F417445

General Info

Members Datasets Scaffolds Average Seq Length
348 207 696 393

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10150829|Ga0070681_101508292
Length 458
Sequence MRKSIVSIAVRYLVLISNSAAPLAKENETTRCDESLTVDDFAGRYLYMKATCWHGKHDIRVENVPDPAIQDSRDAIIRITATAICGSDLHIYDGFIPTMEEGDILGHEFMGVVEETGKQNGPKKGDRVIIPFQIACGQCYFCQRTLTALCDTTNPNADKMKKLYGQGAAGLFGYSHLYGGYPGGQAEYARVPCADFGAFKIPNGLDDEQVLFLTDIFPTGFMVAENCGIEAGQTVAVWGCGPVGQFAIRSAFLLGAGRVIALDNVPERLEMARQGGAEVVNDEEKHLQEKLKDMTGGRGPDHCIDAVGMEAHGAMLDALYDRVKTAVMLETDRSHALRSAIQACAKGGTVSIPGVYGGFLDKFPLGAAFAKGLTLKMGQTNVHRYLRRLLDYILQEKIDPSFVITHRIPLGDAPKGYKTFHDKDDGCIKVVMKPQMTEIPELVTAETAELSGPEAVVA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
174 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
207 2895880812 Frankia sp. BMG5.11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.83
Metatranscriptomes 4.6
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 2.87
Rhizosphere 89.08
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10150829 3300005458 Unclassified 2251
2 JGI24746J21847_1000116 3300001977 Bacteria 9403
3 JGI24746J21847_1003356 3300001977 Bacteria 2518
4 Ga0007429J51699_1010856 3300003579 Bacteria 2639
5 Ga0007429J51699_1012847 3300003579 Bacteria 2585
6 Ga0007429J51699_1031945 3300003579 Bacteria 2729
7 Ga0007429J51699_1067240 3300003579 Bacteria 3663
8 Ga0032354_1010712 3300003693 Bacteria 2840
9 Ga0032354_1036548 3300003693 Bacteria 2061
10 Ga0032354_1075075 3300003693 Bacteria 2517
11 Ga0065714_10114002 3300005288 Bacteria 1434
12 Ga0065712_10068158 3300005290 Bacteria 13710
13 Ga0065712_10073058 3300005290 Bacteria 4516
14 Ga0065712_10107368 3300005290 Bacteria 1897
15 Ga0065712_10111450 3300005290 Bacteria 1817
16 Ga0065712_10122359 3300005290 Bacteria 1652
17 Ga0065715_10093354 3300005293 Bacteria 4716
18 Ga0065715_10105631 3300005293 Bacteria 2868
19 Ga0065715_10115907 3300005293 Bacteria 2398
20 Ga0065715_10118200 3300005293 Bacteria 2299
21 Ga0070676_10007841 3300005328 Bacteria 5740
22 Ga0070683_100000305 3300005329 Bacteria 33656
23 Ga0070683_100000728 3300005329 Bacteria 24092
24 Ga0070683_100003769 3300005329 Bacteria 12376
25 Ga0070683_100362648 3300005329 Bacteria 1380
26 Ga0070670_100000749 3300005331 Bacteria 25181
27 Ga0070670_100018718 3300005331 Bacteria 5937
28 Ga0070670_100090701 3300005331 Bacteria 2626
29 Ga0070677_10007014 3300005333 Bacteria 3748
30 Ga0068869_100048988 3300005334 Bacteria 3057
31 Ga0068869_100054251 3300005334 Bacteria 2917
32 Ga0070666_10046503 3300005335 Bacteria 2911
33 Ga0068868_100007113 3300005338 Bacteria 7956
34 Ga0068868_100007966 3300005338 Bacteria 7571
35 Ga0070689_100088095 3300005340 Bacteria 2443
36 Ga0070689_100267456 3300005340 Bacteria 1414
37 Ga0070668_100142669 3300005347 Bacteria 1931
38 Ga0070668_100182549 3300005347 Bacteria 1715
39 Ga0070675_100001612 3300005354 Bacteria 16628
40 Ga0070675_100005685 3300005354 Bacteria 9546
41 Ga0070675_100071747 3300005354 Bacteria 2874
42 Ga0070671_100073112 3300005355 Bacteria 2864
43 Ga0070673_100107860 3300005364 Bacteria 2304
44 Ga0070667_100046053 3300005367 Bacteria 3668
45 Ga0070667_100127223 3300005367 Bacteria 2221
46 Ga0070700_100007730 3300005441 Bacteria 5822
47 Ga0070663_100029889 3300005455 Bacteria 3728
48 Ga0070678_100031345 3300005456 Bacteria 3666
49 Ga0070678_100166686 3300005456 Bacteria 1790
50 Ga0070662_100041773 3300005457 Bacteria 3273
51 Ga0070662_100110767 3300005457 Bacteria 2091
