 JGI24033J26618_1050387 3300002155 Unclassified 597
3 rootH2_10004468 3300003320 Bacteria 15926
4 Ga0065704_10097370 3300005289 Unclassified 2398
5 Ga0065712_10000410 3300005290 Bacteria 12722
6 Ga0065715_10109348 3300005293 Bacteria 2672
7 Ga0065715_10192495 3300005293 Bacteria 1399
8 Ga0065707_10084258 3300005295 Bacteria 7442
9 Ga0065707_10269500 3300005295 Bacteria 1075
10 Ga0070683_100000260 3300005329 Bacteria 36410
11 Ga0070670_100017730 3300005331 Bacteria 6108
12 Ga0070670_100037969 3300005331 Bacteria 4142
13 Ga0070670_100189080 3300005331 Bacteria 1788
14 Ga0070670_100523786 3300005331 Unclassified 1056
15 Ga0070677_10042793 3300005333 Bacteria 1796
16 Ga0068869_100345076 3300005334 Bacteria 1212
17 Ga0070666_10111769 3300005335 Bacteria 1890
18 Ga0070666_10164787 3300005335 Bacteria 1550
19 Ga0070680_100314570 3300005336 Bacteria 1329
20 Ga0070680_100689466 3300005336 Bacteria 879
21 Ga0070682_100260166 3300005337 Bacteria 1255
22 Ga0070682_101827902 3300005337 Bacteria 531
23 Ga0070682_101837585 3300005337 Bacteria 529
24 Ga0068868_101234853 3300005338 Bacteria 692
25 Ga0070689_100347651 3300005340 Unclassified 1243
26 Ga0070689_100744351 3300005340 Bacteria 859
27 Ga0070689_100916707 3300005340 Bacteria 776
28 Ga0070687_100188432 3300005343 Bacteria 1241
29 Ga0070661_100012307 3300005344 Bacteria 5983
30 Ga0070661_100518011 3300005344 Bacteria 956
31 Ga0070661_101054530 3300005344 Unclassified 676
32 Ga0070668_100222545 3300005347 Bacteria 1557
33 Ga0070668_100296010 3300005347 Bacteria 1356
34 Ga0070668_100814619 3300005347 Bacteria 830
35 Ga0070669_100003119 3300005353 Bacteria 11929
36 Ga0070669_100020029 3300005353 Bacteria 4777
37 Ga0070669_100021247 3300005353 Bacteria 4638
38 Ga0070675_100025600 3300005354 Bacteria 4730
39 Ga0070675_100047610 3300005354 Bacteria 3513
40 Ga0070675_100416369 3300005354 Bacteria 1201
41 Ga0070675_100653697 3300005354 Bacteria 956
42 Ga0070675_102113871 3300005354 Bacteria 519
43 Ga0070671_100016315 3300005355 Bacteria 6007
44 Ga0070674_100487892 3300005356 Bacteria 1024
45 Ga0070674_100544918 3300005356 Bacteria 972
46 Ga0070674_100661536 3300005356 Bacteria 889
47 Ga0070674_101310467 3300005356 Bacteria 646
48 Ga0070674_101619798 3300005356 Bacteria 584
49 Ga0070673_100077470 3300005364 Bacteria 2687
50 Ga0070673_100101388 3300005364 Bacteria 2371
51 Ga0070688_100283332 3300005365 Bacteria 1191
52 Ga0070667_100181246 3300005367 Bacteria 1862
53 Ga0070667_100281890 3300005367 Bacteria 1492
54 Ga0070713_100086947 3300005436 Bacteria 2681
55 Ga0070701_10382671 3300005438 Bacteria 887
56 Ga0070711_100328089 3300005439 Bacteria 1224
57 Ga0070705_101343940 3300005440 Bacteria 594
58 Ga0070700_100282298 3300005441 Unclassified 1204
59 Ga0070700_101180911 3300005441 Bacteria 638
60 Ga0070700_101585402 3300005441 Bacteria 559
61 Ga0070694_100045261 3300005444 Bacteria 2949
62 Ga0070694_100188254 3300005444 Bacteria 1531
63 Ga0070694_100481989 3300005444 Unclassified 984
64 Ga0070663_100021408 3300005455 Bacteria 4301
65 Ga0070678_100201543 3300005456 Bacteria 1643
66 Ga0070662_100036786 3300005457 Bacteria 3466
67 Ga0070662_100693597 3300005457 Bacteria 861
68 Ga0070662_100719683 3300005457 Bacteria 845
69 Ga0070662_101390442 3300005457 Bacteria 605
70 Ga0068867_100016748 3300005459 Bacteria 5207
71 Ga0068867_100155862 3300005459 Bacteria 1798
72 Ga0068867_100778806 3300005459 Bacteria 851
73 Ga0070685_10149821 3300005466 Bacteria 1477
74 Ga0070685_10382074 3300005466 Bacteria 971
75 Ga0070685_11535091 3300005466 Bacteria 514
76 Ga0070707_100607984 3300005468 Bacteria 1056
77 Ga0070684_100013761 3300005535 Bacteria 6531
78 Ga0070672_100027942 3300005543 Bacteria 4214
79 Ga0070672_100064954 3300005543 Bacteria 2885
80 Ga0070672_100140253 3300005543 Bacteria 1993
81 Ga0070686_100350159 3300005544 Bacteria 1109
82 Ga0070704_100444527 3300005549 Unclassified 1115
83 Ga0070704_100487211 3300005549 Bacteria 1068
84 Ga0070664_100003232 3300005564 Bacteria 13170
85 Ga0068857_100095821 3300005577 Unclassified 2659
86 Ga0068857_100553456 3300005577 Bacteria 1084
87 Ga0068857_100621521 3300005577 Bacteria 1022
88 Ga0068856_100031351 3300005614 Bacteria 5200
89 Ga0068852_100028972 3300005616 Bacteria 4541
90 Ga0068859_100521747 3300005617 Bacteria 1283
91 Ga0068859_100521934 3300005617 Bacteria 1283
92 Ga0068864_100036421 3300005618 Bacteria 4194
93 Ga0068864_100372382 3300005618 Bacteria 1352
94 Ga0068864_101679216 3300005618 Bacteria 640
95 Ga0068866_10215243 3300005718 Bacteria 1156
96 Ga0068861_100002243 3300005719 Bacteria 12547
97 Ga0068861_100581926 3300005719 Bacteria 1025
98 Ga0068870_10060175 3300005840 Unclassified 2038
99 Ga0068870_10123262 3300005840 Bacteria 1496
100 Ga0068870_10398219 3300005840 Bacteria 895
101 Ga0068870_10478333 3300005840 Bacteria 826
102 Ga0068863_100005166 3300005841 Bacteria 12873
103 Ga0068858_100128984 3300005842 Bacteria 2370
104 Ga0068860_102413008 3300005843 Bacteria 546
105 Ga0068862_100006400 3300005844 Bacteria 9792
106 Ga0068862_100518180 3300005844 Bacteria 1134
107 Ga0068862_102390416 3300005844 Unclassified 540
108 Ga0081455_10206634 3300005937 Bacteria 1466
109 Ga0075367_10163975 3300006178 Bacteria 1382
110 Ga0075366_10021779 3300006195 Bacteria 3727
111 Ga0075366_10065827 3300006195 Bacteria 2156
112 Ga0075428_100006094 3300006844 Bacteria 13410
113 Ga0075428_100012769 3300006844 Bacteria 9339
114 Ga0075428_100122679 3300006844 Bacteria 2828
