F417447

General Info

Members Datasets Scaffolds Average Seq Length
348 211 696 101

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100908070|Ga0070706_1009080701
Length 114
Sequence MAVSIRLRREGAKNRPYYKVVVADSRSPRDGKFIEVIGTYDPKKPGHNSSMNVERAEYWISKGAQPSDTVRSLIKKNKKVAAAAEVSSPERDRPAHELPESLTSQDPLKPTDND

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 5.46
Rhizosphere 92.82
Stem 0
Stem Tuber 0
Unclassified 32.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100908070 3300005467 Bacteria 813
2 Ga0065714_10526777 3300005288 Unclassified 510
3 Ga0065712_10111675 3300005290 Bacteria 1813
4 Ga0065712_10316232 3300005290 Unclassified 836
5 Ga0065715_10005314 3300005293 Bacteria 3214
6 Ga0065715_10089774 3300005293 Bacteria 8553
7 Ga0065715_10319091 3300005293 Bacteria 995
8 Ga0065715_10388447 3300005293 Bacteria 897
9 Ga0070658_10275452 3300005327 Bacteria 1432
10 Ga0070676_10342358 3300005328 Bacteria 1026
11 Ga0070683_100028595 3300005329 Bacteria 5039
12 Ga0070683_101307946 3300005329 Bacteria 697
13 Ga0070690_100120907 3300005330 Bacteria 1757
14 Ga0070690_101062035 3300005330 Unclassified 641
15 Ga0070670_100005129 3300005331 Bacteria 11019
16 Ga0070670_100026824 3300005331 Bacteria 4955
17 Ga0070670_100682591 3300005331 Unclassified 923
18 Ga0070670_101871659 3300005331 Unclassified 553
19 Ga0068869_100624856 3300005334 Unclassified 912
20 Ga0070666_10073587 3300005335 Bacteria 2327
21 Ga0070680_100418129 3300005336 Bacteria 1144
22 Ga0068868_100038531 3300005338 Unclassified 3711
23 Ga0070689_100082631 3300005340 Unclassified 2523
24 Ga0070689_100704805 3300005340 Unclassified 882
25 Ga0070689_101279689 3300005340 Unclassified 660
26 Ga0070661_100044890 3300005344 Bacteria 3229
27 Ga0070661_100489041 3300005344 Bacteria 984
28 Ga0070661_101733132 3300005344 Bacteria 529
29 Ga0070668_100253533 3300005347 Unclassified 1461
30 Ga0070669_100187636 3300005353 Bacteria 1620
31 Ga0070675_100048421 3300005354 Bacteria 3485
32 Ga0070675_100105881 3300005354 Bacteria 2373
33 Ga0070675_100676296 3300005354 Unclassified 939
34 Ga0070671_100043770 3300005355 Bacteria 3720
35 Ga0070671_100137789 3300005355 Bacteria 2058
36 Ga0070674_100119654 3300005356 Bacteria 1948
37 Ga0070673_100282440 3300005364 Bacteria 1456
38 Ga0070688_100448077 3300005365 Bacteria 964
39 Ga0070688_100653864 3300005365 Bacteria 810
40 Ga0070659_100515314 3300005366 Unclassified 1021
41 Ga0070667_100105354 3300005367 Bacteria 2440
42 Ga0070667_100106842 3300005367 Bacteria 2423
43 Ga0070667_100246796 3300005367 Bacteria 1595
44 Ga0070667_100474851 3300005367 Bacteria 1144
45 Ga0070667_101526354 3300005367 Bacteria 627
46 Ga0070709_10135616 3300005434 Bacteria 1685
47 Ga0070713_100057130 3300005436 Bacteria 3247
48 Ga0070713_101049773 3300005436 Unclassified 787
49 Ga0070710_10253742 3300005437 Bacteria 1131
50 Ga0070710_10426043 3300005437 Unclassified 894
51 Ga0070710_11349624 3300005437 Unclassified 531
52 Ga0070711_100253011 3300005439 Bacteria 1383
53 Ga0070711_100265013 3300005439 Bacteria 1353
54 Ga0070705_100170697 3300005440 Bacteria 1464
55 Ga0070705_100566045 3300005440 Bacteria 874
56 Ga0070708_100112225 3300005445 Bacteria 2507
57 Ga0070708_100122396 3300005445 Unclassified 2401
58 Ga0070708_100350391 3300005445 Unclassified 1391
59 Ga0070663_100045053 3300005455 Bacteria 3114
60 Ga0070663_100630932 3300005455 Bacteria 904
61 Ga0070678_100219135 3300005456 Unclassified 1581
