F417311

General Info

Members Datasets Scaffolds Average Seq Length
347 212 694 171

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0039997|Ga0501071_0039997_2580_3167
Length 195
Sequence MALGRLGFAVLAWHEPGDGPGASSMDLKAHIRQIPDFPKPGILFYDISTLLQAPAAWRAAVERLAALVAAHRPDRLVGIESRGFVVASPIALQLGVGFGMVRKRGKLPGSVVAHTYSLEYGMDSIEISADLIPAGSRVVVVDDLIATGGTAAATVQLLRKIGAEPVAAVFLIELTKLHGRAKLDISVETLLQYDD

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
138 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
141 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 3.75
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0039997 3300049587 Bacteria 3356
2 Ga0065712_10020548 3300005290 Bacteria 2097
3 Ga0065712_10077685 3300005290 Bacteria 3458
4 Ga0065715_10507933 3300005293 Bacteria 770
5 Ga0065707_10241490 3300005295 Bacteria 1154
6 Ga0065707_10625394 3300005295 Bacteria 676
7 Ga0065707_10805979 3300005295 Bacteria 597
8 Ga0070658_10004294 3300005327 Bacteria 11645
9 Ga0070658_10054685 3300005327 Bacteria 3241
10 Ga0070658_10091574 3300005327 Bacteria 2506
11 Ga0070676_10334885 3300005328 Bacteria 1036
12 Ga0070683_100924603 3300005329 Bacteria 837
13 Ga0070690_100114959 3300005330 Bacteria 1800
14 Ga0070690_100377403 3300005330 Bacteria 1036
15 Ga0070670_100393127 3300005331 Bacteria 1223
16 Ga0070666_10002923 3300005335 Bacteria 10331
17 Ga0070666_10037184 3300005335 Bacteria 3236
18 Ga0070680_101170722 3300005336 Bacteria 665
19 Ga0070689_100147696 3300005340 Bacteria 1894
20 Ga0070689_100287548 3300005340 Bacteria 1365
21 Ga0070692_10453844 3300005345 Bacteria 821
22 Ga0070668_100173516 3300005347 Bacteria 1757
23 Ga0070669_100165268 3300005353 Bacteria 1722
24 Ga0070669_100189555 3300005353 Bacteria 1612
25 Ga0070675_100612664 3300005354 Bacteria 988
26 Ga0070673_100535264 3300005364 Bacteria 1063
27 Ga0070688_100542395 3300005365 Bacteria 883
28 Ga0070688_100548736 3300005365 Bacteria 878
29 Ga0070667_100041030 3300005367 Bacteria 3883
30 Ga0070667_100809462 3300005367 Bacteria 870
31 Ga0070709_10000401 3300005434 Bacteria 26361
32 Ga0070701_10270948 3300005438 Bacteria 1033
33 Ga0070705_100262427 3300005440 Bacteria 1219
34 Ga0070694_100652887 3300005444 Bacteria 852
35 Ga0070694_100792152 3300005444 Bacteria 777
36 Ga0070708_100298861 3300005445 Bacteria 1516
37 Ga0070706_100367195 3300005467 Bacteria 1341
38 Ga0070707_100251715 3300005468 Bacteria 1719
39 Ga0070707_100682823 3300005468 Bacteria 989
40 Ga0070698_100079901 3300005471 Bacteria 3266
41 Ga0070698_100122091 3300005471 Bacteria 2564
42 Ga0070698_101059897 3300005471 Bacteria 759
43 Ga0070699_100128950 3300005518 Bacteria 2229
44 Ga0070699_100485429 3300005518 Bacteria 1121
45 Ga0070697_100506741 3300005536 Bacteria 1056
46 Ga0068853_101191997 3300005539 Bacteria 735