115 Ga0075428_100225319 3300006844 Bacteria 2024
116 Ga0075428_100268059 3300006844 Bacteria 1838
117 Ga0075428_100449223 3300006844 Bacteria 1381
118 Ga0075428_100686641 3300006844 Unclassified 1091
119 Ga0075428_101445804 3300006844 Bacteria 721
120 Ga0075428_102034479 3300006844 Bacteria 595
121 Ga0075430_100223600 3300006846 Bacteria 1562
122 Ga0075430_101318195 3300006846 Bacteria 594
123 Ga0075431_100000950 3300006847 Bacteria 25611
124 Ga0075431_100101980 3300006847 Bacteria 2961
125 Ga0075431_100318473 3300006847 Bacteria 1569
126 Ga0075431_100495160 3300006847 Bacteria 1214
127 Ga0075431_102046331 3300006847 Bacteria 528
128 Ga0075434_100622689 3300006871 Bacteria 1098
129 Ga0075434_100988350 3300006871 Bacteria 856
130 Ga0075429_100757576 3300006880 Bacteria 850
131 Ga0075429_101153759 3300006880 Bacteria 676
132 Ga0068865_100770121 3300006881 Bacteria 828
133 Ga0068865_100984718 3300006881 Bacteria 738
134 Ga0068865_102078358 3300006881 Bacteria 516
135 Ga0097620_100521797 3300006931 Bacteria 1283
136 Ga0097620_100521883 3300006931 Bacteria 1283
137 Ga0111539_10000177 3300009094 Bacteria 74071
138 Ga0111539_10019090 3300009094 Bacteria 8472
139 Ga0111539_10027923 3300009094 Bacteria 6891
140 Ga0111539_10047778 3300009094 Bacteria 5114
141 Ga0111539_10144767 3300009094 Bacteria 2782
142 Ga0111539_11801467 3300009094 Bacteria 710
143 Ga0111539_12476444 3300009094 Bacteria 602
144 Ga0105247_10447469 3300009101 Bacteria 931
145 Ga0105247_10532376 3300009101 Bacteria 861
146 Ga0114129_10045564 3300009147 Bacteria 6165
147 Ga0114129_10123516 3300009147 Bacteria 3560
148 Ga0114129_10170714 3300009147 Bacteria 2965
149 Ga0114129_11382638 3300009147 Bacteria 869
150 Ga0114129_11561450 3300009147 Bacteria 809
151 Ga0105243_10390380 3300009148 Bacteria 1290
152 Ga0105248_10040872 3300009177 Bacteria 5199
153 Ga0105248_10637754 3300009177 Bacteria 1202
154 Ga0105249_10000959 3300009553 Bacteria 25526
155 Ga0105249_11700171 3300009553 Bacteria 703
156 Ga0105249_12797915 3300009553 Bacteria 559
157 Ga0105239_11780985 3300010375 Bacteria 713
158 Ga0157342_1014887 3300012507 Bacteria 847
159 Ga0163162_12418659 3300013306 Bacteria 604
160 Ga0157375_10359430 3300013308 Bacteria 1622
161 Ga0163163_10002751 3300014325 Bacteria 14839
162 Ga0157380_10210138 3300014326 Bacteria 1733
163 Ga0157380_10398293 3300014326 Bacteria 1305
164 Ga0157380_10804020 3300014326 Bacteria 958
165 Ga0157380_11088817 3300014326 Unclassified 837
166 Ga0157380_11784103 3300014326 Bacteria 674
167 Ga0157380_12398018 3300014326 Bacteria 593
168 Ga0157377_10176694 3300014745 Bacteria 1339
169 Ga0157377_10798670 3300014745 Bacteria 695
170 Ga0157377_10908138 3300014745 Unclassified 659
171 Ga0157379_10188375 3300014968 Bacteria 1865
172 Ga0163161_10087267 3300017792 Bacteria 2304
173 Ga0207697_10015048 3300025315 Bacteria 3201
174 Ga0207692_10532648 3300025898 Bacteria 749
175 Ga0207642_10070148 3300025899 Bacteria 1664
176 Ga0207710_10173673 3300025900 Bacteria 1054
177 Ga0207710_10407709 3300025900 Bacteria 698
178 Ga0207688_10026366 3300025901 Bacteria 3196
179 Ga0207688_10829164 3300025901 Bacteria 586
180 Ga0207680_10340084 3300025903 Bacteria 1053
181 Ga0207643_10023323 3300025908 Bacteria 3411
182 Ga0207643_10190798 3300025908 Unclassified 1244
183 Ga0207663_10214375 3300025916 Bacteria 1397
184 Ga0207662_10543542 3300025918 Unclassified 804
185 Ga0207662_10992818 3300025918 Bacteria 596
186 Ga0207649_10064480 3300025920 Bacteria 2316
187 Ga0207649_10929230 3300025920 Unclassified 683
188 Ga0207649_11224866 3300025920 Bacteria 593
189 Ga0207646_10202126 3300025922 Bacteria 1795
190 Ga0207681_10001421 3300025923 Bacteria 15448
191 Ga0207681_10024182 3300025923 Bacteria 3896
192 Ga0207681_10636427 3300025923 Unclassified 883
193 Ga0207694_11183826 3300025924 Bacteria 647
194 Ga0207650_10497477 3300025925 Unclassified 1018
195 Ga0207650_11076075 3300025925 Bacteria 684
196 Ga0207659_10029016 3300025926 Bacteria 3765
197 Ga0207659_10113684 3300025926 Unclassified 2062
198 Ga0207700_10306753 3300025928 Bacteria 1372
199 Ga0207690_10413756 3300025932 Bacteria 1077
200 Ga0207706_10082546 3300025933 Bacteria 2825
201 Ga0207706_10154886 3300025933 Bacteria 2016
202 Ga0207706_10219783 3300025933 Bacteria 1664
203 Ga0207706_10794637 3300025933 Bacteria 804
204 Ga0207670_10641384 3300025936 Unclassified 875
205 Ga0207669_10645563 3300025937 Bacteria 865
206 Ga0207669_10697539 3300025937 Bacteria 834
207 Ga0207704_10493542 3300025938 Bacteria 985
208 Ga0207704_10703694 3300025938 Bacteria 837
209 Ga0207704_11461448 3300025938 Unclassified 586
210 Ga0207704_11866758 3300025938 Bacteria 517
211 Ga0207691_10070204 3300025940 Bacteria 3163
212 Ga0207691_10158986 3300025940 Bacteria 1983
213 Ga0207691_10215852 3300025940 Unclassified 1665
214 Ga0207711_10023592 3300025941 Bacteria 5150
215 Ga0207711_10720958 3300025941 Bacteria 930
216 Ga0207689_10132206 3300025942 Bacteria 2054
217 Ga0207679_10047233 3300025945 Bacteria 3126
218 Ga0207679_10371510 3300025945 Bacteria 1252
219 Ga0207679_10793553 3300025945 Bacteria 863
220 Ga0207651_12050548 3300025960 Bacteria 514
221 Ga0207712_10567809 3300025961 Unclassified 978
222 Ga0207712_11144901 3300025961 Bacteria 693
223 Ga0207668_10120644 3300025972 Bacteria 1985
224 Ga0207668_10198252 3300025972 Bacteria 1597
225 Ga0207668_10794912 3300025972 Bacteria 837
226 Ga0207668_11898298 3300025972 Bacteria 537