62 Ga0070678_100794849 3300005456 Unclassified 859
63 Ga0070678_101632498 3300005456 Unclassified 606
64 Ga0070662_100101463 3300005457 Bacteria 2178
65 Ga0070662_100189297 3300005457 Bacteria 1626
66 Ga0070662_100992236 3300005457 Unclassified 719
67 Ga0070662_101725707 3300005457 Bacteria 541
68 Ga0070681_10021678 3300005458 Bacteria 6442
69 Ga0068867_100030916 3300005459 Bacteria 3864
70 Ga0068867_102083493 3300005459 Unclassified 537
71 Ga0070706_100245216 3300005467 Bacteria 1673
72 Ga0070707_100052397 3300005468 Bacteria 3913
73 Ga0070707_100079380 3300005468 Bacteria 3167
74 Ga0070698_100113276 3300005471 Unclassified 2677
75 Ga0070699_100085600 3300005518 Bacteria 2750
76 Ga0070699_100100740 3300005518 Unclassified 2532
77 Ga0070679_100977412 3300005530 Bacteria 790
78 Ga0070684_100007084 3300005535 Bacteria 8714
79 Ga0070684_100074348 3300005535 Bacteria 2995
80 Ga0070684_102214087 3300005535 Bacteria 518
81 Ga0070697_100104384 3300005536 Bacteria 2356
82 Ga0070697_100123199 3300005536 Bacteria 2170
83 Ga0070672_100128691 3300005543 Bacteria 2079
84 Ga0070672_100238100 3300005543 Bacteria 1530
85 Ga0070686_100066912 3300005544 Bacteria 2339
86 Ga0070665_100004925 3300005548 Bacteria 13852
87 Ga0070665_100052362 3300005548 Bacteria 4094
88 Ga0070665_101299143 3300005548 Unclassified 737
89 Ga0070665_101872400 3300005548 Unclassified 606
90 Ga0070704_100658678 3300005549 Bacteria 925
91 Ga0070664_100018951 3300005564 Bacteria 5658
92 Ga0068857_100749645 3300005577 Bacteria 930
93 Ga0068857_101550107 3300005577 Unclassified 646
94 Ga0068854_101107777 3300005578 Unclassified 706
95 Ga0068856_100083204 3300005614 Bacteria 3177
96 Ga0068856_102608599 3300005614 Unclassified 511
97 Ga0068852_101482348 3300005616 Unclassified 701
98 Ga0068864_100870654 3300005618 Unclassified 888
99 Ga0068866_10079400 3300005718 Bacteria 1758
100 Ga0068863_100883337 3300005841 Unclassified 894
101 Ga0068863_101402135 3300005841 Bacteria 706
102 Ga0068863_101663821 3300005841 Bacteria 648
103 Ga0068858_100461273 3300005842 Bacteria 1225
104 Ga0068858_102258124 3300005842 Unclassified 538
105 Ga0068858_102260670 3300005842 Unclassified 538
106 Ga0068860_100507450 3300005843 Unclassified 1205
107 Ga0081539_10073623 3300005985 Bacteria 1821
108 Ga0070717_10504557 3300006028 Bacteria 1093
109 Ga0070717_10779649 3300006028 Unclassified 869
110 Ga0070717_11090900 3300006028 Unclassified 727
111 Ga0070717_11165317 3300006028 Bacteria 701
112 Ga0070715_10051543 3300006163 Bacteria 1771
113 Ga0070716_100107776 3300006173 Bacteria 1720
114 Ga0070712_100021078 3300006175 Bacteria 4274
115 Ga0070712_100101950 3300006175 Bacteria 2125
116 Ga0070712_100656373 3300006175 Bacteria 892
117 Ga0070712_100866629 3300006175 Unclassified 777
118 Ga0068871_100146109 3300006358 Bacteria 2013
119 Ga0068871_100348409 3300006358 Bacteria 1309
120 Ga0075428_102570495 3300006844 Unclassified 521
121 Ga0075433_10478125 3300006852 Unclassified 1097
122 Ga0075433_11170770 3300006852 Unclassified 668
123 Ga0075434_100405907 3300006871 Unclassified 1383
124 Ga0099794_10458322 3300007265 Bacteria 669
125 Ga0099795_10080128 3300007788 Bacteria 1248
126 Ga0105240_10519622 3300009093 Unclassified 1321
127 Ga0111539_10269085 3300009094 Bacteria 1984
128 Ga0111539_11240292 3300009094 Bacteria 866
129 Ga0111539_11685899 3300009094 Bacteria 735
130 Ga0114129_10121000 3300009147 Unclassified 3603