52 Ga0070681_10199734 3300005458 Bacteria 1918
53 Ga0068867_100091295 3300005459 Bacteria 2312
54 Ga0068867_100196187 3300005459 Bacteria 1614
55 Ga0070684_100001200 3300005535 Bacteria 18618
56 Ga0070684_100081247 3300005535 Bacteria 2868
57 Ga0068853_100034165 3300005539 Bacteria 4315
58 Ga0070686_100063559 3300005544 Bacteria 2391
59 Ga0070695_100046405 3300005545 Bacteria 2772
60 Ga0070665_100051363 3300005548 Bacteria 4134
61 Ga0070665_100092493 3300005548 Bacteria 3029
62 Ga0070665_100199384 3300005548 Bacteria 2002
63 Ga0070704_100032984 3300005549 Bacteria 3498
64 Ga0070664_100004217 3300005564 Bacteria 11558
65 Ga0070664_100012244 3300005564 Bacteria 6971
66 Ga0070664_100022639 3300005564 Bacteria 5182
67 Ga0070664_100058976 3300005564 Bacteria 3265
68 Ga0070664_100277947 3300005564 Bacteria 1509
69 Ga0068857_100355100 3300005577 Bacteria 1358
70 Ga0068856_100146807 3300005614 Bacteria 2366
71 Ga0070702_100102513 3300005615 Bacteria 1758
72 Ga0068852_100016936 3300005616 Bacteria 5702
73 Ga0068859_100007262 3300005617 Bacteria 11239
74 Ga0068859_100034829 3300005617 Bacteria 5052
75 Ga0068859_100066462 3300005617 Bacteria 3640
76 Ga0068859_100072371 3300005617 Bacteria 3484
77 Ga0068859_100178353 3300005617 Bacteria 2207
78 Ga0068866_10131911 3300005718 Bacteria 1422
79 Ga0068861_100030117 3300005719 Bacteria 3975
80 Ga0068870_10006491 3300005840 Bacteria 5160
81 Ga0068863_100043536 3300005841 Bacteria 4261
82 Ga0068858_100002439 3300005842 Bacteria 18806
83 Ga0068858_100064148 3300005842 Bacteria 3399
84 Ga0068860_100049619 3300005843 Bacteria 3996
85 Ga0068862_100112704 3300005844 Bacteria 2389
86 Ga0075365_10073841 3300006038 Bacteria 2300
87 Ga0075364_10015733 3300006051 Bacteria 4695
88 Ga0075367_10091859 3300006178 Bacteria 1847
89 Ga0075366_10000371 3300006195 Bacteria 20821
90 Ga0075366_10012341 3300006195 Bacteria 4845
91 Ga0075366_10073471 3300006195 Bacteria 2038
92 Ga0097621_100029352 3300006237 Bacteria 4342
93 Ga0097621_100077443 3300006237 Bacteria 2760
94 Ga0075370_10000981 3300006353 Bacteria 11805
95 Ga0075370_10083733 3300006353 Bacteria 1835
96 Ga0075370_10156135 3300006353 Bacteria 1338
97 Ga0068871_100116045 3300006358 Bacteria 2257
98 Ga0075428_100019136 3300006844 Bacteria 7573
99 Ga0075428_100058028 3300006844 Bacteria 4238
100 Ga0075428_100193500 3300006844 Bacteria 2200
101 Ga0075428_100347995 3300006844 Bacteria 1591
102 Ga0075428_100352223 3300006844 Bacteria 1580
103 Ga0075430_100085766 3300006846 Bacteria 2636
104 Ga0075431_100134082 3300006847 Bacteria 2553
105 Ga0075433_10014543 3300006852 Bacteria 6434
106 Ga0075433_10056555 3300006852 Unclassified 3427
107 Ga0075434_100138966 3300006871 Bacteria 2449
108 Ga0075429_100013400 3300006880 Bacteria 7110
109 Ga0075429_100013737 3300006880 Bacteria 7021
110 Ga0075429_100046599 3300006880 Bacteria 3772
111 Ga0075429_100246700 3300006880 Bacteria 1564
112 Ga0097620_100007262 3300006931 Bacteria 11239
113 Ga0097620_100034829 3300006931 Bacteria 5052
114 Ga0097620_100066462 3300006931 Bacteria 3640
115 Ga0097620_100072369 3300006931 Bacteria 3484
116 Ga0097620_100178367 3300006931 Bacteria 2207
117 Ga0075435_100009561 3300007076 Bacteria 7031
118 Ga0075435_100059412 3300007076 Unclassified 3099
119 Ga0105240_10001961 3300009093 Bacteria 34012
120 Ga0105240_10030252 3300009093 Bacteria 7039
121 Ga0105240_10167790 3300009093 Bacteria 2602