47 Ga0070672_100424732 3300005543 Bacteria 1142
48 Ga0070686_100004217 3300005544 Bacteria 7916
49 Ga0070686_100065026 3300005544 Bacteria 2368
50 Ga0070695_100302900 3300005545 Bacteria 1182
51 Ga0070665_100000173 3300005548 Bacteria 114859
52 Ga0070665_100006451 3300005548 Bacteria 11938
53 Ga0070665_100081363 3300005548 Bacteria 3245
54 Ga0070704_100928548 3300005549 Bacteria 784
55 Ga0070704_101027884 3300005549 Bacteria 746
56 Ga0068855_100400231 3300005563 Bacteria 1505
57 Ga0068854_100023733 3300005578 Bacteria 4192
58 Ga0068856_100133111 3300005614 Bacteria 2491
59 Ga0068852_100516953 3300005616 Bacteria 1191
60 Ga0068859_100425581 3300005617 Bacteria 1424
61 Ga0068859_101236350 3300005617 Bacteria 823
62 Ga0068864_100235333 3300005618 Bacteria 1695
63 Ga0068864_100469644 3300005618 Bacteria 1206
64 Ga0068864_100970580 3300005618 Bacteria 842
65 Ga0068861_100251173 3300005719 Bacteria 1509
66 Ga0068863_100435222 3300005841 Bacteria 1286
67 Ga0068863_101139949 3300005841 Bacteria 785
68 Ga0068858_100011203 3300005842 Bacteria 8473
69 Ga0068860_100003305 3300005843 Bacteria 16590
70 Ga0068860_100256779 3300005843 Bacteria 1703
71 Ga0068860_100939148 3300005843 Bacteria 882
72 Ga0068860_101621530 3300005843 Bacteria 669
73 Ga0068862_100000537 3300005844 Bacteria 39634
74 Ga0081455_10138234 3300005937 Bacteria 1895
75 Ga0081455_10174302 3300005937 Bacteria 1635
76 Ga0081538_10073733 3300005981 Bacteria 1863
77 Ga0081539_10034475 3300005985 Bacteria 3060
78 Ga0070716_100011284 3300006173 Bacteria 4499
79 Ga0097621_100010042 3300006237 Bacteria 6903
80 Ga0068871_100000789 3300006358 Bacteria 21277
81 Ga0068871_100830815 3300006358 Bacteria 853
82 Ga0075428_100167569 3300006844 Bacteria 2383
83 Ga0075431_100023298 3300006847 Bacteria 6335
84 Ga0075433_10021183 3300006852 Bacteria 5448
85 Ga0075433_10299229 3300006852 Bacteria 1425
86 Ga0075433_10549248 3300006852 Bacteria 1016
87 Ga0075434_100001014 3300006871 Bacteria 22835
88 Ga0075434_100001236 3300006871 Bacteria 21230
89 Ga0075434_100065179 3300006871 Bacteria 3628
90 Ga0075434_100077079 3300006871 Bacteria 3328
91 Ga0075434_100218608 3300006871 Bacteria 1925
92 Ga0075434_100419330 3300006871 Bacteria 1360
93 Ga0075434_100708520 3300006871 Bacteria 1024
94 Ga0068865_100018547 3300006881 Bacteria 4491
95 Ga0068865_100122507 3300006881 Bacteria 1936
96 Ga0075436_100000332 3300006914 Bacteria 30123
97 Ga0075436_100045907 3300006914 Bacteria 3013
98 Ga0075436_100107468 3300006914 Bacteria 1946
99 Ga0075436_100293802 3300006914 Bacteria 1163
100 Ga0075436_100344977 3300006914 Bacteria 1072
101 Ga0097620_100425628 3300006931 Bacteria 1424
102 Ga0097620_101236457 3300006931 Bacteria 823
103 Ga0075435_100000028 3300007076 Bacteria 82360