131 Ga0114129_10479484 3300009147 Unclassified 1628
132 Ga0105241_12026652 3300009174 Bacteria 567
133 Ga0105241_12412824 3300009174 Unclassified 525
134 Ga0105248_12522293 3300009177 Bacteria 586
135 Ga0105238_10894444 3300009551 Unclassified 906
136 Ga0105249_10474027 3300009553 Bacteria 1293
137 Ga0099796_10423621 3300010159 Bacteria 588
138 Ga0105239_11053711 3300010375 Unclassified 936
139 Ga0105239_12904436 3300010375 Bacteria 559
140 Ga0105246_10248266 3300011119 Bacteria 1411
141 Ga0157327_1065098 3300012512 Bacteria 553
142 Ga0157373_11032393 3300013100 Unclassified 615
143 Ga0157371_10390786 3300013102 Unclassified 1017
144 Ga0157371_10399536 3300013102 Unclassified 1005
145 Ga0157369_10636708 3300013105 Bacteria 1100
146 Ga0157374_10032643 3300013296 Bacteria 4742
147 Ga0157374_10070022 3300013296 Bacteria 3304
148 Ga0157374_10163185 3300013296 Bacteria 2171
149 Ga0157374_12403619 3300013296 Unclassified 554
150 Ga0157378_11526131 3300013297 Unclassified 713
151 Ga0157378_12203369 3300013297 Unclassified 602
152 Ga0163162_10064484 3300013306 Bacteria 3708
153 Ga0163162_10388008 3300013306 Bacteria 1529
154 Ga0163162_10570599 3300013306 Unclassified 1259
155 Ga0157372_10277725 3300013307 Bacteria 1947
156 Ga0157372_10308477 3300013307 Bacteria 1842
157 Ga0157372_10572258 3300013307 Unclassified 1317
158 Ga0157375_10003770 3300013308 Bacteria 13135
159 Ga0157375_10022047 3300013308 Bacteria 5858
160 Ga0157375_10199233 3300013308 Bacteria 2158
161 Ga0163163_10547197 3300014325 Bacteria 1220
162 Ga0163163_10709077 3300014325 Bacteria 1070
163 Ga0163163_11437865 3300014325 Bacteria 751
164 Ga0163163_11818162 3300014325 Unclassified 669
165 Ga0157377_11069926 3300014745 Unclassified 616
166 Ga0157379_10231115 3300014968 Unclassified 1676
167 Ga0157379_10663420 3300014968 Unclassified 977
168 Ga0157376_10069089 3300014969 Bacteria 2994
169 Ga0157376_10246877 3300014969 Bacteria 1665
170 Ga0157376_10384766 3300014969 Bacteria 1352
171 Ga0157376_10765337 3300014969 Bacteria 976
172 Ga0182007_10039412 3300015262 Unclassified 1581
173 Ga0213874_10351962 3300021377 Unclassified 564
174 Ga0213876_10001903 3300021384 Bacteria 12553
175 Ga0207697_10001007 3300025315 Bacteria 15769
176 Ga0207697_10002439 3300025315 Bacteria 9640
177 Ga0207697_10085180 3300025315 Bacteria 1335
178 Ga0207697_10191392 3300025315 Bacteria 898
179 Ga0207697_10225427 3300025315 Bacteria 827
180 Ga0207642_10111630 3300025899 Bacteria 1393
181 Ga0207710_10123108 3300025900 Unclassified 1240
182 Ga0207680_10188070 3300025903 Bacteria 1400
183 Ga0207680_10219500 3300025903 Bacteria 1303
184 Ga0207680_10257597 3300025903 Bacteria 1207
185 Ga0207685_10185540 3300025905 Bacteria 967
186 Ga0207645_10004672 3300025907 Bacteria 10081
187 Ga0207645_10046071 3300025907 Bacteria 2786
188 Ga0207645_10240213 3300025907 Bacteria 1197
189 Ga0207684_10607519 3300025910 Unclassified 934
190 Ga0207684_11244998 3300025910 Unclassified 615
191 Ga0207707_10198371 3300025912 Bacteria 1750
192 Ga0207693_10028493 3300025915 Bacteria 4412
193 Ga0207693_10137522 3300025915 Bacteria 1921
194 Ga0207663_10088099 3300025916 Unclassified 2052
195 Ga0207663_10132910 3300025916 Bacteria 1722
196 Ga0207663_10218785 3300025916 Bacteria 1385
197 Ga0207660_10027842 3300025917 Bacteria 3861
198 Ga0207662_10186130 3300025918 Bacteria 1338
199 Ga0207649_10097567 3300025920 Bacteria 1938
