F417408

General Info

Members Datasets Scaffolds Average Seq Length
348 189 348 191

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100302248|Ga0068868_1003022482
Length 219
Sequence MQVSMSRSSYIAINRDLATNGLMWHNNRMIAHVSGIVAEKFANSIIVDVHDVGYEVQVAAGDFDRALLGEPIKFYTYHHIREQSQELFGFSSLAAKKLFELLITVQGVGPKAALSILSLGDSEAVRNAIASSDSGFVAKASGVGKKIAERVVVDLSDKVGLAVTVAHASGINSAPVGDEALEALMALGYTLNDALVALENVPTDLPTAERVTRALKGEQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
58 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
59 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
60 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
61 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
101 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
102 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
103 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
104 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
105 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
106 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
125 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
128 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
129 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
130 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
170 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
180 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
184 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
185 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
186 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
189 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.71
Nodule 0
Rhizoplane 0.57
Rhizosphere 72.41
Stem 0
Stem Tuber 0
Unclassified 2.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10507933 2162886012 Unclassified 3487
2 MBSR1b_contig_7200070 2162886012 Unclassified 3487
3 JGI24741J21665_1001092 3300001915 Bacteria 8098
4 JGI24741J21665_1001469 3300001915 Bacteria 6740
5 JGI24740J21852_10011481 3300001979 Bacteria 3370
6 JGI24740J21852_10056052 3300001979 Unclassified 1106
7 JGI24740J21852_10063682 3300001979 Bacteria 1009
8 JGI24740J21852_10099218 3300001979 Bacteria 743
9 JGI24739J22299_10015440 3300001989 Bacteria 2775
10 JGI24739J22299_10127525 3300001989 Bacteria 758
11 JGI24739J22299_10127634 3300001989 Bacteria 758
12 JGI24737J22298_10000043 3300001990 Bacteria 36744
13 JGI24735J21928_10000104 3300002067 Bacteria 31029
14 JGI24738J21930_10003324 3300002075 Bacteria 4083
15 JGI25406J46586_10088143 3300003203 Bacteria 940
16 rootH1_10009329 3300003316 Bacteria 46993
17 rootH2_10006821 3300003320 Bacteria 94080
18 rootL2_10130502 3300003322 Bacteria 5917
19 rootL2_10385764 3300003322 Bacteria 1228
20 rootH1_10012137 3300003323 Bacteria 62005
21 Ga0065715_10000425 3300005293 Bacteria 14903
22 Ga0070658_10000009 3300005327 Bacteria 319868
23 Ga0070683_100001184 3300005329 Bacteria 19791
24 Ga0070683_100039684 3300005329 Bacteria 4324
25 Ga0070683_100114120 3300005329 Unclassified 2550
26 Ga0070680_100057164 3300005336 Bacteria 3189
27 Ga0068868_100302248 3300005338 Bacteria 1359
28 Ga0070660_100000386 3300005339 Bacteria 29414
29 Ga0070660_100010369 3300005339 Bacteria 6585
30 Ga0070660_100244915 3300005339 Unclassified 1461
31 Ga0070661_100030372 3300005344 Bacteria 3903
32 Ga0070675_100635788 3300005354 Bacteria 969
33 Ga0070671_100008117 3300005355 Bacteria 8408
34 Ga0070659_100017295 3300005366 Bacteria 5422
35 Ga0070659_100058289 3300005366 Viruses 3047
36 Ga0070714_100000084 3300005435 Bacteria 80459
37 Ga0070711_100389081 3300005439 Bacteria 1129
38 Ga0070662_100006047 3300005457 Bacteria 7770
39 Ga0070681_10504283 3300005458 Bacteria 1123
40 Ga0070679_100001264 3300005530 Bacteria 22307
41 Ga0070684_100048853 3300005535 Bacteria 3671
42 Ga0068855_100000001 3300005563 Bacteria 818777
43 Ga0068855_100000002 3300005563 Bacteria 616881
44 Ga0068855_100000005 3300005563 Bacteria 337711
45 Ga0068855_100003115 3300005563 Bacteria 20288
46 Ga0068855_100013488 3300005563 Bacteria 9853
47 Ga0070664_100000721 3300005564 Bacteria 25354
48 Ga0070664_100188704 3300005564 Bacteria 1836
49 Ga0070664_100523745 3300005564 Bacteria 1094
50 Ga0068857_100000057 3300005577 Bacteria 62388
51 Ga0068857_100000066 3300005577 Bacteria 59014
52 Ga0068857_100087535 3300005577 Bacteria 2786
53 Ga0068857_100562394 3300005577 Unclassified 1075
54 Ga0068854_100037167 3300005578 Viruses 3416
55 Ga0068856_100000029 3300005614 Bacteria 130205
56 Ga0068856_100000122 3300005614 Bacteria 78134
57 Ga0068856_100006051 3300005614 Bacteria 11890
58 Ga0068856_100225971 3300005614 Bacteria 1887
59 Ga0068852_100000001 3300005616 Bacteria 716526
60 Ga0068852_100000011 3300005616 Bacteria 141147
61 Ga0068852_100250943 3300005616 Bacteria 1695
62 Ga0081455_10000001 3300005937 Bacteria 603871
63 Ga0081539_10022623 3300005985 Bacteria 4150
64 Ga0075365_10000018 3300006038 Bacteria 66628
65 Ga0075365_10023699 3300006038 Bacteria 3863
66 Ga0075365_10039684 3300006038 Bacteria 3067
67 Ga0075365_10043914 3300006038 Bacteria 2927
68 Ga0075365_10144734 3300006038 Bacteria 1651
69 Ga0075365_10259290 3300006038 Bacteria 1222
70 Ga0075365_10374654 3300006038 Bacteria 1004
71 Ga0075365_10655172 3300006038 Unclassified 742
72 Ga0075368_10000058 3300006042 Bacteria 26490
73 Ga0075368_10112093 3300006042 Unclassified 1125
74 Ga0075368_10219082 3300006042 Bacteria 808
75 Ga0075363_100003665 3300006048 Bacteria 6597
76 Ga0075364_10000818 3300006051 Bacteria 16408
77 Ga0075364_10005917 3300006051 Bacteria 7149
78 Ga0075364_10043175 3300006051 Bacteria 2931
79 Ga0075364_10141198 3300006051 Bacteria 1620
80 Ga0075364_10291159 3300006051 Unclassified 1111
81 Ga0075362_10014312 3300006177 Bacteria 3198
82 Ga0075367_10001193 3300006178 Bacteria 10923