122 Ga0105240_10311477 3300009093 Bacteria 1797
123 Ga0111539_10004059 3300009094 Bacteria 19229
124 Ga0111539_10004849 3300009094 Bacteria 17531
125 Ga0111539_10020505 3300009094 Bacteria 8141
126 Ga0111539_10162943 3300009094 Bacteria 2608
127 Ga0111539_10213166 3300009094 Bacteria 2250
128 Ga0105245_10125404 3300009098 Bacteria 2403
129 Ga0105247_10011085 3300009101 Bacteria 5438
130 Ga0105247_10156674 3300009101 Bacteria 1505
131 Ga0114129_10005481 3300009147 Bacteria 17934
132 Ga0114129_10133643 3300009147 Bacteria 3406
133 Ga0114129_10138332 3300009147 Bacteria 3341
134 Ga0114129_10478340 3300009147 Bacteria 1630
135 Ga0114129_10480650 3300009147 Bacteria 1625
136 Ga0114129_10538232 3300009147 Bacteria 1520
137 Ga0105241_10017798 3300009174 Bacteria 5226
138 Ga0105242_10001238 3300009176 Bacteria 20130
139 Ga0105237_10002356 3300009545 Bacteria 23453
140 Ga0105237_10027745 3300009545 Bacteria 5773
141 Ga0105238_10004193 3300009551 Bacteria 14309
142 Ga0105238_10072500 3300009551 Bacteria 3439
143 Ga0105249_10059998 3300009553 Bacteria 3490
144 Ga0105249_10329320 3300009553 Bacteria 1541
145 Ga0105239_10131004 3300010375 Bacteria 2790
146 Ga0157370_10083551 3300013104 Bacteria 3002
147 Ga0157370_10183254 3300013104 Bacteria 1945
148 Ga0157369_10046829 3300013105 Bacteria 4699
149 Ga0157369_10396431 3300013105 Bacteria 1432
150 Ga0157374_10040212 3300013296 Bacteria 4305
151 Ga0157374_10048006 3300013296 Bacteria 3960
152 Ga0157378_10049705 3300013297 Bacteria 3731
153 Ga0163162_10130420 3300013306 Bacteria 2622
154 Ga0157372_10067017 3300013307 Bacteria 4033
155 Ga0157372_10145714 3300013307 Bacteria 2731
156 Ga0157375_10125645 3300013308 Bacteria 2679
157 Ga0163163_10111994 3300014325 Bacteria 2758
158 Ga0157380_10012226 3300014326 Bacteria 6218
159 Ga0157380_10013600 3300014326 Bacteria 5939
160 Ga0157380_10205058 3300014326 Bacteria 1752
161 Ga0157380_10307126 3300014326 Bacteria 1464
162 Ga0182008_10007230 3300014497 Bacteria 6141
163 Ga0157377_10023013 3300014745 Bacteria 3297
164 Ga0157379_10001547 3300014968 Bacteria 18911
165 Ga0157376_10076817 3300014969 Bacteria 2854
166 Ga0163161_10063509 3300017792 Bacteria 2692
167 Ga0163161_10065388 3300017792 Bacteria 2654
168 Ga0206356_11450685 3300020070 Bacteria 2088
169 Ga0206351_10218951 3300020077 Bacteria 1722
170 Ga0154015_1286750 3300020610 Bacteria 2344
171 Ga0213876_10111835 3300021384 Bacteria 1449
172 Ga0207697_10000380 3300025315 Bacteria 24920
173 Ga0207682_10001437 3300025893 Bacteria 10992
174 Ga0207682_10010441 3300025893 Bacteria 3640
175 Ga0207682_10032042 3300025893 Bacteria 2112
176 Ga0207688_10005082 3300025901 Bacteria 7154
177 Ga0207688_10065882 3300025901 Bacteria 2048
178 Ga0207680_10010075 3300025903 Bacteria 4715
179 Ga0207645_10031433 3300025907 Bacteria 3415
180 Ga0207643_10002289 3300025908 Bacteria 10423
181 Ga0207705_10015909 3300025909 Bacteria 5400
182 Ga0207654_10021223 3300025911 Bacteria 3451
183 Ga0207695_10002359 3300025913 Bacteria 28068
184 Ga0207695_10054784 3300025913 Bacteria 4161
185 Ga0207671_10016396 3300025914 Bacteria 5759
186 Ga0207663_10135756 3300025916 Bacteria 1707
187 Ga0207660_10179187 3300025917 Bacteria 1645
188 Ga0207681_10073272 3300025923 Bacteria 2395
189 Ga0207694_10066003 3300025924 Bacteria 2822
190 Ga0207650_10007824 3300025925 Bacteria 7280
191 Ga0207650_10096011 3300025925 Bacteria 2273
192 Ga0207650_10128087 3300025925 Bacteria 1983