200 Ga0207649_10847235 3300025920 Unclassified 715
201 Ga0207652_10349171 3300025921 Bacteria 1335
202 Ga0207646_10026757 3300025922 Bacteria 5262
203 Ga0207646_10049807 3300025922 Bacteria 3750
204 Ga0207646_10058700 3300025922 Bacteria 3437
205 Ga0207646_11179238 3300025922 Unclassified 672
206 Ga0207681_10083374 3300025923 Bacteria 2262
207 Ga0207681_10164633 3300025923 Bacteria 1675
208 Ga0207650_10003918 3300025925 Bacteria 10180
209 Ga0207659_10610638 3300025926 Bacteria 930
210 Ga0207659_10848301 3300025926 Unclassified 785
211 Ga0207700_10304326 3300025928 Bacteria 1377
212 Ga0207644_10008548 3300025931 Bacteria 6698
213 Ga0207644_10216882 3300025931 Unclassified 1515
214 Ga0207644_10222035 3300025931 Bacteria 1498
215 Ga0207644_10536914 3300025931 Bacteria 967
216 Ga0207644_11883078 3300025931 Unclassified 500
217 Ga0207706_10019660 3300025933 Bacteria 6075
218 Ga0207706_10117714 3300025933 Bacteria 2336
219 Ga0207670_10980517 3300025936 Unclassified 710
220 Ga0207670_11014652 3300025936 Unclassified 698
221 Ga0207669_10324041 3300025937 Unclassified 1180
222 Ga0207691_10003406 3300025940 Bacteria 15457
223 Ga0207691_10125797 3300025940 Unclassified 2268
224 Ga0207691_10801641 3300025940 Unclassified 791
225 Ga0207689_10841334 3300025942 Unclassified 774
226 Ga0207689_11134734 3300025942 Unclassified 659
227 Ga0207661_10053997 3300025944 Bacteria 3217
228 Ga0207661_10320374 3300025944 Bacteria 1393
229 Ga0207679_10125194 3300025945 Bacteria 2052
230 Ga0207651_11576396 3300025960 Unclassified 591
231 Ga0207712_10440756 3300025961 Bacteria 1103
232 Ga0207658_10053370 3300025986 Bacteria 2986
233 Ga0207658_10330989 3300025986 Unclassified 1321
234 Ga0207658_10623663 3300025986 Unclassified 970
235 Ga0207677_10384529 3300026023 Bacteria 1185
236 Ga0207677_10601165 3300026023 Bacteria 965
237 Ga0207678_10001436 3300026067 Bacteria 21863
238 Ga0207678_10179821 3300026067 Bacteria 1806
239 Ga0207702_10066359 3300026078 Bacteria 3093
240 Ga0207641_10488921 3300026088 Bacteria 1194
241 Ga0207683_10006765 3300026121 Bacteria 9811
242 Ga0207683_10056103 3300026121 Bacteria 3455
243 Ga0209971_1110035 3300027682 Bacteria 675
244 Ga0209974_10014041 3300027876 Bacteria 2668
245 Ga0207428_10160317 3300027907 Unclassified 1708
246 Ga0268266_10383062 3300028379 Bacteria 1327
247 Ga0268266_10531181 3300028379 Bacteria 1125
248 Ga0268266_10610848 3300028379 Bacteria 1048
249 Ga0268265_11627231 3300028380 Bacteria 651
250 Ga0268264_10253061 3300028381 Bacteria 1637
251 Ga0373934_0059188 3300035086 Unclassified 1525
252 Ga0373941_0225678 3300035115 Bacteria 722
253 Ga0373956_0135005 3300035119 Bacteria 1157
254 Ga0373957_0262996 3300035120 Bacteria 727
255 Ga0373943_0107386 3300035170 Bacteria 1468
256 Ga0373955_0055892 3300035172 Bacteria 2163
257 Ga0373942_0109579 3300035207 Unclassified 853
258 Ga0373935_0009788 3300035692 Bacteria 5742
259 Ga0373947_0057601 3300035725 Bacteria 2352
260 Ga0373937_0094486 3300036401 Bacteria 2772
261 Ga0373937_0147184 3300036401 Unclassified 2205
262 Ga0373925_1563011 3300037068 Unclassified 539
263 Ga0395905_0445457 3300037471 Bacteria 1193
264 Ga0436364_0297417 3300037853 Bacteria 2184
265 Ga0395901_0266300 3300038443 Bacteria 1783
266 Ga0395901_2116375 3300038443 Unclassified 508
267 Ga0436365_1592200 3300039437 Bacteria 19337
268 Ga0436361_0090775 3300039447 Bacteria 3047
269 Ga0436363_1305367 3300039450 Bacteria 1349