83 Ga0075367_10044491 3300006178 Bacteria 2603
84 Ga0075369_10000871 3300006186 Bacteria 9999
85 Ga0075369_10019149 3300006186 Unclassified 2793
86 Ga0075369_10022045 3300006186 Unclassified 2625
87 Ga0075366_10000400 3300006195 Bacteria 20198
88 Ga0075366_10000695 3300006195 Bacteria 15902
89 Ga0075366_10006952 3300006195 Bacteria 6231
90 Ga0075366_10044423 3300006195 Bacteria 2633
91 Ga0075366_10162088 3300006195 Bacteria 1355
92 Ga0097621_100000001 3300006237 Bacteria 632268
93 Ga0075370_10003047 3300006353 Bacteria 7899
94 Ga0075370_10087207 3300006353 Bacteria 1798
95 Ga0075370_10091721 3300006353 Bacteria 1753
96 Ga0075370_10390809 3300006353 Unclassified 834
97 Ga0068871_100000008 3300006358 Bacteria 115827
98 Ga0068871_100039218 3300006358 Bacteria 3789
99 Ga0068865_100007409 3300006881 Bacteria 6752
100 Ga0105240_10000030 3300009093 Bacteria 321312
101 Ga0105240_10000048 3300009093 Bacteria 237451
102 Ga0105240_10000554 3300009093 Bacteria 69214
103 Ga0105240_10002029 3300009093 Bacteria 33399
104 Ga0105240_10031183 3300009093 Bacteria 6917
105 Ga0105245_10372295 3300009098 Unclassified 1420
106 Ga0105245_10471418 3300009098 Unclassified 1267
107 Ga0105247_10168741 3300009101 Unclassified 1454
108 Ga0105241_10000737 3300009174 Bacteria 24848
109 Ga0105241_10004048 3300009174 Bacteria 10851
110 Ga0105241_10029038 3300009174 Bacteria 4122
111 Ga0105241_10075878 3300009174 Bacteria 2620
112 Ga0105241_10101953 3300009174 Bacteria 2283
113 Ga0105242_10058748 3300009176 Unclassified 3154
114 Ga0105248_10136330 3300009177 Bacteria 2769
115 Ga0105237_10000001 3300009545 Bacteria 1009213
116 Ga0105237_10000002 3300009545 Bacteria 702357
117 Ga0105238_10006442 3300009551 Bacteria 11675
118 Ga0105032_100002 3300009979 Bacteria 303884
119 Ga0105032_100013 3300009979 Bacteria 60280
120 Ga0105032_105146 3300009979 Bacteria 1102
121 Ga0105029_100236 3300009984 Bacteria 2822
122 Ga0105033_100276 3300009986 Bacteria 4058
123 Ga0105030_106202 3300009987 Bacteria 1015
124 Ga0105028_100559 3300009993 Bacteria 3989
125 Ga0105239_10001282 3300010375 Bacteria 33954
126 Ga0105239_10001890 3300010375 Bacteria 27386
127 Ga0105246_10000260 3300011119 Bacteria 27386
128 Ga0105246_10058960 3300011119 Bacteria 2661
129 Ga0105246_10267821 3300011119 Bacteria 1364
130 Ga0157373_10000302 3300013100 Bacteria 39962
131 Ga0157373_10008975 3300013100 Bacteria 7397
132 Ga0157373_10013613 3300013100 Bacteria 5968
133 Ga0157373_10032976 3300013100 Bacteria 3728
134 Ga0157370_10000866 3300013104 Bacteria 38387
135 Ga0157370_10001378 3300013104 Bacteria 30046
136 Ga0157370_10043626 3300013104 Bacteria 4314
137 Ga0157370_10449946 3300013104 Bacteria 1184
138 Ga0157370_10724380 3300013104 Unclassified 907
139 Ga0157370_11295129 3300013104 Bacteria 657
140 Ga0157369_10000003 3300013105 Bacteria 507337
141 Ga0157369_10000026 3300013105 Bacteria 216023
142 Ga0157369_10000055 3300013105 Bacteria 161739
143 Ga0157369_10000634 3300013105 Bacteria 45464
144 Ga0157369_10025629 3300013105 Bacteria 6544
145 Ga0157369_10027265 3300013105 Bacteria 6334
146 Ga0157369_10350913 3300013105 Bacteria 1532
147 Ga0157374_10043480 3300013296 Bacteria 4151
148 Ga0157374_10175604 3300013296 Bacteria 2091
149 Ga0157372_10000007 3300013307 Bacteria 340690
150 Ga0157372_10000106 3300013307 Bacteria 87935
151 Ga0157372_10082985 3300013307 Bacteria 3630
152 Ga0157372_10126242 3300013307 Bacteria 2942
153 Ga0157372_11414394 3300013307 Bacteria 802
154 Ga0157372_11706147 3300013307 Bacteria 725
155 Ga0157514_113973 3300013874 Bacteria 721
156 Ga0157377_10000373 3300014745 Bacteria 19998
157 Ga0157376_10000085 3300014969 Bacteria 70910
158 Ga0157376_10007264 3300014969 Bacteria 7891
159 Ga0207647_10001626 3300025904 Bacteria 17272
160 Ga0207705_10000010 3300025909 Bacteria 518023
161 Ga0207654_10000474 3300025911 Bacteria 22982
162 Ga0207654_10003395 3300025911 Bacteria 8048
163 Ga0207654_10197673 3300025911 Bacteria 1322
164 Ga0207654_10455637 3300025911 Bacteria 897
165 Ga0207695_10000009 3300025913 Bacteria 1034276
166 Ga0207695_10000985 3300025913 Bacteria 50515
167 Ga0207695_10001111 3300025913 Bacteria 46810
168 Ga0207695_10016819 3300025913 Bacteria 8539
169 Ga0207671_10000003 3300025914 Bacteria 1065461
170 Ga0207671_10000008 3300025914 Bacteria 798229
171 Ga0207657_10000251 3300025919 Bacteria 57216
172 Ga0207657_10021394 3300025919 Bacteria 6088
173 Ga0207652_10002314 3300025921 Bacteria 16145
174 Ga0207694_10036352 3300025924 Unclassified 3780
175 Ga0207659_10151947 3300025926 Bacteria 1809
176 Ga0207664_10019167 3300025929 Bacteria 5051
177 Ga0207690_10013421 3300025932 Bacteria 4923
178 Ga0207690_10028773 3300025932 Unclassified 3525
179 Ga0207706_10000004 3300025933 Bacteria 280765
180 Ga0207704_10003921 3300025938 Bacteria 6764
181 Ga0207711_10233209 3300025941 Unclassified 1686
182 Ga0207661_10003956 3300025944 Bacteria 10347
183 Ga0207661_10026859 3300025944 Bacteria 4392
184 Ga0207679_10000074 3300025945 Bacteria 89341
185 Ga0207679_10490588 3300025945 Bacteria 1095
186 Ga0207667_10000005 3300025949 Bacteria 715503
187 Ga0207667_10000027 3300025949 Bacteria 337700
188 Ga0207667_10003596 3300025949 Bacteria 19136
189 Ga0207640_10028159 3300025981 Unclassified 3432
190 Ga0207702_10000051 3300026078 Bacteria 139040
191 Ga0207702_10000431 3300026078 Bacteria 47962
192 Ga0207702_10007531 3300026078 Bacteria 9282
193 Ga0207702_10318795 3300026078 Bacteria 1480
194 Ga0207674_10000032 3300026116 Bacteria 142389
195 Ga0207674_10000299 3300026116 Bacteria 62812
196 Ga0207674_10096183 3300026116 Bacteria 2947
197 Ga0207698_10000001 3300026142 Bacteria 625389
198 Ga0207698_10000024 3300026142 Bacteria 123946
199 Ga0207698_10243107 3300026142 Bacteria 1642