104 Ga0075435_100000392 3300007076 Bacteria 26819
105 Ga0075435_100252530 3300007076 Bacteria 1501
106 Ga0075435_100293972 3300007076 Bacteria 1388
107 Ga0105240_10299414 3300009093 Bacteria 1840
108 Ga0105240_10327913 3300009093 Bacteria 1743
109 Ga0105240_10746355 3300009093 Bacteria 1064
110 Ga0105240_11789201 3300009093 Bacteria 640
111 Ga0111539_11678245 3300009094 Bacteria 737
112 Ga0105245_10017820 3300009098 Bacteria 6199
113 Ga0105247_10173117 3300009101 Bacteria 1436
114 Ga0114129_10003691 3300009147 Bacteria 21558
115 Ga0114129_10029213 3300009147 Bacteria 7808
116 Ga0114129_10210114 3300009147 Bacteria 2631
117 Ga0114129_10364863 3300009147 Bacteria 1910
118 Ga0114129_11114417 3300009147 Bacteria 987
119 Ga0114129_11409359 3300009147 Bacteria 859
120 Ga0105242_10002350 3300009176 Bacteria 14921
121 Ga0105242_10003521 3300009176 Bacteria 12169
122 Ga0105242_10478161 3300009176 Bacteria 1180
123 Ga0105248_10132538 3300009177 Bacteria 2812
124 Ga0105248_10349599 3300009177 Bacteria 1664
125 Ga0105248_10641894 3300009177 Bacteria 1198
126 Ga0105248_10959890 3300009177 Bacteria 965
127 Ga0105238_10003662 3300009551 Bacteria 15314
128 Ga0105249_10208369 3300009553 Bacteria 1917
129 Ga0105249_10682994 3300009553 Bacteria 1086
130 Ga0105028_100875 3300009993 Bacteria 3205
131 Ga0157369_11214330 3300013105 Bacteria 769
132 Ga0157374_10818244 3300013296 Bacteria 948
133 Ga0157378_10600227 3300013297 Bacteria 1112
134 Ga0157375_10757355 3300013308 Bacteria 1122
135 Ga0163163_11135141 3300014325 Bacteria 844
136 Ga0163163_11782966 3300014325 Bacteria 676
137 Ga0157380_10567545 3300014326 Bacteria 1116
138 Ga0157380_11149244 3300014326 Bacteria 818
139 Ga0157379_10097670 3300014968 Bacteria 2637
140 Ga0157379_10865964 3300014968 Bacteria 856
141 Ga0157376_10154469 3300014969 Bacteria 2073
142 Ga0163161_10418634 3300017792 Bacteria 1077
143 Ga0213876_10384628 3300021384 Bacteria 746
144 Ga0207680_10011884 3300025903 Bacteria 4418
145 Ga0207680_10029157 3300025903 Bacteria 3097
146 Ga0207680_10102029 3300025903 Bacteria 1845
147 Ga0207685_10391754 3300025905 Bacteria 710
148 Ga0207699_10000149 3300025906 Bacteria 45209
149 Ga0207645_10614903 3300025907 Bacteria 738
150 Ga0207705_10116582 3300025909 Bacteria 1978
151 Ga0207705_10199257 3300025909 Bacteria 1517
152 Ga0207705_10227535 3300025909 Bacteria 1418
153 Ga0207684_10265594 3300025910 Bacteria 1481
154 Ga0207707_10454328 3300025912 Bacteria 1096
155 Ga0207695_10209885 3300025913 Bacteria 1858
156 Ga0207660_10656853 3300025917 Bacteria 855
157 Ga0207646_10089253 3300025922 Bacteria 2759
158 Ga0207681_10410749 3300025923 Bacteria 1095
159 Ga0207681_10771497 3300025923 Bacteria 802
160 Ga0207694_10000385 3300025924 Bacteria 41099
161 Ga0207687_10018879 3300025927 Bacteria 4559