270 Ga0451798_0326583 3300041458 Bacteria 1182
271 Ga0451802_0166794 3300041460 Unclassified 670
272 Ga0439451_044838 3300042009 Unclassified 886
273 Ga0439451_063198 3300042009 Bacteria 741
274 Ga0439451_129662 3300042009 Unclassified 515
275 Ga0439455_0006330 3300042012 Bacteria 2453
276 Ga0439464_0016395 3300042439 Bacteria 2002
277 Ga0439460_0023226 3300042461 Bacteria 1708
278 Ga0439440_0219839 3300042993 Bacteria 569
279 Ga0466966_0846602 3300044684 Bacteria 551
280 Ga0451576_1202059 3300045051 Unclassified 792
281 Ga0451576_1541567 3300045051 Unclassified 690
282 Ga0466967_0133590 3300045976 Bacteria 2306
283 Ga0495592_0039292 3300046454 Bacteria 3555
284 Ga0495592_0466449 3300046454 Unclassified 789
285 Ga0495651_0092461 3300046462 Bacteria 2266
286 Ga0495651_0230991 3300046462 Unclassified 1274
287 Ga0495653_0068451 3300046463 Bacteria 2663
288 Ga0495580_0600173 3300046472 Bacteria 728
289 Ga0495664_0045359 3300046477 Bacteria 2607
290 Ga0495608_0070021 3300046511 Bacteria 2290
291 Ga0495618_0128014 3300046514 Unclassified 1625
292 Ga0495618_0456612 3300046514 Bacteria 775
293 Ga0495628_0022456 3300046516 Bacteria 5182
294 Ga0495630_0474019 3300046517 Unclassified 959
295 Ga0495652_0012541 3300046529 Bacteria 7642
296 Ga0495665_0196315 3300046531 Unclassified 1047
297 Ga0495640_0160033 3300046533 Bacteria 1443
298 Ga0495586_0073718 3300046535 Bacteria 1867
299 Ga0495587_0057237 3300046536 Bacteria 2292
300 Ga0495645_0011316 3300046543 Bacteria 6274
301 Ga0495667_0304480 3300046559 Bacteria 1009
302 Ga0495657_0574697 3300046675 Bacteria 653
303 Ga0495599_0007832 3300046678 Bacteria 6485
304 Ga0495623_0015384 3300046679 Bacteria 4944
305 Ga0495646_0005107 3300046680 Bacteria 8275
306 Ga0495669_0100395 3300046684 Bacteria 1344
307 Ga0495669_0327272 3300046684 Unclassified 740
308 Ga0495613_0900422 3300046689 Unclassified 573
309 Ga0495581_0153843 3300047315 Bacteria 1344
310 Ga0495604_0071177 3300047317 Bacteria 2631
311 Ga0495604_0545185 3300047317 Unclassified 748
312 Ga0495674_0150816 3300047319 Bacteria 1949
313 Ga0495680_0117086 3300047322 Unclassified 1970
314 Ga0495675_0017945 3300047444 Bacteria 4487
315 Ga0495675_0193718 3300047444 Bacteria 1240
316 Ga0495684_0151353 3300047471 Bacteria 1734
317 Ga0495593_0433505 3300047673 Unclassified 658
318 Ga0495602_0043870 3300048088 Bacteria 4060
319 Ga0496100_1202232 3300048903 Bacteria 598
320 Ga0496101_0043004 3300048904 Bacteria 3227
321 Ga0496101_1476848 3300048904 Unclassified 529
322 Ga0496104_0014922 3300048907 Bacteria 7024
323 Ga0496104_0189826 3300048907 Bacteria 1966
324 Ga0496105_0077922 3300048908 Bacteria 2737
325 Ga0496105_0087775 3300048908 Bacteria 2570
326 Ga0496106_1084086 3300048909 Unclassified 628
327 Ga0496108_0772401 3300048911 Unclassified 830
328 Ga0496108_1669259 3300048911 Bacteria 525
329 Ga0496109_0061483 3300048912 Bacteria 3434
330 Ga0496112_0010611 3300048915 Bacteria 8370
331 Ga0496113_0075584 3300048916 Bacteria 2571
332 Ga0496113_0427750 3300048916 Bacteria 1064
333 Ga0496114_0024795 3300048917 Bacteria 4897
334 Ga0496114_0110099 3300048917 Bacteria 2359
335 Ga0496115_0003485 3300048918 Bacteria 11311
336 nmdc:mga05p37_1867968_c1 3300050507 Unclassified 576
337 nmdc:mga05p37_94556_c1 3300050507 Bacteria 3682
338 nmdc:mga08y16_422132_c1 3300050511 Unclassified 1363
339 nmdc:mga0n895_1197545_c1 3300050512 Bacteria 734
340 nmdc:mga0n895_1613658_c1 3300050512 Bacteria 613