227 Ga0207658_10049336 3300025986 Bacteria 3093
228 Ga0207658_10436793 3300025986 Bacteria 1157
229 Ga0207677_11438602 3300026023 Bacteria 636
230 Ga0207703_10109900 3300026035 Bacteria 2351
231 Ga0207703_10795658 3300026035 Bacteria 902
232 Ga0207678_10162895 3300026067 Bacteria 1905
233 Ga0207708_10145068 3300026075 Unclassified 1865
234 Ga0207708_10602948 3300026075 Bacteria 930
235 Ga0207708_10631753 3300026075 Bacteria 910
236 Ga0207702_10010433 3300026078 Bacteria 7771
237 Ga0207641_10001309 3300026088 Bacteria 24607
238 Ga0207648_10017586 3300026089 Bacteria 6495
239 Ga0207648_10087926 3300026089 Bacteria 2712
240 Ga0207648_10739221 3300026089 Bacteria 913
241 Ga0207648_11276823 3300026089 Bacteria 690
242 Ga0207676_10433114 3300026095 Bacteria 1236
243 Ga0207676_10562976 3300026095 Bacteria 1090
244 Ga0207676_11016676 3300026095 Unclassified 817
245 Ga0207674_10177552 3300026116 Unclassified 2082
246 Ga0207674_10313654 3300026116 Bacteria 1517
247 Ga0207675_100027769 3300026118 Bacteria 5272
248 Ga0207675_100278531 3300026118 Bacteria 1625
249 Ga0207675_102318540 3300026118 Unclassified 550
250 Ga0207683_10045106 3300026121 Bacteria 3854
251 Ga0207683_10282824 3300026121 Bacteria 1516
252 Ga0207698_10036322 3300026142 Bacteria 3616
253 Ga0209971_1020282 3300027682 Bacteria 1580
254 Ga0209813_10070473 3300027866 Bacteria 1135
255 Ga0207428_10008893 3300027907 Bacteria 9046
256 Ga0207428_10020140 3300027907 Bacteria 5674
257 Ga0207428_10040118 3300027907 Bacteria 3800
258 Ga0207428_10064221 3300027907 Unclassified 2899
259 Ga0207428_10509962 3300027907 Bacteria 873
260 Ga0207428_10814238 3300027907 Bacteria 663
261 Ga0265354_1000656 3300028016 Bacteria 5757
262 Ga0265357_1024298 3300028023 Bacteria 675
263 Ga0268265_10033630 3300028380 Bacteria 3729
264 Ga0268265_10127901 3300028380 Bacteria 2106
265 Ga0268265_10490899 3300028380 Unclassified 1155
266 Ga0268265_11169032 3300028380 Bacteria 766
267 Ga0268265_11792782 3300028380 Unclassified 620
268 Ga0268264_11286263 3300028381 Bacteria 741
269 Ga0265334_10005350 3300028573 Bacteria 5607
270 Ga0265770_1001241 3300030878 Unclassified 3536
271 Ga0265760_10013895 3300031090 Bacteria 2304
272 Ga0265339_10029968 3300031249 Bacteria 3084
273 Ga0307408_100397289 3300031548 Bacteria 1183
274 Ga0307408_100797560 3300031548 Bacteria 857
275 Ga0307413_10089581 3300031824 Bacteria 1999
276 Ga0307410_10008285 3300031852 Bacteria 5757
277 Ga0307409_100006091 3300031995 Bacteria 7048
278 Ga0307416_100766075 3300032002 Bacteria 1059
279 Ga0307416_102666442 3300032002 Bacteria 597
280 Ga0307414_10036086 3300032004 Bacteria 3297
281 Ga0307411_12322783 3300032005 Bacteria 504
282 Ga0316212_1001959 3300033547 Bacteria 2896
283 Ga0373941_0515807 3300035115 Bacteria 510
284 Ga0373961_0086898 3300035241 Bacteria 993
285 Ga0373931_0139255 3300035691 Bacteria 1404
286 Ga0395901_0684375 3300038443 Bacteria 1025
287 Ga0451798_0641920 3300041458 Unclassified 588
288 Ga0450923_033073 3300042125 Bacteria 1062
289 Ga0439460_0183554 3300042461 Bacteria 708
290 Ga0466957_1341800 3300044842 Bacteria 520
291 Ga0495656_0619209 3300046615 Unclassified 580
292 Ga0495669_0000817 3300046684 Bacteria 13248
293 Ga0496100_0191803 3300048903 Bacteria 1484
294 Ga0496104_0002024 3300048907 Bacteria 17607
295 Ga0496105_0025743 3300048908 Bacteria 4793
296 Ga0496108_0131035 3300048911 Bacteria 2155
297 Ga0496109_0019085 3300048912 Bacteria 6038
298 Ga0496110_0013759 3300048913 Bacteria 6703
299 Ga0496111_0006579 3300048914 Bacteria 7559
300 Ga0496112_0000729 3300048915 Bacteria 22860
301 Ga0496113_1297126 3300048916 Bacteria 566
302 Ga0501040_0080607 3300049576 Bacteria 2255
303 Ga0501041_1004566 3300049577 Bacteria 537
304 Ga0501042_1357484 3300049578 Bacteria 518
305 Ga0501046_0101658 3300049580 Bacteria 2205
306 Ga0501071_0026606 3300049587 Bacteria 4062
307 Ga0501072_0876114 3300049588 Bacteria 702
308 Ga0501073_0047692 3300049589 Unclassified 3010
309 Ga0501075_0025566 3300049591 Bacteria 4338
310 Ga0501076_0055237 3300049592 Bacteria 3149
311 Ga0501080_0337513 3300049742 Bacteria 1362
312 Ga0501083_0510504 3300049744 Bacteria 782
313 Ga0501083_0835666 3300049744 Bacteria 599
314 Ga0501035_0925648 3300049822 Bacteria 689
315 Ga0501045_0101518 3300049824 Bacteria 2130
316 nmdc:mga03n38_537187_c1 3300050490 Bacteria 660
317 nmdc:mga00v17_13765_c1 3300050491 Bacteria 4497
318 nmdc:mga0k408_115329_c1 3300050493 Bacteria 1589
319 nmdc:mga0k408_159694_c1 3300050493 Bacteria 1343
320 nmdc:mga06z11_2452_c1 3300050494 Bacteria 7079
321 nmdc:mga04h51_188303_c1 3300050495 Bacteria 806
322 nmdc:mga05p37_121979_c1 3300050507 Bacteria 3201
323 nmdc:mga05p37_417251_c1 3300050507 Bacteria 1563
324 nmdc:mga05p37_649486_c1 3300050507 Bacteria 1182
325 nmdc:mga05p37_925666_c1 3300050507 Bacteria 936
326 nmdc:mga09592_533434_c1 3300050508 Bacteria 1009
327 nmdc:mga0qj67_1015295_c1 3300050509 Bacteria 650
328 nmdc:mga0qj67_532461_c1 3300050509 Bacteria 943
329 nmdc:mga06r32_128695_c1 3300050510 Bacteria 2502
330 nmdc:mga06r32_455950_c1 3300050510 Bacteria 1258
331 nmdc:mga06r32_60607_c1 3300050510 Unclassified 3642
332 nmdc:mga06r32_709719_c1 3300050510 Bacteria 971
333 nmdc:mga08y16_101405_c1 3300050511 Bacteria 2997
334 nmdc:mga08y16_10640_c1 3300050511 Bacteria 9654
335 nmdc:mga08y16_239903_c1 3300050511 Bacteria 1874
336 nmdc:mga08y16_28137_c1 3300050511 Bacteria 5926
337 nmdc:mga08y16_292489_c1 3300050511 Bacteria 1679