200 Ga0209813_10000732 3300027866 Bacteria 7475
201 Ga0209813_10053033 3300027866 Bacteria 1273
202 Ga0265337_1000643 3300028556 Bacteria 18479
203 Ga0265337_1006064 3300028556 Unclassified 4710
204 Ga0265326_10003441 3300028558 Bacteria 5177
205 Ga0265326_10117527 3300028558 Unclassified 756
206 Ga0265334_10000004 3300028573 Bacteria 243436
207 Ga0265334_10003364 3300028573 Bacteria 7293
208 Ga0265323_10010797 3300028653 Archaea 3697
209 Ga0265336_10004957 3300028666 Bacteria 4965
210 Ga0265338_10000003 3300028800 Bacteria 733923
211 Ga0265338_10063454 3300028800 Unclassified 3221
212 Ga0314311_1098846 3300030733 Bacteria 1113
213 Ga0314311_1211405 3300030733 Bacteria 2914
214 Ga0316179_1097059 3300030734 Bacteria 15011
215 Ga0316178_1151194 3300030735 Bacteria 2216
216 Ga0316180_1166974 3300030736 Bacteria 2355
217 Ga0316183_1006123 3300030742 Bacteria 1358
218 Ga0316183_1025503 3300030742 Bacteria 20028
219 Ga0316183_1035098 3300030742 Bacteria 17152
220 Ga0316183_1037189 3300030742 Unclassified 1825
221 Ga0316183_1078625 3300030742 Bacteria 10974
222 Ga0316183_1121630 3300030742 Bacteria 1216
223 Ga0316181_1004960 3300030744 Unclassified 1336
224 Ga0316181_1116978 3300030744 Bacteria 53317
225 Ga0316181_1284439 3300030744 Unclassified 1138
226 Ga0316182_1038280 3300030745 Bacteria 21015
227 Ga0316182_1110912 3300030745 Bacteria 16963
228 Ga0316182_1317116 3300030745 Bacteria 2843
229 Ga0316182_1426736 3300030745 Unclassified 1361
230 Ga0265330_10012413 3300031235 Archaea 3984
231 Ga0265332_10003894 3300031238 Bacteria 7122
232 Ga0265328_10008863 3300031239 Bacteria 4126
233 Ga0265325_10010620 3300031241 Bacteria 5322
234 Ga0265329_10082742 3300031242 Unclassified 1016
235 Ga0265327_10046792 3300031251 Bacteria 2286
236 Ga0265327_10127382 3300031251 Unclassified 1201
237 Ga0265316_10451119 3300031344 Unclassified 922
238 Ga0265313_10007743 3300031595 Bacteria 7269
239 Ga0265342_10027634 3300031712 Archaea 3541
240 Ga0307516_10392816 3300031730 Bacteria 1047
241 Ga0307406_10000001 3300031901 Bacteria 638191
242 Ga0307406_10000396 3300031901 Bacteria 25166
243 Ga0307414_10382888 3300032004 Bacteria 1217
244 Ga0307414_10834614 3300032004 Bacteria 842
245 Ga0395899_0025992 3300037312 Bacteria 4418
246 Ga0395899_0052946 3300037312 Unclassified 3007
247 Ga0395900_0000001 3300037418 Bacteria 931146
248 Ga0395900_0022143 3300037418 Bacteria 6501
249 Ga0395898_0000002 3300037466 Bacteria 931013
250 Ga0395901_0000006 3300038443 Bacteria 514112
251 Ga0395901_0171456 3300038443 Bacteria 2277
252 Ga0395901_0579003 3300038443 Bacteria 1134
253 Ga0439461_0002023 3300041410 Unclassified 3205
254 Ga0439461_0069761 3300041410 Unclassified 812
255 Ga0439466_0050697 3300041411 Bacteria 1361
256 Ga0439445_0001738 3300042004 Unclassified 4800
257 Ga0439432_029366 3300042006 Bacteria 1788
258 Ga0439452_063765 3300042010 Unclassified 821
259 Ga0439463_124237 3300042016 Bacteria 667
260 Ga0450923_012587 3300042125 Bacteria 1542
261 Ga0450906_010744 3300042145 Bacteria 1724
262 Ga0439446_0000003 3300042156 Bacteria 158513
263 Ga0450909_015980 3300042185 Bacteria 1108
264 Ga0439434_0002961 3300042435 Bacteria 4966
265 Ga0439434_0004342 3300042435 Bacteria 4147
266 Ga0439464_0000047 3300042439 Bacteria 16001
267 Ga0450918_000162 3300042531 Bacteria 14905
268 Ga0466965_0000084 3300044683 Bacteria 27012
269 Ga0466970_0068416 3300044765 Bacteria 1908
270 Ga0451576_0163399 3300045051 Unclassified 2323
271 Ga0495638_0000061 3300046460 Bacteria 188551
272 Ga0495638_0000167 3300046460 Bacteria 102139
273 Ga0495582_0095730 3300046473 Unclassified 1659
274 Ga0495597_0073459 3300046542 Bacteria 1470
275 Ga0495622_0000008 3300046557 Bacteria 232461
276 Ga0495634_0103333 3300046642 Unclassified 1839
277 Ga0495658_0002026 3300046683 Bacteria 10311
278 Ga0495671_0075255 3300046692 Bacteria 1656
279 Ga0495600_0026449 3300046809 Unclassified 3744
280 Ga0495660_0000005 3300046810 Bacteria 574567
281 Ga0495672_0000010 3300047320 Bacteria 545038
282 Ga0495672_0110439 3300047320 Bacteria 1477
283 Ga0495686_0018697 3300047472 Viruses 4642
284 Ga0495602_0134343 3300048088 Unclassified 1968
285 Ga0496112_0224518 3300048915 Bacteria 1834
286 Ga0496115_0000001 3300048918 Bacteria 367230
287 Ga0496124_0072087 3300048927 Unclassified 2861
288 Ga0496126_0150156 3300048929 Bacteria 1998
289 Ga0501034_0000028 3300049571 Bacteria 255803
290 Ga0501034_0001066 3300049571 Bacteria 38868
291 Ga0501034_1029809 3300049571 Bacteria 706
292 Ga0501037_0000001 3300049573 Bacteria 753276
293 Ga0501038_0119039 3300049574 Bacteria 2180
294 Ga0501043_0272527 3300049579 Bacteria 1299
295 Ga0501080_0354049 3300049742 Unclassified 1325
296 Ga0501276_000199 3300049773 Bacteria 3315
297 nmdc:mga03683_13805_c1 3300050489 Bacteria 2978
298 nmdc:mga03n38_70538_c1 3300050490 Bacteria 1616
299 nmdc:mga00v17_143_c1 3300050491 Bacteria 41277
300 nmdc:mga00v17_260018_c1 3300050491 Unclassified 1126
301 nmdc:mga00v17_429761_c1 3300050491 Unclassified 858
302 nmdc:mga00v17_9746_c1 3300050491 Bacteria 5214
303 nmdc:mga0yw44_120261_c1 3300050492 Unclassified 1691
304 nmdc:mga0yw44_14_c1 3300050492 Bacteria 86738
305 nmdc:mga0yw44_342826_c1 3300050492 Bacteria 1005
306 nmdc:mga0yw44_41530_c1 3300050492 Bacteria 2738
307 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
308 nmdc:mga0yw44_50_c1 3300050492 Bacteria 40560
309 nmdc:mga0k408_104049_c2 3300050493 Bacteria 1249
310 nmdc:mga0k408_164_c1 3300050493 Bacteria 20604
311 nmdc:mga0k408_6447_c1 3300050493 Bacteria 6258
312 nmdc:mga0k408_752_c1 3300050493 Bacteria 17811
313 nmdc:mga06z11_4644_c1 3300050494 Bacteria 5418
314 nmdc:mga07m45_118408_c1 3300050496 Bacteria 1529
315 nmdc:mga07m45_287083_c1 3300050496 Bacteria 957
316 nmdc:mga07m45_403972_c1 3300050496 Unclassified 793