341 nmdc:mga0a205_244899_c1 3300050515 Unclassified 1010
342 nmdc:mga0a205_349392_c1 3300050515 Bacteria 1346
343 Ga0495601_0012825 3300053077 Bacteria 5030
344 Ga0495612_0010520 3300053078 Bacteria 3739
345 Ga0495655_0066369 3300053083 Bacteria 998
346 Ga0495595_0347740 3300053084 Unclassified 748
347 Ga0495619_1018942 3300053085 Unclassified 553
348 Ga0500618_131193 3300053125 Unclassified 569
349 Ga0070706_100908070
350 Ga0065714_10526777
351 Ga0065712_10111675
352 Ga0065712_10316232
353 Ga0065715_10005314
354 Ga0065715_10089774
355 Ga0065715_10319091
356 Ga0065715_10388447
357 Ga0070658_10275452
358 Ga0070676_10342358
359 Ga0070683_100028595
360 Ga0070683_101307946
361 Ga0070690_100120907
362 Ga0070690_101062035
363 Ga0070670_100005129
364 Ga0070670_100026824
365 Ga0070670_100682591
366 Ga0070670_101871659
367 Ga0068869_100624856
368 Ga0070666_10073587
369 Ga0070680_100418129
370 Ga0068868_100038531
371 Ga0070689_100082631
372 Ga0070689_100704805
373 Ga0070689_101279689
374 Ga0070661_100044890
375 Ga0070661_100489041
376 Ga0070661_101733132
377 Ga0070668_100253533
378 Ga0070669_100187636
379 Ga0070675_100048421
380 Ga0070675_100105881
381 Ga0070675_100676296
382 Ga0070671_100043770
383 Ga0070671_100137789
384 Ga0070674_100119654
385 Ga0070673_100282440
386 Ga0070688_100448077
387 Ga0070688_100653864
388 Ga0070659_100515314
389 Ga0070667_100105354
390 Ga0070667_100106842
391 Ga0070667_100246796
392 Ga0070667_100474851
393 Ga0070667_101526354
394 Ga0070709_10135616
395 Ga0070713_100057130
396 Ga0070713_101049773
397 Ga0070710_10253742
398 Ga0070710_10426043
399 Ga0070710_11349624
400 Ga0070711_100253011
401 Ga0070711_100265013
402 Ga0070705_100170697
403 Ga0070705_100566045
404 Ga0070708_100112225
405 Ga0070708_100122396
406 Ga0070708_100350391
407 Ga0070663_100045053
408 Ga0070663_100630932
409 Ga0070678_100219135
410 Ga0070678_100794849
411 Ga0070678_101632498
412 Ga0070662_100101463
413 Ga0070662_100189297
414 Ga0070662_100992236
415 Ga0070662_101725707
416 Ga0070681_10021678
417 Ga0068867_100030916
418 Ga0068867_102083493
419 Ga0070706_100245216
420 Ga0070707_100052397
421 Ga0070707_100079380
422 Ga0070698_100113276
423 Ga0070699_100085600
424 Ga0070699_100100740
425 Ga0070679_100977412
426 Ga0070684_100007084
427 Ga0070684_100074348
428 Ga0070684_102214087
429 Ga0070697_100104384
430 Ga0070697_100123199
431 Ga0070672_100128691
432 Ga0070672_100238100
433 Ga0070686_100066912
434 Ga0070665_100004925
435 Ga0070665_100052362
436 Ga0070665_101299143
437 Ga0070665_101872400
438 Ga0070704_100658678
439 Ga0070664_100018951
440 Ga0068857_100749645
441 Ga0068857_101550107
442 Ga0068854_101107777
443 Ga0068856_100083204
444 Ga0068856_102608599
445 Ga0068852_101482348
446 Ga0068864_100870654
447 Ga0068866_10079400
448 Ga0068863_100883337
449 Ga0068863_101402135
450 Ga0068863_101663821
451 Ga0068858_100461273
452 Ga0068858_102258124
453 Ga0068858_102260670
454 Ga0068860_100507450
455 Ga0081539_10073623
456 Ga0070717_10504557
457 Ga0070717_10779649
458 Ga0070717_11090900
459 Ga0070717_11165317
460 Ga0070715_10051543
461 Ga0070716_100107776
462 Ga0070712_100021078
463 Ga0070712_100101950
464 Ga0070712_100656373
465 Ga0070712_100866629
466 Ga0068871_100146109
467 Ga0068871_100348409
468 Ga0075428_102570495
469 Ga0075433_10478125
470 Ga0075433_11170770
471 Ga0075434_100405907
472 Ga0099794_10458322
473 Ga0099795_10080128
474 Ga0105240_10519622