193 Ga0207659_10018067 3300025926 Bacteria 4616
194 Ga0207659_10027485 3300025926 Bacteria 3853
195 Ga0207659_10083858 3300025926 Bacteria 2363
196 Ga0207659_10265589 3300025926 Bacteria 1398
197 Ga0207644_10132002 3300025931 Bacteria 1913
198 Ga0207706_10001124 3300025933 Bacteria 27217
199 Ga0207706_10119780 3300025933 Bacteria 2314
200 Ga0207706_10133861 3300025933 Bacteria 2180
201 Ga0207686_10003352 3300025934 Bacteria 8601
202 Ga0207670_10025395 3300025936 Bacteria 3718
203 Ga0207665_10034667 3300025939 Bacteria 3348
204 Ga0207691_10002188 3300025940 Bacteria 19113
205 Ga0207689_10034147 3300025942 Bacteria 4225
206 Ga0207689_10282698 3300025942 Bacteria 1374
207 Ga0207661_10000649 3300025944 Bacteria 22461
208 Ga0207661_10337623 3300025944 Bacteria 1357
209 Ga0207679_10019970 3300025945 Bacteria 4513
210 Ga0207679_10030382 3300025945 Bacteria 3772
211 Ga0207679_10031649 3300025945 Bacteria 3705
212 Ga0207667_10240413 3300025949 Bacteria 1853
213 Ga0207651_10166302 3300025960 Bacteria 1734
214 Ga0207651_10220074 3300025960 Bacteria 1534
215 Ga0207712_10022412 3300025961 Bacteria 4158
216 Ga0207658_10019625 3300025986 Bacteria 4676
217 Ga0207703_10015672 3300026035 Bacteria 5911
218 Ga0207703_10155936 3300026035 Bacteria 1995
219 Ga0207678_10105780 3300026067 Bacteria 2401
220 Ga0207678_10165039 3300026067 Bacteria 1891
221 Ga0207708_10010149 3300026075 Bacteria 6992
222 Ga0207708_10218455 3300026075 Bacteria 1526
223 Ga0207702_10038616 3300026078 Bacteria 3998
224 Ga0207641_10012884 3300026088 Bacteria 6859
225 Ga0207648_10103314 3300026089 Bacteria 2499
226 Ga0207674_10149661 3300026116 Bacteria 2291
227 Ga0207675_100006069 3300026118 Bacteria 11496
228 Ga0207675_100070754 3300026118 Bacteria 3260
229 Ga0207683_10005941 3300026121 Bacteria 10464
230 Ga0207683_10055992 3300026121 Bacteria 3458
231 Ga0207428_10008973 3300027907 Bacteria 9007
232 Ga0207428_10015897 3300027907 Bacteria 6492
233 Ga0207428_10049755 3300027907 Bacteria 3356
234 Ga0268266_10102619 3300028379 Bacteria 2523
235 Ga0268266_10103755 3300028379 Bacteria 2509
236 Ga0268265_10186331 3300028380 Bacteria 1788
237 Ga0307408_100016328 3300031548 Bacteria 4953
238 Ga0307408_100135570 3300031548 Bacteria 1926
239 Ga0307413_10015209 3300031824 Bacteria 3936
240 Ga0307413_10068377 3300031824 Bacteria 2225
241 Ga0307406_10062203 3300031901 Bacteria 2414
242 Ga0307407_10048766 3300031903 Bacteria 2413
243 Ga0307409_100046877 3300031995 Bacteria 3275
244 Ga0307416_100127553 3300032002 Bacteria 2282
245 Ga0307416_100295056 3300032002 Bacteria 1607
246 Ga0307411_10065743 3300032005 Bacteria 2433
247 Ga0307411_10223186 3300032005 Bacteria 1463
248 Ga0307415_100058239 3300032126 Bacteria 2659
249 Ga0307415_100072670 3300032126 Bacteria 2423
250 Ga0373939_0011096 3300035114 Bacteria 2266
251 Ga0373943_0024157 3300035170 Bacteria 2832
252 Ga0373931_0176340 3300035691 Bacteria 1263
253 Ga0395900_0036020 3300037418 Bacteria 5099
254 Ga0436364_0080805 3300037853 Bacteria 3448
255 Ga0436364_0846928 3300037853 Bacteria 1333
256 Ga0395901_0014778 3300038443 Bacteria 7932
257 Ga0436365_0740312 3300039437 Bacteria 1915
258 Ga0436365_0842797 3300039437 Bacteria 11472
259 Ga0436365_1357373 3300039437 Bacteria 13807
260 Ga0436363_1529099 3300039450 Bacteria 1203
261 Ga0439435_0010892 3300042436 Bacteria 2171
262 Ga0439435_0026467 3300042436 Bacteria 1545
263 Ga0439460_0016818 3300042461 Bacteria 1953
264 Ga0451577_0010654 3300042876 Bacteria 8758