338 nmdc:mga08y16_30128_c1 3300050511 Bacteria 5712
339 nmdc:mga08y16_303937_c1 3300050511 Bacteria 1644
340 nmdc:mga08y16_403747_c1 3300050511 Bacteria 1398
341 nmdc:mga0n895_1868720_c1 3300050512 Bacteria 560
342 nmdc:mga0n895_498186_c1 3300050512 Bacteria 1227
343 nmdc:mga0n895_739804_c1 3300050512 Bacteria 977
344 nmdc:mga0n895_963440_c1 3300050512 Bacteria 836
345 nmdc:mga0rr50_1451944_c1 3300050513 Bacteria 580
346 nmdc:mga0rr50_848905_c1 3300050513 Bacteria 779
347 Ga0500646_0099483 3300053090 Bacteria 911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10992818 Ga0207662_109928182 103
2 3300003320 rootH2_10004468 rootH2_100044687 108
3 3300038443 Ga0395901_0684375 Ga0395901_0684375_28_354 108
4 3300005356 Ga0070674_101619798 Ga0070674_1016197982 109
5 3300005290 Ga0065712_10000410 Ga0065712_100004107 111
6 3300005293 Ga0065715_10109348 Ga0065715_101093483 111
7 3300005329 Ga0070683_100000260 Ga0070683_10000026021 111
8 3300005331 Ga0070670_100037969 Ga0070670_1000379691 111
9 3300005335 Ga0070666_10164787 Ga0070666_101647872 111
10 3300005344 Ga0070661_100012307 Ga0070661_1000123074 111
11 3300005347 Ga0070668_100814619 Ga0070668_1008146192 111
12 3300005355 Ga0070671_100016315 Ga0070671_1000163153 111
13 3300005367 Ga0070667_100281890 Ga0070667_1002818902 111
14 3300005436 Ga0070713_100086947 Ga0070713_1000869473 111
15 3300005439 Ga0070711_100328089 Ga0070711_1003280892 111
16 3300005455 Ga0070663_100021408 Ga0070663_1000214084 111
17 3300005457 Ga0070662_100036786 Ga0070662_1000367862 111
18 3300005466 Ga0070685_10149821 Ga0070685_101498213 111
19 3300005535 Ga0070684_100013761 Ga0070684_1000137615 111
20 3300005543 Ga0070672_100140253 Ga0070672_1001402532 111
21 3300005564 Ga0070664_100003232 Ga0070664_1000032322 111
22 3300005618 Ga0068864_100036421 Ga0068864_1000364212 111
23 3300005842 Ga0068858_100128984 Ga0068858_1001289842 111
24 3300006844 Ga0075428_100449223 Ga0075428_1004492231 111
25 3300006847 Ga0075431_100495160 Ga0075431_1004951602 111
26 3300006880 Ga0075429_100757576 Ga0075429_1007575762 111
27 3300009101 Ga0105247_10447469 Ga0105247_104474691 111
28 3300009147 Ga0114129_11561450 Ga0114129_115614502 111
29 3300009177 Ga0105248_10040872 Ga0105248_100408725 111
30 3300010375 Ga0105239_11780985 Ga0105239_117809852 111
31 3300012507 Ga0157342_1014887 Ga0157342_10148872 111
32 3300013308 Ga0157375_10359430 Ga0157375_103594302 111
33 3300014325 Ga0163163_10002751 Ga0163163_1000275114 111
34 3300014968 Ga0157379_10188375 Ga0157379_101883752 111
35 3300025916 Ga0207663_10214375 Ga0207663_102143752 111
36 3300025928 Ga0207700_10306753 Ga0207700_103067531 111
37 3300044842 Ga0466957_1341800 Ga0466957_1341800_32_373 111
38 3300050509 nmdc:mga0qj67_532461_c1 nmdc:mga0qj67_532461_c1_83_442 111
39 3300050510 nmdc:mga06r32_455950_c1 nmdc:mga06r32_455950_c1_58_417 111
40 3300046615 Ga0495656_0619209 Ga0495656_0619209_111_509 112
41 3300032002 Ga0307416_100766075 Ga0307416_1007660752 113
42 3300049744 Ga0501083_0835666 Ga0501083_0835666_62_415 115
43 iso_pu_bacteria 2883291878 2883293312 115
44 3300005466 Ga0070685_11535091 Ga0070685_115350911 117
45 3300005577 Ga0068857_100553456 Ga0068857_1005534562 117
46 3300025938 Ga0207704_11461448 Ga0207704_114614482 117
47 3300026116 Ga0207674_10313654 Ga0207674_103136543 117
48 3300026121 Ga0207683_10282824 Ga0207683_102828243 117
49 3300028016 Ga0265354_1000656 Ga0265354_10006563 117
50 3300028023 Ga0265357_1024298 Ga0265357_10242981 117
51 3300030878 Ga0265770_1001241 Ga0265770_10012412 117
52 3300031090 Ga0265760_10013895 Ga0265760_100138952 117
53 3300033547 Ga0316212_1001959 Ga0316212_10019594 117
54 3300049589 Ga0501073_0047692 Ga0501073_0047692_2575_2940 117
55 3300049744 Ga0501083_0510504 Ga0501083_0510504_41_415 117
56 3300005336 Ga0070680_100314570 Ga0070680_1003145701 118
57 3300005336 Ga0070680_100689466 Ga0070680_1006894662 118
58 3300005337 Ga0070682_101827902 Ga0070682_1018279021 118
59 3300005340 Ga0070689_100744351 Ga0070689_1007443512 118
60 3300005354 Ga0070675_102113871 Ga0070675_1021138711 118
61 3300005356 Ga0070674_100487892 Ga0070674_1004878922 118
62 3300005438 Ga0070701_10382671 Ga0070701_103826712 118
63 3300005444 Ga0070694_100045261 Ga0070694_1000452613 118
64 3300005444 Ga0070694_100188254 Ga0070694_1001882541 118
65 3300005614 Ga0068856_100031351 Ga0068856_1000313512 118
66 3300005616 Ga0068852_100028972 Ga0068852_1000289724 118
67 3300005840 Ga0068870_10478333 Ga0068870_104783332 118
68 3300006846 Ga0075430_101318195 Ga0075430_1013181951 118
69 3300006847 Ga0075431_100318473 Ga0075431_1003184732 118
70 3300009094 Ga0111539_10019090 Ga0111539_100190902 118
71 3300009094 Ga0111539_11801467 Ga0111539_118014671 118
72 3300014326 Ga0157380_11784103 Ga0157380_117841032 118
73 3300014326 Ga0157380_12398018 Ga0157380_123980181 118
74 3300025898 Ga0207692_10532648 Ga0207692_105326481 118
75 3300025972 Ga0207668_11898298 Ga0207668_118982981 118
76 3300026078 Ga0207702_10010433 Ga0207702_100104334 118
77 3300026142 Ga0207698_10036322 Ga0207698_100363224 118
78 3300027907 Ga0207428_10008893 Ga0207428_100088938 118
79 3300031548 Ga0307408_100797560 Ga0307408_1007975602 118
80 3300031824 Ga0307413_10089581 Ga0307413_100895813 118
81 3300031852 Ga0307410_10008285 Ga0307410_100082855 118
82 3300031995 Ga0307409_100006091 Ga0307409_1000060918 118
83 3300032002 Ga0307416_102666442 Ga0307416_1026664422 118