162 Ga0207700_10498130 3300025928 Bacteria 1078
163 Ga0207706_10389257 3300025933 Bacteria 1209
164 Ga0207686_10013255 3300025934 Bacteria 4558
165 Ga0207686_10217429 3300025934 Bacteria 1378
166 Ga0207686_10340552 3300025934 Bacteria 1126
167 Ga0207670_10072984 3300025936 Bacteria 2378
168 Ga0207670_11317084 3300025936 Bacteria 613
169 Ga0207669_10796756 3300025937 Bacteria 783
170 Ga0207704_10011082 3300025938 Bacteria 4424
171 Ga0207665_10018224 3300025939 Bacteria 4614
172 Ga0207665_10485282 3300025939 Bacteria 953
173 Ga0207711_10114832 3300025941 Bacteria 2398
174 Ga0207711_10277265 3300025941 Bacteria 1544
175 Ga0207711_10398186 3300025941 Bacteria 1279
176 Ga0207711_10412111 3300025941 Bacteria 1256
177 Ga0207651_10241139 3300025960 Bacteria 1473
178 Ga0207651_10750375 3300025960 Bacteria 863
179 Ga0207712_10499954 3300025961 Bacteria 1039
180 Ga0207668_10119237 3300025972 Bacteria 1995
181 Ga0207640_10264768 3300025981 Bacteria 1341
182 Ga0207658_10081228 3300025986 Bacteria 2485
183 Ga0207677_10122596 3300026023 Bacteria 1958
184 Ga0207703_10019262 3300026035 Bacteria 5330
185 Ga0207639_11107362 3300026041 Bacteria 743
186 Ga0207641_10400234 3300026088 Unclassified 1318
187 Ga0207648_10019803 3300026089 Bacteria 6072
188 Ga0207676_10344545 3300026095 Bacteria 1376
189 Ga0207676_10887914 3300026095 Bacteria 874
190 Ga0207683_10141513 3300026121 Bacteria 2168
191 Ga0207428_10107708 3300027907 Bacteria 2147
192 Ga0268266_10000398 3300028379 Bacteria 65855
193 Ga0268266_10004618 3300028379 Bacteria 13137
194 Ga0268265_10000138 3300028380 Bacteria 92824
195 Ga0268264_10002320 3300028381 Bacteria 16828
196 Ga0268264_10265105 3300028381 Bacteria 1602
197 Ga0268264_10768283 3300028381 Bacteria 961
198 Ga0265328_10010960 3300031239 Bacteria 3634
199 Ga0265340_10129738 3300031247 Bacteria 1157
200 Ga0265331_10108750 3300031250 Unclassified 1272
201 Ga0307508_10019277 3300031616 Bacteria 6203
202 Ga0316576_10004283 3300031727 Bacteria 8534
203 Ga0307409_100789224 3300031995 Bacteria 956
204 Ga0373929_0000016 3300035085 Bacteria 128712
205 Ga0373953_0147575 3300035117 Bacteria 1007
206 Ga0373956_0115295 3300035119 Bacteria 1253
207 Ga0373956_0233158 3300035119 Bacteria 874
208 Ga0373957_0096314 3300035120 Bacteria 1181
209 Ga0373943_0324102 3300035170 Bacteria 879
210 Ga0373961_0013437 3300035241 Bacteria 2065
211 Ga0316574_0293700 3300035398 Bacteria 1034
212 Ga0373924_0377739 3300035410 Bacteria 632
213 Ga0373935_0004985 3300035692 Bacteria 7813
214 Ga0373937_0428144 3300036401 Bacteria 1256
215 Ga0373937_0797433 3300036401 Bacteria 892
216 Ga0316584_0052872 3300036712 Unclassified 3038
217 Ga0373925_0568431 3300037068 Bacteria 933
218 Ga0436365_0704309 3300039437 Bacteria 1129