265 Ga0466966_0048002 3300044684 Bacteria 2721
266 Ga0466961_0003486 3300044693 Bacteria 9807
267 Ga0466961_0005269 3300044693 Bacteria 8138
268 Ga0466961_0007697 3300044693 Bacteria 6860
269 Ga0466963_0001410 3300044694 Bacteria 12911
270 Ga0466963_0012932 3300044694 Bacteria 5115
271 Ga0466963_0058749 3300044694 Bacteria 2565
272 Ga0466963_0076564 3300044694 Bacteria 2259
273 Ga0466971_0000327 3300044719 Bacteria 18324
274 Ga0466957_0013433 3300044842 Bacteria 4750
275 Ga0466957_0028617 3300044842 Bacteria 3319
276 Ga0466959_0017796 3300045049 Bacteria 5212
277 Ga0466959_0069524 3300045049 Bacteria 2551
278 Ga0466959_0111969 3300045049 Bacteria 1947
279 Ga0451576_0015757 3300045051 Bacteria 8366
280 Ga0466958_0001996 3300045836 Bacteria 10037
281 Ga0466958_0004307 3300045836 Bacteria 7497
282 Ga0466967_0002686 3300045976 Bacteria 11230
283 Ga0466967_0006296 3300045976 Bacteria 8374
284 Ga0466967_0033272 3300045976 Bacteria 4362
285 Ga0495638_0030278 3300046460 Bacteria 3486
286 Ga0495580_0026560 3300046472 Bacteria 4221
287 Ga0495640_0125780 3300046533 Bacteria 1663
288 Ga0495668_0002068 3300046616 Bacteria 17388
289 Ga0495581_0035027 3300047315 Bacteria 2905
290 Ga0496104_0004164 3300048907 Bacteria 12553
291 Ga0496105_0248530 3300048908 Bacteria 1441
292 Ga0496108_0013895 3300048911 Bacteria 6567
293 Ga0496109_0009245 3300048912 Bacteria 8394
294 Ga0496109_0067995 3300048912 Bacteria 3265
295 Ga0496110_0003398 3300048913 Bacteria 12174
296 Ga0496110_0227264 3300048913 Bacteria 1697
297 Ga0496111_0013767 3300048914 Bacteria 5512
298 Ga0496112_0030017 3300048915 Bacteria 5260
299 Ga0496115_0070000 3300048918 Bacteria 2843
300 Ga0496119_0046550 3300048922 Bacteria 2708
301 Ga0496126_0067903 3300048929 Bacteria 3185
302 Ga0501299_002911 3300049522 Bacteria 2423
303 Ga0501303_002050 3300049526 Bacteria 1535
304 Ga0501032_0038043 3300049569 Unclassified 3278
305 Ga0501034_0006722 3300049571 Bacteria 12324
306 Ga0501034_0018362 3300049571 Bacteria 7172
307 Ga0501034_0133997 3300049571 Bacteria 2459
308 Ga0501034_0161818 3300049571 Bacteria 2209
309 Ga0501043_0103612 3300049579 Unclassified 2236
310 Ga0501047_0034244 3300049581 Unclassified 4904
311 Ga0501071_0051641 3300049587 Bacteria 2964
312 Ga0501071_0128863 3300049587 Bacteria 1879
313 Ga0501076_0010426 3300049592 Bacteria 6899
314 Ga0501079_0063386 3300049741 Bacteria 2852
315 Ga0501081_0095701 3300049743 Bacteria 2094
316 Ga0501035_0345839 3300049822 Bacteria 1245
317 Ga0501035_0362849 3300049822 Bacteria 1210
318 Ga0501045_0076256 3300049824 Bacteria 2470
319 nmdc:mga00v17_8484_c1 3300050491 Bacteria 5529
320 nmdc:mga0k408_6887_c1 3300050493 Bacteria 6066
321 nmdc:mga04h51_17361_c1 3300050495 Bacteria 2104
322 nmdc:mga07m45_17303_c1 3300050496 Bacteria 3869
323 nmdc:mga05p37_73511_c1 3300050507 Bacteria 4207
324 nmdc:mga09592_12631_c1 3300050508 Bacteria 6884
325 nmdc:mga09592_20093_c1 3300050508 Bacteria 5488
326 nmdc:mga09592_269787_c1 3300050508 Bacteria 1476
327 nmdc:mga09592_29462_c1 3300050508 Bacteria 3956
328 nmdc:mga06r32_294370_c1 3300050510 Bacteria 1610
329 nmdc:mga06r32_343357_c1 3300050510 Bacteria 1477
330 nmdc:mga08y16_200001_c1 3300050511 Bacteria 2071
331 nmdc:mga08y16_46401_c1 3300050511 Bacteria 4549
332 nmdc:mga08y16_5068_c1 3300050511 Bacteria 13771
333 nmdc:mga0n895_6868_c1 3300050512 Bacteria 9720
334 nmdc:mga0a205_11201_c1 3300050515 Bacteria 8254