84 3300032004 Ga0307414_10036086 Ga0307414_100360864 118
85 3300032005 Ga0307411_12322783 Ga0307411_123227832 118
86 3300035115 Ga0373941_0515807 Ga0373941_0515807_64_420 118
87 3300042125 Ga0450923_033073 Ga0450923_033073_532_888 118
88 3300042461 Ga0439460_0183554 Ga0439460_0183554_303_659 118
89 3300048903 Ga0496100_0191803 Ga0496100_0191803_75_431 118
90 3300048907 Ga0496104_0002024 Ga0496104_0002024_16865_17221 118
91 3300048908 Ga0496105_0025743 Ga0496105_0025743_4111_4467 118
92 3300048911 Ga0496108_0131035 Ga0496108_0131035_1045_1401 118
93 3300048912 Ga0496109_0019085 Ga0496109_0019085_4510_4866 118
94 3300048913 Ga0496110_0013759 Ga0496110_0013759_1388_1744 118
95 3300048914 Ga0496111_0006579 Ga0496111_0006579_1891_2247 118
96 3300048915 Ga0496112_0000729 Ga0496112_0000729_3697_4053 118
97 3300048916 Ga0496113_1297126 Ga0496113_1297126_66_422 118
98 3300050509 nmdc:mga0qj67_1015295_c1 nmdc:mga0qj67_1015295_c1_213_569 118
99 3300050510 nmdc:mga06r32_709719_c1 nmdc:mga06r32_709719_c1_451_819 118
100 3300050511 nmdc:mga08y16_101405_c1 nmdc:mga08y16_101405_c1_2137_2505 118
101 3300050511 nmdc:mga08y16_239903_c1 nmdc:mga08y16_239903_c1_27_395 118
102 3300050511 nmdc:mga08y16_403747_c1 nmdc:mga08y16_403747_c1_493_849 118
103 3300053090 Ga0500646_0099483 Ga0500646_0099483_286_642 118
104 2162886011 MRS1b_contig_1858700 MRS1b_0557.00001850 119
105 3300002155 JGI24033J26618_1050387 JGI24033J26618_10503871 119
106 3300005289 Ga0065704_10097370 Ga0065704_100973704 119
107 3300005293 Ga0065715_10192495 Ga0065715_101924952 119
108 3300005295 Ga0065707_10084258 Ga0065707_100842588 119
109 3300005295 Ga0065707_10269500 Ga0065707_102695002 119
110 3300005331 Ga0070670_100017730 Ga0070670_1000177305 119
111 3300005331 Ga0070670_100189080 Ga0070670_1001890802 119
112 3300005331 Ga0070670_100523786 Ga0070670_1005237862 119
113 3300005333 Ga0070677_10042793 Ga0070677_100427933 119
114 3300005334 Ga0068869_100345076 Ga0068869_1003450761 119
115 3300005335 Ga0070666_10111769 Ga0070666_101117692 119
116 3300005337 Ga0070682_100260166 Ga0070682_1002601662 119
117 3300005337 Ga0070682_101837585 Ga0070682_1018375852 119
118 3300005338 Ga0068868_101234853 Ga0068868_1012348532 119
119 3300005340 Ga0070689_100347651 Ga0070689_1003476512 119
120 3300005340 Ga0070689_100916707 Ga0070689_1009167072 119
121 3300005343 Ga0070687_100188432 Ga0070687_1001884322 119
122 3300005344 Ga0070661_100518011 Ga0070661_1005180112 119
123 3300005344 Ga0070661_101054530 Ga0070661_1010545302 119
124 3300005347 Ga0070668_100222545 Ga0070668_1002225454 119
125 3300005347 Ga0070668_100296010 Ga0070668_1002960103 119
126 3300005353 Ga0070669_100003119 Ga0070669_1000031191 119
127 3300005353 Ga0070669_100020029 Ga0070669_1000200293 119
128 3300005353 Ga0070669_100021247 Ga0070669_1000212474 119
129 3300005354 Ga0070675_100025600 Ga0070675_1000256003 119
130 3300005354 Ga0070675_100047610 Ga0070675_1000476106 119
131 3300005354 Ga0070675_100416369 Ga0070675_1004163692 119
132 3300005354 Ga0070675_100653697 Ga0070675_1006536972 119
133 3300005356 Ga0070674_100544918 Ga0070674_1005449181 119
134 3300005356 Ga0070674_100661536 Ga0070674_1006615361 119
135 3300005356 Ga0070674_101310467 Ga0070674_1013104672 119
136 3300005364 Ga0070673_100077470 Ga0070673_1000774703 119
137 3300005364 Ga0070673_100101388 Ga0070673_1001013883 119
138 3300005365 Ga0070688_100283332 Ga0070688_1002833322 119
139 3300005367 Ga0070667_100181246 Ga0070667_1001812462 119
140 3300005440 Ga0070705_101343940 Ga0070705_1013439401 119
141 3300005441 Ga0070700_100282298 Ga0070700_1002822982 119
142 3300005441 Ga0070700_101180911 Ga0070700_1011809112 119
143 3300005441 Ga0070700_101585402 Ga0070700_1015854021 119
144 3300005444 Ga0070694_100481989 Ga0070694_1004819891 119
145 3300005456 Ga0070678_100201543 Ga0070678_1002015432 119
146 3300005457 Ga0070662_100693597 Ga0070662_1006935971 119
147 3300005457 Ga0070662_100719683 Ga0070662_1007196831 119
148 3300005457 Ga0070662_101390442 Ga0070662_1013904421 119
149 3300005459 Ga0068867_100016748 Ga0068867_1000167484 119
150 3300005459 Ga0068867_100155862 Ga0068867_1001558622 119
151 3300005459 Ga0068867_100778806 Ga0068867_1007788062 119
152 3300005466 Ga0070685_10382074 Ga0070685_103820741 119
153 3300005468 Ga0070707_100607984 Ga0070707_1006079842 119
154 3300005543 Ga0070672_100027942 Ga0070672_1000279423 119
155 3300005543 Ga0070672_100064954 Ga0070672_1000649542 119
156 3300005544 Ga0070686_100350159 Ga0070686_1003501591 119
157 3300005549 Ga0070704_100444527 Ga0070704_1004445272 119
158 3300005549 Ga0070704_100487211 Ga0070704_1004872112 119
159 3300005577 Ga0068857_100095821 Ga0068857_1000958213 119
160 3300005577 Ga0068857_100621521 Ga0068857_1006215213 119
161 3300005617 Ga0068859_100521747 Ga0068859_1005217472 119
162 3300005617 Ga0068859_100521934 Ga0068859_1005219343 119
163 3300005618 Ga0068864_100372382 Ga0068864_1003723823 119
164 3300005618 Ga0068864_101679216 Ga0068864_1016792161 119
165 3300005718 Ga0068866_10215243 Ga0068866_102152432 119
166 3300005719 Ga0068861_100002243 Ga0068861_1000022436 119
167 3300005719 Ga0068861_100581926 Ga0068861_1005819262 119
168 3300005840 Ga0068870_10060175 Ga0068870_100601753 119
169 3300005840 Ga0068870_10123262 Ga0068870_101232623 119
170 3300005840 Ga0068870_10398219 Ga0068870_103982192 119
171 3300005841 Ga0068863_100005166 Ga0068863_1000051666 119
172 3300005843 Ga0068860_102413008 Ga0068860_1024130081 119