219 Ga0451797_0636449 3300041453 Bacteria 1111
220 Ga0451837_0109290 3300041494 Bacteria 632
221 Ga0451843_1756998 3300041509 Bacteria 3397
222 Ga0439464_0042511 3300042439 Bacteria 1298
223 Ga0450916_018131 3300042530 Bacteria 946
224 Ga0451577_0008828 3300042876 Bacteria 9761
225 Ga0439440_0163921 3300042993 Bacteria 643
226 Ga0453684_0000481 3300044712 Bacteria 158570
227 Ga0453684_0137565 3300044712 Bacteria 2922
228 Ga0495592_0083823 3300046454 Bacteria 2301
229 Ga0495629_0079020 3300046459 Bacteria 2297
230 Ga0495629_0408285 3300046459 Bacteria 923
231 Ga0495651_0480549 3300046462 Bacteria 798
232 Ga0495582_0270480 3300046473 Bacteria 975
233 Ga0495618_0102896 3300046514 Bacteria 1828
234 Ga0495628_0238745 3300046516 Bacteria 1360
235 Ga0495630_0436127 3300046517 Bacteria 1004
236 Ga0495586_0014385 3300046535 Bacteria 4204
237 Ga0495621_0193226 3300046539 Bacteria 816
238 Ga0495645_0010850 3300046543 Bacteria 6401
239 Ga0495667_0032459 3300046559 Bacteria 3499
240 Ga0495634_0380694 3300046642 Bacteria 841
241 Ga0495599_0054333 3300046678 Bacteria 2509
242 Ga0495658_0397232 3300046683 Bacteria 879
243 Ga0495658_0735109 3300046683 Bacteria 632
244 Ga0495600_0124188 3300046809 Bacteria 1679
245 Ga0495600_0151091 3300046809 Bacteria 1504
246 Ga0495680_0158474 3300047322 Bacteria 1645
247 Ga0495680_0223904 3300047322 Bacteria 1342
248 Ga0496104_0449518 3300048907 Bacteria 1200
249 Ga0496105_0430170 3300048908 Bacteria 1044
250 Ga0496106_0089649 3300048909 Bacteria 2372
251 Ga0496106_0781297 3300048909 Bacteria 758
252 Ga0496109_0403157 3300048912 Bacteria 1292
253 Ga0496111_0698331 3300048914 Bacteria 738
254 Ga0496113_0441271 3300048916 Bacteria 1046
255 Ga0496114_0000022 3300048917 Bacteria 219236
256 Ga0496114_0049320 3300048917 Bacteria 3503
257 Ga0496114_0405796 3300048917 Bacteria 1207
258 Ga0496114_1100893 3300048917 Unclassified 679
259 Ga0496115_0037638 3300048918 Bacteria 3835
260 Ga0501031_0304474 3300049568 Bacteria 1033
261 Ga0501032_0120245 3300049569 Bacteria 1736
262 Ga0501034_0246745 3300049571 Bacteria 1731
263 Ga0501036_0001185 3300049572 Bacteria 19860
264 Ga0501037_0492011 3300049573 Bacteria 833
265 Ga0501038_0003926 3300049574 Bacteria 13821
266 Ga0501038_0024110 3300049574 Bacteria 5431
267 Ga0501038_0504415 3300049574 Bacteria 925
268 Ga0501039_0002319 3300049575 Bacteria 14134
269 Ga0501039_0681630 3300049575 Bacteria 804
270 Ga0501040_0064104 3300049576 Bacteria 2529
271 Ga0501040_0658639 3300049576 Bacteria 757
272 Ga0501041_0036548 3300049577 Bacteria 2975
273 Ga0501042_0576158 3300049578 Bacteria 818
274 Ga0501043_0073224 3300049579 Bacteria 2691
275 Ga0501046_0002689 3300049580 Bacteria 16559
276 Ga0501046_0229077 3300049580 Bacteria 1374
277 Ga0501048_0026910 3300049582 Bacteria 4185