335 nmdc:mga0a205_29917_c1 3300050515 Bacteria 5212
336 Ga0500641_0001989 3300053096 Bacteria 7252
337 Ga0500617_008749 3300053124 Bacteria 4106
338 Ga0500568_0000888 3300053139 Bacteria 20865
339 Ga0500616_0003063 3300053153 Bacteria 13146
340 Ga0590074_003002 3300059423 Bacteria 2786
341 Ga0587066_003644 3300059490 Bacteria 1828
342 Ga0587073_0001873 3300059492 Bacteria 2580
343 Ga0587080_001472 3300059503 Bacteria 2559
344 Ga0587088_004539 3300059508 Bacteria 1766
345 Ga0587075_000314 3300059644 Bacteria 3548
346 Ga0587079_002711 3300059647 Bacteria 2213
347 2644025924 2643221603 Bacteria 6147767
348 2895882300 2895880812 Bacteria 11255272
349 Ga0070681_10150829
350 JGI24746J21847_1000116
351 JGI24746J21847_1003356
352 Ga0007429J51699_1010856
353 Ga0007429J51699_1012847
354 Ga0007429J51699_1031945
355 Ga0007429J51699_1067240
356 Ga0032354_1010712
357 Ga0032354_1036548
358 Ga0032354_1075075
359 Ga0065714_10114002
360 Ga0065712_10068158
361 Ga0065712_10073058
362 Ga0065712_10107368
363 Ga0065712_10111450
364 Ga0065712_10122359
365 Ga0065715_10093354
366 Ga0065715_10105631
367 Ga0065715_10115907
368 Ga0065715_10118200
369 Ga0070676_10007841
370 Ga0070683_100000305
371 Ga0070683_100000728
372 Ga0070683_100003769
373 Ga0070683_100362648
374 Ga0070670_100000749
375 Ga0070670_100018718
376 Ga0070670_100090701
377 Ga0070677_10007014
378 Ga0068869_100048988
379 Ga0068869_100054251
380 Ga0070666_10046503
381 Ga0068868_100007113
382 Ga0068868_100007966
383 Ga0070689_100088095
384 Ga0070689_100267456
385 Ga0070668_100142669
386 Ga0070668_100182549
387 Ga0070675_100001612
388 Ga0070675_100005685
389 Ga0070675_100071747
390 Ga0070671_100073112
391 Ga0070673_100107860
392 Ga0070667_100046053
393 Ga0070667_100127223
394 Ga0070700_100007730
395 Ga0070663_100029889
396 Ga0070678_100031345
397 Ga0070678_100166686
398 Ga0070662_100041773
399 Ga0070662_100110767
400 Ga0070681_10199734
401 Ga0068867_100091295
402 Ga0068867_100196187
403 Ga0070684_100001200
404 Ga0070684_100081247
405 Ga0068853_100034165
406 Ga0070686_100063559
407 Ga0070695_100046405
408 Ga0070665_100051363
409 Ga0070665_100092493
410 Ga0070665_100199384
411 Ga0070704_100032984
412 Ga0070664_100004217
413 Ga0070664_100012244
414 Ga0070664_100022639
415 Ga0070664_100058976
416 Ga0070664_100277947
417 Ga0068857_100355100
418 Ga0068856_100146807
419 Ga0070702_100102513
420 Ga0068852_100016936
421 Ga0068859_100007262
422 Ga0068859_100034829
423 Ga0068859_100066462
424 Ga0068859_100072371
425 Ga0068859_100178353
426 Ga0068866_10131911
427 Ga0068861_100030117
428 Ga0068870_10006491
429 Ga0068863_100043536
430 Ga0068858_100002439
431 Ga0068858_100064148
432 Ga0068860_100049619
433 Ga0068862_100112704
434 Ga0075365_10073841
435 Ga0075364_10015733
436 Ga0075367_10091859
437 Ga0075366_10000371
438 Ga0075366_10012341
439 Ga0075366_10073471
440 Ga0097621_100029352
441 Ga0097621_100077443
442 Ga0075370_10000981
443 Ga0075370_10083733
444 Ga0075370_10156135
445 Ga0068871_100116045
446 Ga0075428_100019136
447 Ga0075428_100058028
448 Ga0075428_100193500
449 Ga0075428_100347995
450 Ga0075428_100352223
451 Ga0075430_100085766
452 Ga0075431_100134082
453 Ga0075433_10014543
454 Ga0075433_10056555
455 Ga0075434_100138966
456 Ga0075429_100013400
457 Ga0075429_100013737
458 Ga0075429_100046599
459 Ga0075429_100246700
460 Ga0097620_100007262
461 Ga0097620_100034829
462 Ga0097620_100066462
463 Ga0097620_100072369
464 Ga0097620_100178367