173 3300005844 Ga0068862_100006400 Ga0068862_10000640012 119
174 3300005844 Ga0068862_100518180 Ga0068862_1005181802 119
175 3300005844 Ga0068862_102390416 Ga0068862_1023904161 119
176 3300005937 Ga0081455_10206634 Ga0081455_102066341 119
177 3300006178 Ga0075367_10163975 Ga0075367_101639752 119
178 3300006195 Ga0075366_10021779 Ga0075366_100217793 119
179 3300006195 Ga0075366_10065827 Ga0075366_100658273 119
180 3300006844 Ga0075428_100006094 Ga0075428_1000060945 119
181 3300006844 Ga0075428_100012769 Ga0075428_1000127696 119
182 3300006844 Ga0075428_100122679 Ga0075428_1001226792 119
183 3300006844 Ga0075428_100225319 Ga0075428_1002253191 119
184 3300006844 Ga0075428_100268059 Ga0075428_1002680593 119
185 3300006844 Ga0075428_100686641 Ga0075428_1006866412 119
186 3300006844 Ga0075428_101445804 Ga0075428_1014458041 119
187 3300006844 Ga0075428_102034479 Ga0075428_1020344792 119
188 3300006846 Ga0075430_100223600 Ga0075430_1002236002 119
189 3300006847 Ga0075431_100000950 Ga0075431_10000095014 119
190 3300006847 Ga0075431_100101980 Ga0075431_1001019802 119
191 3300006847 Ga0075431_102046331 Ga0075431_1020463311 119
192 3300006871 Ga0075434_100622689 Ga0075434_1006226892 119
193 3300006871 Ga0075434_100988350 Ga0075434_1009883502 119
194 3300006880 Ga0075429_101153759 Ga0075429_1011537592 119
195 3300006881 Ga0068865_100770121 Ga0068865_1007701212 119
196 3300006881 Ga0068865_100984718 Ga0068865_1009847181 119
197 3300006881 Ga0068865_102078358 Ga0068865_1020783582 119
198 3300006931 Ga0097620_100521797 Ga0097620_1005217972 119
199 3300006931 Ga0097620_100521883 Ga0097620_1005218833 119
200 3300009094 Ga0111539_10000177 Ga0111539_100001777 119
201 3300009094 Ga0111539_10027923 Ga0111539_100279238 119
202 3300009094 Ga0111539_10047778 Ga0111539_100477785 119
203 3300009094 Ga0111539_10144767 Ga0111539_101447672 119
204 3300009094 Ga0111539_12476444 Ga0111539_124764441 119
205 3300009101 Ga0105247_10532376 Ga0105247_105323762 119
206 3300009147 Ga0114129_10045564 Ga0114129_100455644 119
207 3300009147 Ga0114129_10123516 Ga0114129_101235163 119
208 3300009147 Ga0114129_10170714 Ga0114129_101707142 119
209 3300009147 Ga0114129_11382638 Ga0114129_113826382 119
210 3300009148 Ga0105243_10390380 Ga0105243_103903803 119
211 3300009177 Ga0105248_10637754 Ga0105248_106377542 119
212 3300009553 Ga0105249_10000959 Ga0105249_1000095919 119
213 3300009553 Ga0105249_11700171 Ga0105249_117001712 119
214 3300009553 Ga0105249_12797915 Ga0105249_127979151 119
215 3300013306 Ga0163162_12418659 Ga0163162_124186592 119
216 3300014326 Ga0157380_10210138 Ga0157380_102101382 119
217 3300014326 Ga0157380_10398293 Ga0157380_103982932 119
218 3300014326 Ga0157380_10804020 Ga0157380_108040201 119
219 3300014326 Ga0157380_11088817 Ga0157380_110888172 119
220 3300014745 Ga0157377_10176694 Ga0157377_101766942 119
221 3300014745 Ga0157377_10798670 Ga0157377_107986702 119
222 3300014745 Ga0157377_10908138 Ga0157377_109081381 119
223 3300017792 Ga0163161_10087267 Ga0163161_100872672 119
224 3300025315 Ga0207697_10015048 Ga0207697_100150482 119
225 3300025899 Ga0207642_10070148 Ga0207642_100701483 119
226 3300025900 Ga0207710_10173673 Ga0207710_101736732 119
227 3300025900 Ga0207710_10407709 Ga0207710_104077092 119
228 3300025901 Ga0207688_10026366 Ga0207688_100263663 119
229 3300025901 Ga0207688_10829164 Ga0207688_108291642 119
230 3300025903 Ga0207680_10340084 Ga0207680_103400842 119
231 3300025908 Ga0207643_10023323 Ga0207643_100233233 119
232 3300025908 Ga0207643_10190798 Ga0207643_101907981 119
233 3300025918 Ga0207662_10543542 Ga0207662_105435422 119
234 3300025920 Ga0207649_10064480 Ga0207649_100644802 119
235 3300025920 Ga0207649_10929230 Ga0207649_109292301 119
236 3300025920 Ga0207649_11224866 Ga0207649_112248661 119
237 3300025922 Ga0207646_10202126 Ga0207646_102021262 119
238 3300025923 Ga0207681_10001421 Ga0207681_1000142111 119
239 3300025923 Ga0207681_10024182 Ga0207681_100241823 119
240 3300025923 Ga0207681_10636427 Ga0207681_106364271 119
241 3300025924 Ga0207694_11183826 Ga0207694_111838261 119
242 3300025925 Ga0207650_10497477 Ga0207650_104974772 119
243 3300025925 Ga0207650_11076075 Ga0207650_110760751 119
244 3300025926 Ga0207659_10029016 Ga0207659_100290163 119
245 3300025926 Ga0207659_10113684 Ga0207659_101136841 119
246 3300025932 Ga0207690_10413756 Ga0207690_104137561 119
247 3300025933 Ga0207706_10082546 Ga0207706_100825462 119
248 3300025933 Ga0207706_10154886 Ga0207706_101548865 119
249 3300025933 Ga0207706_10219783 Ga0207706_102197832 119
250 3300025933 Ga0207706_10794637 Ga0207706_107946372 119
251 3300025936 Ga0207670_10641384 Ga0207670_106413842 119
252 3300025937 Ga0207669_10645563 Ga0207669_106455632 119
253 3300025937 Ga0207669_10697539 Ga0207669_106975392 119
254 3300025938 Ga0207704_10493542 Ga0207704_104935421 119
255 3300025938 Ga0207704_10703694 Ga0207704_107036942 119
256 3300025938 Ga0207704_11866758 Ga0207704_118667581 119
257 3300025940 Ga0207691_10070204 Ga0207691_100702045 119
258 3300025940 Ga0207691_10158986 Ga0207691_101589862 119
259 3300025940 Ga0207691_10215852 Ga0207691_102158522 119
260 3300025941 Ga0207711_10023592 Ga0207711_100235922 119
261 3300025941 Ga0207711_10720958 Ga0207711_107209582 119
262 3300025942 Ga0207689_10132206 Ga0207689_101322062 119
263 3300025945 Ga0207679_10047233 Ga0207679_100472332 119
264 3300025945 Ga0207679_10371510 Ga0207679_103715102 119