317 nmdc:mga07m45_440583_c1 3300050496 Bacteria 756
318 nmdc:mga07m45_71062_c1 3300050496 Bacteria 1980
319 nmdc:mga0sz30_19448_c1 3300050516 Unclassified 2731
320 nmdc:mga0sz30_39538_c1 3300050516 Bacteria 1979
321 nmdc:mga0sz30_8622_c1 3300050516 Bacteria 3348
322 Ga0500643_000193 3300053087 Bacteria 58059
323 Ga0500643_001796 3300053087 Bacteria 11763
324 Ga0500643_016352 3300053087 Bacteria 2515
325 Ga0500644_0015649 3300053088 Bacteria 2168
326 Ga0500646_0000005 3300053090 Bacteria 130895
327 Ga0500583_0003262 3300053092 Bacteria 5065
328 Ga0500651_0000025 3300053093 Bacteria 123745
329 Ga0500566_0000001 3300053094 Bacteria 1101031
330 Ga0500641_0000001 3300053096 Bacteria 1115973
331 Ga0500650_0121565 3300053098 Bacteria 1217
332 Ga0500555_000009 3300053103 Bacteria 263998
333 Ga0500556_0009150 3300053104 Unclassified 2872
334 Ga0500562_000002 3300053108 Bacteria 977234
335 Ga0500569_000001 3300053109 Bacteria 137852
336 Ga0500594_0000011 3300053118 Bacteria 87409
337 Ga0500614_026480 3300053123 Unclassified 1386
338 Ga0500652_000001 3300053131 Bacteria 946868
339 Ga0500655_000483 3300053133 Bacteria 8070
340 Ga0500577_0019057 3300053142 Bacteria 2218
341 Ga0500577_0022767 3300053142 Unclassified 2083
342 Ga0500577_0033146 3300053142 Bacteria 1823
343 Ga0500588_0000026 3300053146 Bacteria 35169
344 Ga0500616_0000012 3300053153 Bacteria 681798
345 Ga0500616_0033436 3300053153 Bacteria 2806
346 Ga0500616_0257012 3300053153 Unclassified 743
347 Ga0500620_039568 3300053155 Bacteria 1540
348 Ga0500570_000274 3300053724 Bacteria 17800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0110439 Ga0495672_0110439_290_871 162
2 3300053104 Ga0500556_0009150 Ga0500556_0009150_557_1150 172
3 3300041410 Ga0439461_0069761 Ga0439461_0069761_132_710 175
4 3300041411 Ga0439466_0050697 Ga0439466_0050697_512_1090 175
5 3300042006 Ga0439432_029366 Ga0439432_029366_92_670 175
6 3300042010 Ga0439452_063765 Ga0439452_063765_137_715 175
7 3300042125 Ga0450923_012587 Ga0450923_012587_635_1213 175
8 3300042435 Ga0439434_0004342 Ga0439434_0004342_504_1082 175
9 3300009174 Ga0105241_10000737 Ga0105241_100007375 177
10 3300025911 Ga0207654_10000474 Ga0207654_100004743 177
11 3300009093 Ga0105240_10031183 Ga0105240_100311836 178
12 3300006038 Ga0075365_10144734 Ga0075365_101447342 181
13 3300045051 Ga0451576_0163399 Ga0451576_0163399_1009_1590 182
14 3300013307 Ga0157372_10000106 Ga0157372_1000010621 184
15 3300006186 Ga0075369_10022045 Ga0075369_100220452 185
16 3300028800 Ga0265338_10063454 Ga0265338_100634544 185
17 3300050516 nmdc:mga0sz30_19448_c1 nmdc:mga0sz30_19448_c1_497_1063 185
18 3300005329 Ga0070683_100114120 Ga0070683_1001141203 186
19 3300028556 Ga0265337_1000643 Ga0265337_10006432 186
20 3300028556 Ga0265337_1006064 Ga0265337_10060645 186
21 3300028558 Ga0265326_10003441 Ga0265326_100034417 186
22 3300028573 Ga0265334_10000004 Ga0265334_10000004203 186
23 3300028573 Ga0265334_10003364 Ga0265334_100033643 186
24 3300028653 Ga0265323_10010797 Ga0265323_100107975 186
25 3300028666 Ga0265336_10004957 Ga0265336_100049577 186
26 3300028800 Ga0265338_10000003 Ga0265338_10000003176 186
27 3300031235 Ga0265330_10012413 Ga0265330_100124135 186
28 3300031238 Ga0265332_10003894 Ga0265332_100038943 186
29 3300031239 Ga0265328_10008863 Ga0265328_100088632 186
30 3300031241 Ga0265325_10010620 Ga0265325_100106203 186
31 3300031242 Ga0265329_10082742 Ga0265329_100827422 186
32 3300031251 Ga0265327_10127382 Ga0265327_101273822 186
33 3300031595 Ga0265313_10007743 Ga0265313_100077434 186
34 3300031712 Ga0265342_10027634 Ga0265342_100276345 186
35 3300003203 JGI25406J46586_10088143 JGI25406J46586_100881432 187
36 3300005336 Ga0070680_100057164 Ga0070680_1000571643 187
37 3300005435 Ga0070714_100000084 Ga0070714_10000008462 187
38 3300005439 Ga0070711_100389081 Ga0070711_1003890812 187
39 3300005458 Ga0070681_10504283 Ga0070681_105042831 187
40 3300005530 Ga0070679_100001264 Ga0070679_10000126412 187
41 3300005985 Ga0081539_10022623 Ga0081539_100226235 187
42 3300009093 Ga0105240_10000048 Ga0105240_10000048153 187
43 3300009098 Ga0105245_10471418 Ga0105245_104714182 187
44 3300009176 Ga0105242_10058748 Ga0105242_100587483 187
45 3300025913 Ga0207695_10000985 Ga0207695_100009852 187
46 3300025921 Ga0207652_10002314 Ga0207652_1000231419 187
47 3300025929 Ga0207664_10019167 Ga0207664_100191672 187
48 3300031344 Ga0265316_10451119 Ga0265316_104511192 187
49 3300001915 JGI24741J21665_1001092 JGI24741J21665_10010927 188
50 3300001915 JGI24741J21665_1001469 JGI24741J21665_10014694 188
51 3300001979 JGI24740J21852_10056052 JGI24740J21852_100560522 188
52 3300003316 rootH1_10009329 rootH1_1000932911 188
53 3300005329 Ga0070683_100001184 Ga0070683_1000011845 188
54 3300005355 Ga0070671_100008117 Ga0070671_1000081175 188
55 3300005563 Ga0068855_100000001 Ga0068855_100000001570 188
56 3300005563 Ga0068855_100013488 Ga0068855_10001348811 188
57 3300005577 Ga0068857_100562394 Ga0068857_1005623941 188
58 3300005614 Ga0068856_100006051 Ga0068856_10000605113 188
59 3300006038 Ga0075365_10023699 Ga0075365_100236994 188
60 3300006038 Ga0075365_10039684 Ga0075365_100396842 188
61 3300006038 Ga0075365_10043914 Ga0075365_100439141 188
62 3300006038 Ga0075365_10259290 Ga0075365_102592902 188
63 3300006042 Ga0075368_10112093 Ga0075368_101120932 188
64 3300006051 Ga0075364_10043175 Ga0075364_100431754 188
65 3300006186 Ga0075369_10019149 Ga0075369_100191494 188
66 3300006195 Ga0075366_10000695 Ga0075366_100006957 188
67 3300006195 Ga0075366_10162088 Ga0075366_101620882 188
68 3300009093 Ga0105240_10002029 Ga0105240_1000202923 188
69 3300009174 Ga0105241_10029038 Ga0105241_100290385 188
70 3300009986 Ga0105033_100276 Ga0105033_1002762 188