278 Ga0501048_0407606 3300049582 Bacteria 972
279 Ga0501067_0013082 3300049583 Bacteria 4592
280 Ga0501067_0021795 3300049583 Bacteria 3546
281 Ga0501068_0005358 3300049584 Bacteria 7011
282 Ga0501068_0013648 3300049584 Bacteria 4626
283 Ga0501068_0049893 3300049584 Bacteria 2529
284 Ga0501069_0000207 3300049585 Bacteria 26116
285 Ga0501070_0004092 3300049586 Bacteria 12539
286 Ga0501071_0293672 3300049587 Bacteria 1231
287 Ga0501071_0333541 3300049587 Bacteria 1153
288 Ga0501071_1069446 3300049587 Bacteria 623
289 Ga0501072_0048104 3300049588 Bacteria 3358
290 Ga0501074_0022008 3300049590 Bacteria 4631
291 Ga0501075_0008125 3300049591 Bacteria 7301
292 Ga0501075_0265203 3300049591 Bacteria 1309
293 Ga0501075_0308675 3300049591 Bacteria 1205
294 Ga0501077_0000284 3300049593 Bacteria 30131
295 Ga0501079_0063725 3300049741 Bacteria 2844
296 Ga0501079_0064855 3300049741 Bacteria 2817
297 Ga0501079_0501039 3300049741 Bacteria 955
298 Ga0501080_0002960 3300049742 Bacteria 14936
299 Ga0501080_0200682 3300049742 Bacteria 1831
300 Ga0501083_0000768 3300049744 Bacteria 21000
301 Ga0501083_0002752 3300049744 Bacteria 12150
302 Ga0501083_0435527 3300049744 Bacteria 853
303 Ga0501035_0022457 3300049822 Bacteria 5794
304 Ga0501035_0959689 3300049822 Bacteria 674
305 Ga0501044_0239982 3300049823 Bacteria 1756
306 Ga0501045_0187194 3300049824 Bacteria 1543
307 Ga0501045_0231809 3300049824 Bacteria 1374
308 nmdc:mga0yw44_300434_c1 3300050492 Bacteria 1075
309 nmdc:mga05p37_1439541_c1 3300050507 Bacteria 691
310 nmdc:mga05p37_330832_c1 3300050507 Bacteria 1800
311 nmdc:mga05p37_405556_c1 3300050507 Bacteria 1590
312 nmdc:mga05p37_7993_c2 3300050507 Bacteria 8627
313 nmdc:mga09592_57727_c1 3300050508 Bacteria 3281
314 nmdc:mga0qj67_347622_c1 3300050509 Bacteria 1199
315 nmdc:mga06r32_3417_c1 3300050510 Bacteria 13381
316 nmdc:mga08y16_298259_c1 3300050511 Bacteria 1662
317 nmdc:mga08y16_412707_c1 3300050511 Bacteria 1381
318 nmdc:mga0n895_11521_c1 3300050512 Bacteria 7895
319 nmdc:mga0n895_194985_c1 3300050512 Bacteria 2057
320 nmdc:mga0n895_31666_c1 3300050512 Bacteria 5067
321 nmdc:mga0n895_429922_c1 3300050512 Bacteria 1334
322 nmdc:mga0n895_66049_c1 3300050512 Bacteria 3582
323 nmdc:mga0n895_758_c1 3300050512 Bacteria 22873
324 nmdc:mga0n895_91821_c1 3300050512 Bacteria 3039
325 nmdc:mga0rr50_225360_c1 3300050513 Bacteria 1549
326 nmdc:mga0rr50_33553_c1 3300050513 Unclassified 3668
327 nmdc:mga0rr50_540986_c1 3300050513 Bacteria 992
328 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
329 nmdc:mga08x19_141608_c1 3300050514 Bacteria 1625
330 nmdc:mga08x19_40598_c1 3300050514 Bacteria 2962
331 nmdc:mga08x19_429_c1 3300050514 Bacteria 28767
332 nmdc:mga08x19_592_c1 3300050514 Bacteria 23482
333 nmdc:mga08x19_83530_c1 3300050514 Bacteria 2100