265 3300025945 Ga0207679_10793553 Ga0207679_107935531 119
266 3300025960 Ga0207651_12050548 Ga0207651_120505481 119
267 3300025961 Ga0207712_10567809 Ga0207712_105678092 119
268 3300025961 Ga0207712_11144901 Ga0207712_111449011 119
269 3300025972 Ga0207668_10120644 Ga0207668_101206443 119
270 3300025972 Ga0207668_10198252 Ga0207668_101982522 119
271 3300025972 Ga0207668_10794912 Ga0207668_107949122 119
272 3300025986 Ga0207658_10049336 Ga0207658_100493362 119
273 3300025986 Ga0207658_10436793 Ga0207658_104367931 119
274 3300026023 Ga0207677_11438602 Ga0207677_114386022 119
275 3300026035 Ga0207703_10109900 Ga0207703_101099002 119
276 3300026035 Ga0207703_10795658 Ga0207703_107956581 119
277 3300026067 Ga0207678_10162895 Ga0207678_101628953 119
278 3300026075 Ga0207708_10145068 Ga0207708_101450682 119
279 3300026075 Ga0207708_10602948 Ga0207708_106029482 119
280 3300026075 Ga0207708_10631753 Ga0207708_106317531 119
281 3300026088 Ga0207641_10001309 Ga0207641_1000130912 119
282 3300026089 Ga0207648_10017586 Ga0207648_100175864 119
283 3300026089 Ga0207648_10087926 Ga0207648_100879263 119
284 3300026089 Ga0207648_10739221 Ga0207648_107392212 119
285 3300026089 Ga0207648_11276823 Ga0207648_112768232 119
286 3300026095 Ga0207676_10433114 Ga0207676_104331142 119
287 3300026095 Ga0207676_10562976 Ga0207676_105629761 119
288 3300026095 Ga0207676_11016676 Ga0207676_110166762 119
289 3300026116 Ga0207674_10177552 Ga0207674_101775522 119
290 3300026118 Ga0207675_100027769 Ga0207675_1000277697 119
291 3300026118 Ga0207675_100278531 Ga0207675_1002785312 119
292 3300026118 Ga0207675_102318540 Ga0207675_1023185401 119
293 3300026121 Ga0207683_10045106 Ga0207683_100451062 119
294 3300027682 Ga0209971_1020282 Ga0209971_10202821 119
295 3300027866 Ga0209813_10070473 Ga0209813_100704732 119
296 3300027907 Ga0207428_10020140 Ga0207428_100201407 119
297 3300027907 Ga0207428_10040118 Ga0207428_100401183 119
298 3300027907 Ga0207428_10064221 Ga0207428_100642213 119
299 3300027907 Ga0207428_10509962 Ga0207428_105099622 119
300 3300027907 Ga0207428_10814238 Ga0207428_108142382 119
301 3300028380 Ga0268265_10033630 Ga0268265_100336303 119
302 3300028380 Ga0268265_10127901 Ga0268265_101279013 119
303 3300028380 Ga0268265_10490899 Ga0268265_104908992 119
304 3300028380 Ga0268265_11169032 Ga0268265_111690322 119
305 3300028380 Ga0268265_11792782 Ga0268265_117927822 119
306 3300028381 Ga0268264_11286263 Ga0268264_112862632 119
307 3300028573 Ga0265334_10005350 Ga0265334_100053506 119
308 3300031249 Ga0265339_10029968 Ga0265339_100299684 119
309 3300031548 Ga0307408_100397289 Ga0307408_1003972891 119
310 3300035241 Ga0373961_0086898 Ga0373961_0086898_608_979 119
311 3300035691 Ga0373931_0139255 Ga0373931_0139255_161_532 119
312 3300041458 Ga0451798_0641920 Ga0451798_0641920_179_544 119
313 3300046684 Ga0495669_0000817 Ga0495669_0000817_979_1338 119
314 3300049576 Ga0501040_0080607 Ga0501040_0080607_376_744 119
315 3300049577 Ga0501041_1004566 Ga0501041_1004566_87_455 119
316 3300049578 Ga0501042_1357484 Ga0501042_1357484_137_505 119
317 3300049580 Ga0501046_0101658 Ga0501046_0101658_449_817 119
318 3300049587 Ga0501071_0026606 Ga0501071_0026606_512_880 119
319 3300049588 Ga0501072_0876114 Ga0501072_0876114_81_449 119
320 3300049591 Ga0501075_0025566 Ga0501075_0025566_860_1228 119
321 3300049592 Ga0501076_0055237 Ga0501076_0055237_1950_2318 119
322 3300049742 Ga0501080_0337513 Ga0501080_0337513_764_1132 119
323 3300049822 Ga0501035_0925648 Ga0501035_0925648_122_484 119
324 3300049824 Ga0501045_0101518 Ga0501045_0101518_1328_1696 119
325 3300050490 nmdc:mga03n38_537187_c1 nmdc:mga03n38_537187_c1_73_441 119
326 3300050491 nmdc:mga00v17_13765_c1 nmdc:mga00v17_13765_c1_3603_3971 119
327 3300050493 nmdc:mga0k408_115329_c1 nmdc:mga0k408_115329_c1_284_652 119
328 3300050493 nmdc:mga0k408_159694_c1 nmdc:mga0k408_159694_c1_747_1115 119
329 3300050494 nmdc:mga06z11_2452_c1 nmdc:mga06z11_2452_c1_419_787 119
330 3300050495 nmdc:mga04h51_188303_c1 nmdc:mga04h51_188303_c1_387_755 119
331 3300050507 nmdc:mga05p37_121979_c1 nmdc:mga05p37_121979_c1_634_993 119
332 3300050507 nmdc:mga05p37_417251_c1 nmdc:mga05p37_417251_c1_987_1364 119
333 3300050507 nmdc:mga05p37_649486_c1 nmdc:mga05p37_649486_c1_748_1119 119
334 3300050507 nmdc:mga05p37_925666_c1 nmdc:mga05p37_925666_c1_91_462 119
335 3300050508 nmdc:mga09592_533434_c1 nmdc:mga09592_533434_c1_55_453 119
336 3300050510 nmdc:mga06r32_128695_c1 nmdc:mga06r32_128695_c1_48_407 119
337 3300050510 nmdc:mga06r32_60607_c1 nmdc:mga06r32_60607_c1_1164_1562 119
338 3300050511 nmdc:mga08y16_10640_c1 nmdc:mga08y16_10640_c1_3425_3784 119
339 3300050511 nmdc:mga08y16_28137_c1 nmdc:mga08y16_28137_c1_2416_2787 119
340 3300050511 nmdc:mga08y16_292489_c1 nmdc:mga08y16_292489_c1_1253_1612 119
341 3300050511 nmdc:mga08y16_30128_c1 nmdc:mga08y16_30128_c1_3472_3861 119
342 3300050511 nmdc:mga08y16_303937_c1 nmdc:mga08y16_303937_c1_1189_1548 119
343 3300050512 nmdc:mga0n895_1868720_c1 nmdc:mga0n895_1868720_c1_17_376 119
344 3300050512 nmdc:mga0n895_498186_c1 nmdc:mga0n895_498186_c1_820_1191 119
345 3300050512 nmdc:mga0n895_739804_c1 nmdc:mga0n895_739804_c1_575_952 119
346 3300050512 nmdc:mga0n895_963440_c1 nmdc:mga0n895_963440_c1_182_553 119
347 3300050513 nmdc:mga0rr50_1451944_c1 nmdc:mga0rr50_1451944_c1_31_402 119
348 3300050513 nmdc:mga0rr50_848905_c1 nmdc:mga0rr50_848905_c1_380_739 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