71 3300010375 Ga0105239_10001890 Ga0105239_100018909 188
72 3300013100 Ga0157373_10000302 Ga0157373_100003023 188
73 3300025913 Ga0207695_10016819 Ga0207695_100168192 188
74 3300025944 Ga0207661_10003956 Ga0207661_100039568 188
75 3300026078 Ga0207702_10007531 Ga0207702_100075315 188
76 3300028558 Ga0265326_10117527 Ga0265326_101175271 188
77 3300031251 Ga0265327_10046792 Ga0265327_100467924 188
78 3300037418 Ga0395900_0022143 Ga0395900_0022143_2875_3453 188
79 3300038443 Ga0395901_0579003 Ga0395901_0579003_18_593 188
80 3300046460 Ga0495638_0000167 Ga0495638_0000167_32862_33434 188
81 3300046473 Ga0495582_0095730 Ga0495582_0095730_369_947 188
82 3300046557 Ga0495622_0000008 Ga0495622_0000008_38365_38943 188
83 3300046642 Ga0495634_0103333 Ga0495634_0103333_549_1127 188
84 3300046683 Ga0495658_0002026 Ga0495658_0002026_2927_3505 188
85 3300046809 Ga0495600_0026449 Ga0495600_0026449_2756_3334 188
86 3300047320 Ga0495672_0000010 Ga0495672_0000010_194193_194777 188
87 3300048088 Ga0495602_0134343 Ga0495602_0134343_662_1240 188
88 3300048915 Ga0496112_0224518 Ga0496112_0224518_681_1265 188
89 3300048929 Ga0496126_0150156 Ga0496126_0150156_260_838 188
90 3300049773 Ga0501276_000199 Ga0501276_000199_1381_1962 188
91 3300050491 nmdc:mga00v17_429761_c1 nmdc:mga00v17_429761_c1_95_676 188
92 3300050492 nmdc:mga0yw44_120261_c1 nmdc:mga0yw44_120261_c1_785_1366 188
93 3300050492 nmdc:mga0yw44_41530_c1 nmdc:mga0yw44_41530_c1_762_1343 188
94 3300050493 nmdc:mga0k408_164_c1 nmdc:mga0k408_164_c1_4410_4991 188
95 3300053087 Ga0500643_000193 Ga0500643_000193_40698_41282 188
96 3300053094 Ga0500566_0000001 Ga0500566_0000001_254487_255065 188
97 3300053108 Ga0500562_000002 Ga0500562_000002_523684_524262 188
98 3300053123 Ga0500614_026480 Ga0500614_026480_756_1334 188
99 2162886012 MBSR1b_contig_10507933 MBSR1b_0671.00007590 189
100 2162886012 MBSR1b_contig_7200070 MBSR1b_0434.00002560 189
101 3300001979 JGI24740J21852_10011481 JGI24740J21852_100114811 189
102 3300001979 JGI24740J21852_10063682 JGI24740J21852_100636821 189
103 3300001979 JGI24740J21852_10099218 JGI24740J21852_100992182 189
104 3300001989 JGI24739J22299_10015440 JGI24739J22299_100154404 189
105 3300001989 JGI24739J22299_10127525 JGI24739J22299_101275251 189
106 3300001989 JGI24739J22299_10127634 JGI24739J22299_101276341 189
107 3300001990 JGI24737J22298_10000043 JGI24737J22298_1000004344 189
108 3300002067 JGI24735J21928_10000104 JGI24735J21928_100001044 189
109 3300002075 JGI24738J21930_10003324 JGI24738J21930_100033242 189
110 3300003320 rootH2_10006821 rootH2_1000682150 189
111 3300003322 rootL2_10130502 rootL2_101305024 189
112 3300003322 rootL2_10385764 rootL2_103857642 189
113 3300003323 rootH1_10012137 rootH1_1001213737 189
114 3300005293 Ga0065715_10000425 Ga0065715_100004257 189
115 3300005327 Ga0070658_10000009 Ga0070658_1000000946 189
116 3300005329 Ga0070683_100039684 Ga0070683_1000396842 189
117 3300005338 Ga0068868_100302248 Ga0068868_1003022482 189
118 3300005339 Ga0070660_100000386 Ga0070660_10000038627 189
119 3300005339 Ga0070660_100010369 Ga0070660_1000103692 189
120 3300005339 Ga0070660_100244915 Ga0070660_1002449152 189
121 3300005344 Ga0070661_100030372 Ga0070661_1000303725 189
122 3300005354 Ga0070675_100635788 Ga0070675_1006357882 189
123 3300005366 Ga0070659_100017295 Ga0070659_1000172953 189
124 3300005366 Ga0070659_100058289 Ga0070659_1000582892 189
125 3300005457 Ga0070662_100006047 Ga0070662_1000060478 189
126 3300005535 Ga0070684_100048853 Ga0070684_1000488532 189
127 3300005563 Ga0068855_100000002 Ga0068855_100000002461 189
128 3300005563 Ga0068855_100000005 Ga0068855_100000005161 189
129 3300005563 Ga0068855_100003115 Ga0068855_10000311514 189
130 3300005564 Ga0070664_100000721 Ga0070664_10000072121 189
131 3300005564 Ga0070664_100188704 Ga0070664_1001887042 189
132 3300005564 Ga0070664_100523745 Ga0070664_1005237452 189
133 3300005577 Ga0068857_100000057 Ga0068857_10000005723 189
134 3300005577 Ga0068857_100000066 Ga0068857_10000006612 189
135 3300005577 Ga0068857_100087535 Ga0068857_1000875352 189
136 3300005578 Ga0068854_100037167 Ga0068854_1000371672 189
137 3300005614 Ga0068856_100000029 Ga0068856_100000029120 189
138 3300005614 Ga0068856_100000122 Ga0068856_10000012277 189
139 3300005614 Ga0068856_100225971 Ga0068856_1002259712 189
140 3300005616 Ga0068852_100000001 Ga0068852_100000001314 189
141 3300005616 Ga0068852_100000011 Ga0068852_10000001171 189
142 3300005616 Ga0068852_100250943 Ga0068852_1002509432 189
143 3300005937 Ga0081455_10000001 Ga0081455_10000001538 189
144 3300006038 Ga0075365_10000018 Ga0075365_1000001881 189
145 3300006038 Ga0075365_10374654 Ga0075365_103746542 189
146 3300006038 Ga0075365_10655172 Ga0075365_106551722 189
147 3300006042 Ga0075368_10000058 Ga0075368_1000005832 189
148 3300006042 Ga0075368_10219082 Ga0075368_102190822 189
149 3300006048 Ga0075363_100003665 Ga0075363_1000036658 189
150 3300006051 Ga0075364_10000818 Ga0075364_1000081819 189
151 3300006051 Ga0075364_10005917 Ga0075364_100059177 189
152 3300006051 Ga0075364_10141198 Ga0075364_101411982 189
153 3300006051 Ga0075364_10291159 Ga0075364_102911592 189
154 3300006177 Ga0075362_10014312 Ga0075362_100143123 189
155 3300006178 Ga0075367_10001193 Ga0075367_100011935 189
156 3300006178 Ga0075367_10044491 Ga0075367_100444914 189
157 3300006186 Ga0075369_10000871 Ga0075369_100008712 189
158 3300006195 Ga0075366_10000400 Ga0075366_1000040022 189
159 3300006195 Ga0075366_10006952 Ga0075366_100069522 189
160 3300006195 Ga0075366_10044423 Ga0075366_100444232 189
161 3300006237 Ga0097621_100000001 Ga0097621_100000001434 189
162 3300006353 Ga0075370_10003047 Ga0075370_100030477 189
163 3300006353 Ga0075370_10087207 Ga0075370_100872072 189