465 Ga0075435_100009561
466 Ga0075435_100059412
467 Ga0105240_10001961
468 Ga0105240_10030252
469 Ga0105240_10167790
470 Ga0105240_10311477
471 Ga0111539_10004059
472 Ga0111539_10004849
473 Ga0111539_10020505
474 Ga0111539_10162943
475 Ga0111539_10213166
476 Ga0105245_10125404
477 Ga0105247_10011085
478 Ga0105247_10156674
479 Ga0114129_10005481
480 Ga0114129_10133643
481 Ga0114129_10138332
482 Ga0114129_10478340
483 Ga0114129_10480650
484 Ga0114129_10538232
485 Ga0105241_10017798
486 Ga0105242_10001238
487 Ga0105237_10002356
488 Ga0105237_10027745
489 Ga0105238_10004193
490 Ga0105238_10072500
491 Ga0105249_10059998
492 Ga0105249_10329320
493 Ga0105239_10131004
494 Ga0157370_10083551
495 Ga0157370_10183254
496 Ga0157369_10046829
497 Ga0157369_10396431
498 Ga0157374_10040212
499 Ga0157374_10048006
500 Ga0157378_10049705
501 Ga0163162_10130420
502 Ga0157372_10067017
503 Ga0157372_10145714
504 Ga0157375_10125645
505 Ga0163163_10111994
506 Ga0157380_10012226
507 Ga0157380_10013600
508 Ga0157380_10205058
509 Ga0157380_10307126
510 Ga0182008_10007230
511 Ga0157377_10023013
512 Ga0157379_10001547
513 Ga0157376_10076817
514 Ga0163161_10063509
515 Ga0163161_10065388
516 Ga0206356_11450685
517 Ga0206351_10218951
518 Ga0154015_1286750
519 Ga0213876_10111835
520 Ga0207697_10000380
521 Ga0207682_10001437
522 Ga0207682_10010441
523 Ga0207682_10032042
524 Ga0207688_10005082
525 Ga0207688_10065882
526 Ga0207680_10010075
527 Ga0207645_10031433
528 Ga0207643_10002289
529 Ga0207705_10015909
530 Ga0207654_10021223
531 Ga0207695_10002359
532 Ga0207695_10054784
533 Ga0207671_10016396
534 Ga0207663_10135756
535 Ga0207660_10179187
536 Ga0207681_10073272
537 Ga0207694_10066003
538 Ga0207650_10007824
539 Ga0207650_10096011
540 Ga0207650_10128087
541 Ga0207659_10018067
542 Ga0207659_10027485
543 Ga0207659_10083858
544 Ga0207659_10265589
545 Ga0207644_10132002
546 Ga0207706_10001124
547 Ga0207706_10119780
548 Ga0207706_10133861
549 Ga0207686_10003352
550 Ga0207670_10025395
551 Ga0207665_10034667
552 Ga0207691_10002188
553 Ga0207689_10034147
554 Ga0207689_10282698
555 Ga0207661_10000649
556 Ga0207661_10337623
557 Ga0207679_10019970
558 Ga0207679_10030382
559 Ga0207679_10031649
560 Ga0207667_10240413
561 Ga0207651_10166302
562 Ga0207651_10220074
563 Ga0207712_10022412
564 Ga0207658_10019625
565 Ga0207703_10015672
566 Ga0207703_10155936
567 Ga0207678_10105780
568 Ga0207678_10165039
569 Ga0207708_10010149
570 Ga0207708_10218455
571 Ga0207702_10038616
572 Ga0207641_10012884
573 Ga0207648_10103314
574 Ga0207674_10149661
575 Ga0207675_100006069
576 Ga0207675_100070754
577 Ga0207683_10005941
578 Ga0207683_10055992
579 Ga0207428_10008973
580 Ga0207428_10015897
581 Ga0207428_10049755
582 Ga0268266_10102619
583 Ga0268266_10103755
584 Ga0268265_10186331
585 Ga0307408_100016328
586 Ga0307408_100135570
587 Ga0307413_10015209
588 Ga0307413_10068377
589 Ga0307406_10062203
590 Ga0307407_10048766
591 Ga0307409_100046877
592 Ga0307416_100127553
593 Ga0307416_100295056
594 Ga0307411_10065743
595 Ga0307411_10223186
596 Ga0307415_100058239
597 Ga0307415_100072670
598 Ga0373939_0011096
599 Ga0373943_0024157
600 Ga0373931_0176340
601 Ga0395900_0036020
602 Ga0436364_0080805
603 Ga0436364_0846928
604 Ga0395901_0014778
605 Ga0436365_0740312
606 Ga0436365_0842797
607 Ga0436365_1357373
608 Ga0436363_1529099
609 Ga0439435_0010892
610 Ga0439435_0026467
611 Ga0439460_0016818
612 Ga0451577_0010654
613 Ga0466966_0048002