475 Ga0111539_10269085
476 Ga0111539_11240292
477 Ga0111539_11685899
478 Ga0114129_10121000
479 Ga0114129_10479484
480 Ga0105241_12026652
481 Ga0105241_12412824
482 Ga0105248_12522293
483 Ga0105238_10894444
484 Ga0105249_10474027
485 Ga0099796_10423621
486 Ga0105239_11053711
487 Ga0105239_12904436
488 Ga0105246_10248266
489 Ga0157327_1065098
490 Ga0157373_11032393
491 Ga0157371_10390786
492 Ga0157371_10399536
493 Ga0157369_10636708
494 Ga0157374_10032643
495 Ga0157374_10070022
496 Ga0157374_10163185
497 Ga0157374_12403619
498 Ga0157378_11526131
499 Ga0157378_12203369
500 Ga0163162_10064484
501 Ga0163162_10388008
502 Ga0163162_10570599
503 Ga0157372_10277725
504 Ga0157372_10308477
505 Ga0157372_10572258
506 Ga0157375_10003770
507 Ga0157375_10022047
508 Ga0157375_10199233
509 Ga0163163_10547197
510 Ga0163163_10709077
511 Ga0163163_11437865
512 Ga0163163_11818162
513 Ga0157377_11069926
514 Ga0157379_10231115
515 Ga0157379_10663420
516 Ga0157376_10069089
517 Ga0157376_10246877
518 Ga0157376_10384766
519 Ga0157376_10765337
520 Ga0182007_10039412
521 Ga0213874_10351962
522 Ga0213876_10001903
523 Ga0207697_10001007
524 Ga0207697_10002439
525 Ga0207697_10085180
526 Ga0207697_10191392
527 Ga0207697_10225427
528 Ga0207642_10111630
529 Ga0207710_10123108
530 Ga0207680_10188070
531 Ga0207680_10219500
532 Ga0207680_10257597
533 Ga0207685_10185540
534 Ga0207645_10004672
535 Ga0207645_10046071
536 Ga0207645_10240213
537 Ga0207684_10607519
538 Ga0207684_11244998
539 Ga0207707_10198371
540 Ga0207693_10028493
541 Ga0207693_10137522
542 Ga0207663_10088099
543 Ga0207663_10132910
544 Ga0207663_10218785
545 Ga0207660_10027842
546 Ga0207662_10186130
547 Ga0207649_10097567
548 Ga0207649_10847235
549 Ga0207652_10349171
550 Ga0207646_10026757
551 Ga0207646_10049807
552 Ga0207646_10058700
553 Ga0207646_11179238
554 Ga0207681_10083374
555 Ga0207681_10164633
556 Ga0207650_10003918
557 Ga0207659_10610638
558 Ga0207659_10848301
559 Ga0207700_10304326
560 Ga0207644_10008548
561 Ga0207644_10216882
562 Ga0207644_10222035
563 Ga0207644_10536914
564 Ga0207644_11883078
565 Ga0207706_10019660
566 Ga0207706_10117714
567 Ga0207670_10980517
568 Ga0207670_11014652
569 Ga0207669_10324041
570 Ga0207691_10003406
571 Ga0207691_10125797
572 Ga0207691_10801641
573 Ga0207689_10841334
574 Ga0207689_11134734
575 Ga0207661_10053997
576 Ga0207661_10320374
577 Ga0207679_10125194
578 Ga0207651_11576396
579 Ga0207712_10440756
580 Ga0207658_10053370
581 Ga0207658_10330989
582 Ga0207658_10623663
583 Ga0207677_10384529
584 Ga0207677_10601165
585 Ga0207678_10001436
586 Ga0207678_10179821
587 Ga0207702_10066359
588 Ga0207641_10488921
589 Ga0207683_10006765
590 Ga0207683_10056103
591 Ga0209971_1110035
592 Ga0209974_10014041
593 Ga0207428_10160317
594 Ga0268266_10383062
595 Ga0268266_10531181
596 Ga0268266_10610848
597 Ga0268265_11627231
598 Ga0268264_10253061
599 Ga0373934_0059188
600 Ga0373941_0225678
601 Ga0373956_0135005
602 Ga0373957_0262996
603 Ga0373943_0107386
604 Ga0373955_0055892
605 Ga0373942_0109579
606 Ga0373935_0009788
607 Ga0373947_0057601
608 Ga0373937_0094486
609 Ga0373937_0147184
610 Ga0373925_1563011
611 Ga0395905_0445457
612 Ga0436364_0297417
613 Ga0395901_0266300
614 Ga0395901_2116375
615 Ga0436365_1592200
616 Ga0436361_0090775
617 Ga0436363_1305367
618 Ga0451798_0326583
619 Ga0451802_0166794
620 Ga0439451_044838
621 Ga0439451_063198
622 Ga0439451_129662
623 Ga0439455_0006330