164 3300006353 Ga0075370_10091721 Ga0075370_100917212 189
165 3300006353 Ga0075370_10390809 Ga0075370_103908092 189
166 3300006358 Ga0068871_100000008 Ga0068871_10000000890 189
167 3300006358 Ga0068871_100039218 Ga0068871_1000392182 189
168 3300006881 Ga0068865_100007409 Ga0068865_1000074092 189
169 3300009093 Ga0105240_10000030 Ga0105240_1000003066 189
170 3300009093 Ga0105240_10000554 Ga0105240_1000055451 189
171 3300009098 Ga0105245_10372295 Ga0105245_103722952 189
172 3300009101 Ga0105247_10168741 Ga0105247_101687412 189
173 3300009174 Ga0105241_10004048 Ga0105241_100040487 189
174 3300009174 Ga0105241_10075878 Ga0105241_100758784 189
175 3300009174 Ga0105241_10101953 Ga0105241_101019532 189
176 3300009177 Ga0105248_10136330 Ga0105248_101363304 189
177 3300009545 Ga0105237_10000001 Ga0105237_10000001312 189
178 3300009545 Ga0105237_10000002 Ga0105237_10000002211 189
179 3300009551 Ga0105238_10006442 Ga0105238_1000644210 189
180 3300009979 Ga0105032_100002 Ga0105032_10000239 189
181 3300009979 Ga0105032_100013 Ga0105032_10001334 189
182 3300009979 Ga0105032_105146 Ga0105032_1051462 189
183 3300009984 Ga0105029_100236 Ga0105029_1002362 189
184 3300009987 Ga0105030_106202 Ga0105030_1062022 189
185 3300009993 Ga0105028_100559 Ga0105028_1005593 189
186 3300010375 Ga0105239_10001282 Ga0105239_1000128232 189
187 3300011119 Ga0105246_10000260 Ga0105246_1000026018 189
188 3300011119 Ga0105246_10058960 Ga0105246_100589602 189
189 3300011119 Ga0105246_10267821 Ga0105246_102678212 189
190 3300013100 Ga0157373_10008975 Ga0157373_1000897512 189
191 3300013100 Ga0157373_10013613 Ga0157373_100136135 189
192 3300013100 Ga0157373_10032976 Ga0157373_100329762 189
193 3300013104 Ga0157370_10000866 Ga0157370_100008663 189
194 3300013104 Ga0157370_10001378 Ga0157370_1000137817 189
195 3300013104 Ga0157370_10043626 Ga0157370_100436262 189
196 3300013104 Ga0157370_10449946 Ga0157370_104499462 189
197 3300013104 Ga0157370_10724380 Ga0157370_107243801 189
198 3300013104 Ga0157370_11295129 Ga0157370_112951291 189
199 3300013105 Ga0157369_10000003 Ga0157369_10000003302 189
200 3300013105 Ga0157369_10000026 Ga0157369_1000002692 189
201 3300013105 Ga0157369_10000055 Ga0157369_10000055106 189
202 3300013105 Ga0157369_10000634 Ga0157369_100006348 189
203 3300013105 Ga0157369_10025629 Ga0157369_100256293 189
204 3300013105 Ga0157369_10027265 Ga0157369_100272652 189
205 3300013105 Ga0157369_10350913 Ga0157369_103509132 189
206 3300013296 Ga0157374_10043480 Ga0157374_100434803 189
207 3300013296 Ga0157374_10175604 Ga0157374_101756043 189
208 3300013307 Ga0157372_10000007 Ga0157372_10000007311 189
209 3300013307 Ga0157372_10082985 Ga0157372_100829852 189
210 3300013307 Ga0157372_10126242 Ga0157372_101262422 189
211 3300013307 Ga0157372_11414394 Ga0157372_114143941 189
212 3300013307 Ga0157372_11706147 Ga0157372_117061471 189
213 3300013874 Ga0157514_113973 Ga0157514_1139732 189
214 3300014745 Ga0157377_10000373 Ga0157377_1000037311 189
215 3300014969 Ga0157376_10000085 Ga0157376_1000008555 189
216 3300014969 Ga0157376_10007264 Ga0157376_100072644 189
217 3300025904 Ga0207647_10001626 Ga0207647_100016264 189
218 3300025909 Ga0207705_10000010 Ga0207705_10000010481 189
219 3300025911 Ga0207654_10003395 Ga0207654_100033954 189
220 3300025911 Ga0207654_10197673 Ga0207654_101976732 189
221 3300025911 Ga0207654_10455637 Ga0207654_104556372 189
222 3300025913 Ga0207695_10000009 Ga0207695_10000009314 189
223 3300025913 Ga0207695_10001111 Ga0207695_1000111115 189
224 3300025914 Ga0207671_10000003 Ga0207671_10000003314 189
225 3300025914 Ga0207671_10000008 Ga0207671_10000008313 189
226 3300025919 Ga0207657_10000251 Ga0207657_100002515 189
227 3300025919 Ga0207657_10021394 Ga0207657_100213944 189
228 3300025924 Ga0207694_10036352 Ga0207694_100363524 189
229 3300025926 Ga0207659_10151947 Ga0207659_101519472 189
230 3300025932 Ga0207690_10013421 Ga0207690_100134212 189
231 3300025932 Ga0207690_10028773 Ga0207690_100287733 189
232 3300025933 Ga0207706_10000004 Ga0207706_1000000453 189
233 3300025938 Ga0207704_10003921 Ga0207704_1000392110 189
234 3300025941 Ga0207711_10233209 Ga0207711_102332093 189
235 3300025944 Ga0207661_10026859 Ga0207661_100268592 189
236 3300025945 Ga0207679_10000074 Ga0207679_1000007498 189
237 3300025945 Ga0207679_10490588 Ga0207679_104905882 189
238 3300025949 Ga0207667_10000005 Ga0207667_10000005571 189
239 3300025949 Ga0207667_10000027 Ga0207667_10000027159 189
240 3300025949 Ga0207667_10003596 Ga0207667_1000359613 189
241 3300025981 Ga0207640_10028159 Ga0207640_100281594 189
242 3300026078 Ga0207702_10000051 Ga0207702_1000005176 189
243 3300026078 Ga0207702_10000431 Ga0207702_1000043132 189
244 3300026078 Ga0207702_10318795 Ga0207702_103187952 189
245 3300026116 Ga0207674_10000032 Ga0207674_1000003274 189
246 3300026116 Ga0207674_10000299 Ga0207674_1000029952 189
247 3300026116 Ga0207674_10096183 Ga0207674_100961832 189
248 3300026142 Ga0207698_10000001 Ga0207698_10000001266 189
249 3300026142 Ga0207698_10000024 Ga0207698_10000024100 189
250 3300026142 Ga0207698_10243107 Ga0207698_102431072 189
251 3300027866 Ga0209813_10000732 Ga0209813_100007329 189
252 3300027866 Ga0209813_10053033 Ga0209813_100530332 189
253 3300030733 Ga0314311_1098846 Ga0314311_10988461 189
254 3300030733 Ga0314311_1211405 Ga0314311_12114052 189
255 3300030734 Ga0316179_1097059 Ga0316179_109705917 189
256 3300030735 Ga0316178_1151194 Ga0316178_11511944 189
257 3300030736 Ga0316180_1166974 Ga0316180_11669742 189
258 3300030742 Ga0316183_1006123 Ga0316183_10061232 189
259 3300030742 Ga0316183_1025503 Ga0316183_10255038 189
260 3300030742 Ga0316183_1035098 Ga0316183_10350989 189
261 3300030742 Ga0316183_1037189 Ga0316183_10371891 189
262 3300030742 Ga0316183_1078625 Ga0316183_10786256 189