60

0.99

PF12840

HTH_20

Helix-turn-helix domain

13

62

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

15

60

0.97

PF12802

MarR_2

MarR family

15

66

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hx7-assembly1.cif.gz_A structure of mntr e11k mutant complexed with cd2+ 0.9211 30 60
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9021 1 76
3r61-assembly1.cif.gz_B structure of the mntr co2+ complex 0.8915 30 60
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8836 17 74
2quf-assembly1.cif.gz_A crystal structure of transcription factor axxa-pf0095 from pyrococcus furiosus 0.8778 10 74
ID Description Score Start End Superfamily
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.934 15 60 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9273 17 62 1.10.10.10
af_P16684_3_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9255 30 63 1.10.10.10
4hx4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9239 30 60 1.10.10.10
4hv5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9238 30 60 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A562IJL4-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9442 4 74 GO:0003677
GO:0003700
AF-A0A220MQS7-F1-model_v4 Transcriptional regulator 0.9439 5 61 GO:0003677
GO:0003700
AF-A0A7J9Z081-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9419 4 74 GO:0003700
AF-A0A2H9L8M1-F1-model_v4 HTH arsR-type domain-containing protein 0.9414 2 74 GO:0003700
GO:0016020
AF-A0A179C760-F1-model_v4 HTH arsR-type domain-containing protein 0.94 4 74 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
81.94 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map