624 Ga0439464_0016395
625 Ga0439460_0023226
626 Ga0439440_0219839
627 Ga0466966_0846602
628 Ga0451576_1202059
629 Ga0451576_1541567
630 Ga0466967_0133590
631 Ga0495592_0039292
632 Ga0495592_0466449
633 Ga0495651_0092461
634 Ga0495651_0230991
635 Ga0495653_0068451
636 Ga0495580_0600173
637 Ga0495664_0045359
638 Ga0495608_0070021
639 Ga0495618_0128014
640 Ga0495618_0456612
641 Ga0495628_0022456
642 Ga0495630_0474019
643 Ga0495652_0012541
644 Ga0495665_0196315
645 Ga0495640_0160033
646 Ga0495586_0073718
647 Ga0495587_0057237
648 Ga0495645_0011316
649 Ga0495667_0304480
650 Ga0495657_0574697
651 Ga0495599_0007832
652 Ga0495623_0015384
653 Ga0495646_0005107
654 Ga0495669_0100395
655 Ga0495669_0327272
656 Ga0495613_0900422
657 Ga0495581_0153843
658 Ga0495604_0071177
659 Ga0495604_0545185
660 Ga0495674_0150816
661 Ga0495680_0117086
662 Ga0495675_0017945
663 Ga0495675_0193718
664 Ga0495684_0151353
665 Ga0495593_0433505
666 Ga0495602_0043870
667 Ga0496100_1202232
668 Ga0496101_0043004
669 Ga0496101_1476848
670 Ga0496104_0014922
671 Ga0496104_0189826
672 Ga0496105_0077922
673 Ga0496105_0087775
674 Ga0496106_1084086
675 Ga0496108_0772401
676 Ga0496108_1669259
677 Ga0496109_0061483
678 Ga0496112_0010611
679 Ga0496113_0075584
680 Ga0496113_0427750
681 Ga0496114_0024795
682 Ga0496114_0110099
683 Ga0496115_0003485
684 nmdc:mga05p37_1867968_c1
685 nmdc:mga05p37_94556_c1
686 nmdc:mga08y16_422132_c1
687 nmdc:mga0n895_1197545_c1
688 nmdc:mga0n895_1613658_c1
689 nmdc:mga0a205_244899_c1
690 nmdc:mga0a205_349392_c1
691 Ga0495601_0012825
692 Ga0495612_0010520
693 Ga0495655_0066369
694 Ga0495595_0347740
695 Ga0495619_1018942
696 Ga0500618_131193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00886

Ribosomal_S16

Ribosomal protein S16

9

67

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8phj-assembly1.cif.gz_P ca4-bound cami1 in complex with 70s ribosome 0.8868 3 79
8fmw-assembly1.cif.gz_P the structure of a hibernating ribosome in the lyme disease pathogen 0.8866 1 82
6w6p-assembly1.cif.gz_p multibody refinement of 70s ribosome from enterococcus faecalis 0.8847 2 77
6om6-assembly1.cif.gz_u structure of trans-translation inhibitor bound to e. coli 70s ribosome with p site trna 0.8794 3 80
7jil-assembly1.cif.gz_u 70s ribosome flavobacterium johnsoniae 0.8794 2 74
ID Description Score Start End Superfamily
af_P56806_1_79_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8794 3 77 3.30.1320.10
3knhP00 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8688 3 77 3.30.1320.10
5x8rp00 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8536 3 76 3.30.1320.10
1vs5P00 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8518 3 79 3.30.1320.10
4kdgP00 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8515 3 76 3.30.1320.10
ID Description Score Start End GO Terms
AF-A0A838Q926-F1-model_v4 Small ribosomal subunit protein bS16 0.9248 1 82 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A7V3QW33-F1-model_v4 Small ribosomal subunit protein bS16 0.9202 3 82 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A849UJQ9-F1-model_v4 Small ribosomal subunit protein bS16 0.9193 1 80 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A2D6MYY4-F1-model_v4 Small ribosomal subunit protein bS16 0.9166 3 83 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A2V5JZL6-F1-model_v4 30S ribosomal protein S16 0.9152 1 77 GO:0003735
GO:0005737
GO:0006412
GO:0015935

Map