614 Ga0466961_0003486
615 Ga0466961_0005269
616 Ga0466961_0007697
617 Ga0466963_0001410
618 Ga0466963_0012932
619 Ga0466963_0058749
620 Ga0466963_0076564
621 Ga0466971_0000327
622 Ga0466957_0013433
623 Ga0466957_0028617
624 Ga0466959_0017796
625 Ga0466959_0069524
626 Ga0466959_0111969
627 Ga0451576_0015757
628 Ga0466958_0001996
629 Ga0466958_0004307
630 Ga0466967_0002686
631 Ga0466967_0006296
632 Ga0466967_0033272
633 Ga0495638_0030278
634 Ga0495580_0026560
635 Ga0495640_0125780
636 Ga0495668_0002068
637 Ga0495581_0035027
638 Ga0496104_0004164
639 Ga0496105_0248530
640 Ga0496108_0013895
641 Ga0496109_0009245
642 Ga0496109_0067995
643 Ga0496110_0003398
644 Ga0496110_0227264
645 Ga0496111_0013767
646 Ga0496112_0030017
647 Ga0496115_0070000
648 Ga0496119_0046550
649 Ga0496126_0067903
650 Ga0501299_002911
651 Ga0501303_002050
652 Ga0501032_0038043
653 Ga0501034_0006722
654 Ga0501034_0018362
655 Ga0501034_0133997
656 Ga0501034_0161818
657 Ga0501043_0103612
658 Ga0501047_0034244
659 Ga0501071_0051641
660 Ga0501071_0128863
661 Ga0501076_0010426
662 Ga0501079_0063386
663 Ga0501081_0095701
664 Ga0501035_0345839
665 Ga0501035_0362849
666 Ga0501045_0076256
667 nmdc:mga00v17_8484_c1
668 nmdc:mga0k408_6887_c1
669 nmdc:mga04h51_17361_c1
670 nmdc:mga07m45_17303_c1
671 nmdc:mga05p37_73511_c1
672 nmdc:mga09592_12631_c1
673 nmdc:mga09592_20093_c1
674 nmdc:mga09592_269787_c1
675 nmdc:mga09592_29462_c1
676 nmdc:mga06r32_294370_c1
677 nmdc:mga06r32_343357_c1
678 nmdc:mga08y16_200001_c1
679 nmdc:mga08y16_46401_c1
680 nmdc:mga08y16_5068_c1
681 nmdc:mga0n895_6868_c1
682 nmdc:mga0a205_11201_c1
683 nmdc:mga0a205_29917_c1
684 Ga0500641_0001989
685 Ga0500617_008749
686 Ga0500568_0000888
687 Ga0500616_0003063
688 Ga0590074_003002
689 Ga0587066_003644
690 Ga0587073_0001873
691 Ga0587080_001472
692 Ga0587088_004539
693 Ga0587075_000314
694 Ga0587079_002711
695 2644025924
696 2895882300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

242

329

0.89

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

71

203

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.9723 1 392
4cpd-assembly1.cif.gz_D alcohol dehydrogenase tadh from thermus sp. atn1 0.9672 1 391
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.9668 1 392
4cpd-assembly1.cif.gz_D alcohol dehydrogenase tadh from thermus sp. atn1 0.9588 1 391
4cpd-assembly2.cif.gz_B alcohol dehydrogenase tadh from thermus sp. atn1 0.956 1 391
ID Description Score Start End Superfamily
af_Q9P6I8_35_189_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9754 2 153 3.90.180.10
af_P77316_1_168_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9619 1 166 3.90.180.10
4cpdD01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9585 1 391 3.90.180.10
af_Q9P6I8_35_189_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9507 2 153 3.90.180.10
af_P77316_175_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9492 175 336 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N8NGZ3-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.991 1 96 GO:0008270
GO:0016491
AF-A0A2V7Y5U5-F1-model_v4 Glutathione-dependent formaldehyde dehydrogenase 0.9907 1 392 GO:0008270
GO:0016491
AF-M5EN42-F1-model_v4 Putative oxidoreductase, Zn-dependent and NAD(P)-binding 0.9884 1 109 GO:0008270
GO:0016491
AF-A0A2V7Y5U5-F1-model_v4 Glutathione-dependent formaldehyde dehydrogenase 0.988 1 392 GO:0008270
GO:0016491
AF-A0A4P0YN91-F1-model_v4 deleted 0.9855 1 97

Map