263 3300030742 Ga0316183_1121630 Ga0316183_11216302 189
264 3300030744 Ga0316181_1004960 Ga0316181_10049602 189
265 3300030744 Ga0316181_1116978 Ga0316181_111697824 189
266 3300030744 Ga0316181_1284439 Ga0316181_12844392 189
267 3300030745 Ga0316182_1038280 Ga0316182_10382806 189
268 3300030745 Ga0316182_1110912 Ga0316182_11109123 189
269 3300030745 Ga0316182_1317116 Ga0316182_13171162 189
270 3300030745 Ga0316182_1426736 Ga0316182_14267363 189
271 3300031730 Ga0307516_10392816 Ga0307516_103928162 189
272 3300031901 Ga0307406_10000001 Ga0307406_10000001383 189
273 3300031901 Ga0307406_10000396 Ga0307406_1000039617 189
274 3300032004 Ga0307414_10382888 Ga0307414_103828881 189
275 3300032004 Ga0307414_10834614 Ga0307414_108346141 189
276 3300037312 Ga0395899_0025992 Ga0395899_0025992_3804_4382 189
277 3300037312 Ga0395899_0052946 Ga0395899_0052946_1743_2315 189
278 3300037418 Ga0395900_0000001 Ga0395900_0000001_420009_420581 189
279 3300037466 Ga0395898_0000002 Ga0395898_0000002_685425_685997 189
280 3300038443 Ga0395901_0000006 Ga0395901_0000006_331101_331673 189
281 3300038443 Ga0395901_0171456 Ga0395901_0171456_1395_1967 189
282 3300041410 Ga0439461_0002023 Ga0439461_0002023_1701_2276 189
283 3300042004 Ga0439445_0001738 Ga0439445_0001738_1756_2331 189
284 3300042016 Ga0439463_124237 Ga0439463_124237_49_621 189
285 3300042145 Ga0450906_010744 Ga0450906_010744_1031_1606 189
286 3300042156 Ga0439446_0000003 Ga0439446_0000003_140946_141524 189
287 3300042185 Ga0450909_015980 Ga0450909_015980_162_737 189
288 3300042435 Ga0439434_0002961 Ga0439434_0002961_3299_3877 189
289 3300042439 Ga0439464_0000047 Ga0439464_0000047_13807_14379 189
290 3300042531 Ga0450918_000162 Ga0450918_000162_9605_10192 189
291 3300044683 Ga0466965_0000084 Ga0466965_0000084_11352_11930 189
292 3300044765 Ga0466970_0068416 Ga0466970_0068416_992_1564 189
293 3300046460 Ga0495638_0000061 Ga0495638_0000061_48965_49540 189
294 3300046542 Ga0495597_0073459 Ga0495597_0073459_225_800 189
295 3300046692 Ga0495671_0075255 Ga0495671_0075255_663_1238 189
296 3300046810 Ga0495660_0000005 Ga0495660_0000005_341568_342143 189
297 3300047472 Ga0495686_0018697 Ga0495686_0018697_2173_2748 189
298 3300048918 Ga0496115_0000001 Ga0496115_0000001_132451_133020 189
299 3300048927 Ga0496124_0072087 Ga0496124_0072087_1923_2498 189
300 3300049571 Ga0501034_0000028 Ga0501034_0000028_172182_172760 189
301 3300049571 Ga0501034_0001066 Ga0501034_0001066_32263_32835 189
302 3300049571 Ga0501034_1029809 Ga0501034_1029809_84_662 189
303 3300049573 Ga0501037_0000001 Ga0501037_0000001_19983_20558 189
304 3300049574 Ga0501038_0119039 Ga0501038_0119039_123_698 189
305 3300049579 Ga0501043_0272527 Ga0501043_0272527_164_739 189
306 3300049742 Ga0501080_0354049 Ga0501080_0354049_519_1097 189
307 3300050489 nmdc:mga03683_13805_c1 nmdc:mga03683_13805_c1_1259_1834 189
308 3300050490 nmdc:mga03n38_70538_c1 nmdc:mga03n38_70538_c1_228_803 189
309 3300050491 nmdc:mga00v17_143_c1 nmdc:mga00v17_143_c1_25884_26459 189
310 3300050491 nmdc:mga00v17_260018_c1 nmdc:mga00v17_260018_c1_453_1034 189
311 3300050491 nmdc:mga00v17_9746_c1 nmdc:mga00v17_9746_c1_1568_2140 189
312 3300050492 nmdc:mga0yw44_14_c1 nmdc:mga0yw44_14_c1_57166_57741 189
313 3300050492 nmdc:mga0yw44_342826_c1 nmdc:mga0yw44_342826_c1_297_872 189
314 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_114286_114861 189
315 3300050492 nmdc:mga0yw44_50_c1 nmdc:mga0yw44_50_c1_34917_35495 189
316 3300050493 nmdc:mga0k408_104049_c2 nmdc:mga0k408_104049_c2_165_740 189
317 3300050493 nmdc:mga0k408_6447_c1 nmdc:mga0k408_6447_c1_1705_2277 189
318 3300050493 nmdc:mga0k408_752_c1 nmdc:mga0k408_752_c1_12255_12839 189
319 3300050494 nmdc:mga06z11_4644_c1 nmdc:mga06z11_4644_c1_1057_1632 189
320 3300050496 nmdc:mga07m45_118408_c1 nmdc:mga07m45_118408_c1_371_946 189
321 3300050496 nmdc:mga07m45_287083_c1 nmdc:mga07m45_287083_c1_112_687 189
322 3300050496 nmdc:mga07m45_403972_c1 nmdc:mga07m45_403972_c1_39_611 189
323 3300050496 nmdc:mga07m45_440583_c1 nmdc:mga07m45_440583_c1_76_651 189
324 3300050496 nmdc:mga07m45_71062_c1 nmdc:mga07m45_71062_c1_626_1201 189
325 3300050516 nmdc:mga0sz30_39538_c1 nmdc:mga0sz30_39538_c1_36_608 189
326 3300050516 nmdc:mga0sz30_8622_c1 nmdc:mga0sz30_8622_c1_1714_2289 189
327 3300053087 Ga0500643_001796 Ga0500643_001796_4553_5128 189
328 3300053087 Ga0500643_016352 Ga0500643_016352_1408_1983 189
329 3300053088 Ga0500644_0015649 Ga0500644_0015649_526_1101 189
330 3300053090 Ga0500646_0000005 Ga0500646_0000005_50638_51213 189
331 3300053092 Ga0500583_0003262 Ga0500583_0003262_2527_3102 189
332 3300053093 Ga0500651_0000025 Ga0500651_0000025_50858_51433 189
333 3300053096 Ga0500641_0000001 Ga0500641_0000001_988976_989551 189
334 3300053098 Ga0500650_0121565 Ga0500650_0121565_347_922 189
335 3300053103 Ga0500555_000009 Ga0500555_000009_48123_48698 189
336 3300053109 Ga0500569_000001 Ga0500569_000001_48966_49541 189
337 3300053118 Ga0500594_0000011 Ga0500594_0000011_35977_36552 189
338 3300053131 Ga0500652_000001 Ga0500652_000001_499132_499707 189
339 3300053133 Ga0500655_000483 Ga0500655_000483_5802_6371 189
340 3300053142 Ga0500577_0019057 Ga0500577_0019057_796_1371 189
341 3300053142 Ga0500577_0022767 Ga0500577_0022767_1395_1970 189
342 3300053142 Ga0500577_0033146 Ga0500577_0033146_773_1348 189
343 3300053146 Ga0500588_0000026 Ga0500588_0000026_2995_3570 189
344 3300053153 Ga0500616_0000012 Ga0500616_0000012_191880_192455 189
345 3300053153 Ga0500616_0033436 Ga0500616_0033436_1539_2114 189
346 3300053153 Ga0500616_0257012 Ga0500616_0257012_83_658 189
347 3300053155 Ga0500620_039568 Ga0500620_039568_81_653 189
348 3300053724 Ga0500570_000274 Ga0500570_000274_7429_8004 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

29

89

0.98

PF07499

RuvA_C

RuvA, C-terminal domain

175

217

0.93

PF14520

HHH_5

Helix-hairpin-helix domain

99

157

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ixr-assembly1.cif.gz_A ruva-ruvb complex 0.9393 1 131
1d8l-assembly1.cif.gz_A e. coli holliday junction binding protein ruva nh2 region lacking domain iii 0.9392 1 129
2zte-assembly1.cif.gz_A mtruva form iv 0.9312 1 130
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9234 1 130
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9091 1 130
ID Description Score Start End Superfamily
2zteA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.955 64 130 1.10.150.20
2ztdA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.949 1 64 2.40.50.140
2h5xD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9469 66 132 1.10.150.20
1ixrA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9452 64 131 1.10.150.20
2h5xC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9403 66 133 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A258BPA8-F1-model_v4 Holliday junction branch migration protein RuvA 0.9914 1 100 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-W1V4X5-F1-model_v4 Holliday junction ATP-dependent DNA helicase RuvA 0.988 1 65 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A505VC93-F1-model_v4 deleted 0.988 1 64
AF-A0A258BPA8-F1-model_v4 Holliday junction branch migration protein RuvA 0.9816 1 100 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A355BKX3-F1-model_v4 Holliday junction branch migration protein RuvA 0.9754 1 62 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378

Feature Viewer

pLDDT pTM Quality
88.67 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map