334 nmdc:mga0a205_665519_c1 3300050515 Bacteria 892
335 nmdc:mga0a205_966792_c1 3300050515 Bacteria 698
336 Ga0495601_0012107 3300053077 Bacteria 5170
337 Ga0495601_0081663 3300053077 Bacteria 2075
338 Ga0495595_0310184 3300053084 Bacteria 794
339 Ga0495619_0010555 3300053085 Bacteria 5812
340 Ga0495619_0091843 3300053085 Bacteria 2056
341 Ga0495619_0145978 3300053085 Bacteria 1631
342 Ga0500588_0000065 3300053146 Bacteria 16577
343 Ga0501082_0000011 3300060353 Bacteria 121336
344 Ga0501082_0484437 3300060353 Bacteria 1081
345 Ga0530510_0253157 3300061734 Bacteria 1312
346 Ga0530510_0895812 3300061734 Bacteria 678
347 2883293171 2883291878 Bacteria 5894118
348 Ga0501071_0039997
349 Ga0065712_10020548
350 Ga0065712_10077685
351 Ga0065715_10507933
352 Ga0065707_10241490
353 Ga0065707_10625394
354 Ga0065707_10805979
355 Ga0070658_10004294
356 Ga0070658_10054685
357 Ga0070658_10091574
358 Ga0070676_10334885
359 Ga0070683_100924603
360 Ga0070690_100114959
361 Ga0070690_100377403
362 Ga0070670_100393127
363 Ga0070666_10002923
364 Ga0070666_10037184
365 Ga0070680_101170722
366 Ga0070689_100147696
367 Ga0070689_100287548
368 Ga0070692_10453844
369 Ga0070668_100173516
370 Ga0070669_100165268
371 Ga0070669_100189555
372 Ga0070675_100612664
373 Ga0070673_100535264
374 Ga0070688_100542395
375 Ga0070688_100548736
376 Ga0070667_100041030
377 Ga0070667_100809462
378 Ga0070709_10000401
379 Ga0070701_10270948
380 Ga0070705_100262427
381 Ga0070694_100652887
382 Ga0070694_100792152
383 Ga0070708_100298861
384 Ga0070706_100367195
385 Ga0070707_100251715
386 Ga0070707_100682823
387 Ga0070698_100079901
388 Ga0070698_100122091
389 Ga0070698_101059897
390 Ga0070699_100128950
391 Ga0070699_100485429
392 Ga0070697_100506741
393 Ga0068853_101191997
394 Ga0070672_100424732
395 Ga0070686_100004217
396 Ga0070686_100065026
397 Ga0070695_100302900
398 Ga0070665_100000173
399 Ga0070665_100006451
400 Ga0070665_100081363
401 Ga0070704_100928548
402 Ga0070704_101027884
403 Ga0068855_100400231
404 Ga0068854_100023733
405 Ga0068856_100133111
406 Ga0068852_100516953
407 Ga0068859_100425581
408 Ga0068859_101236350
409 Ga0068864_100235333
410 Ga0068864_100469644
411 Ga0068864_100970580
412 Ga0068861_100251173
413 Ga0068863_100435222
414 Ga0068863_101139949
415 Ga0068858_100011203
416 Ga0068860_100003305
417 Ga0068860_100256779
418 Ga0068860_100939148
419 Ga0068860_101621530
420 Ga0068862_100000537
421 Ga0081455_10138234
422 Ga0081455_10174302
423 Ga0081538_10073733
424 Ga0081539_10034475
425 Ga0070716_100011284
426 Ga0097621_100010042
427 Ga0068871_100000789
428 Ga0068871_100830815
429 Ga0075428_100167569
430 Ga0075431_100023298
431 Ga0075433_10021183
432 Ga0075433_10299229
433 Ga0075433_10549248
434 Ga0075434_100001014
435 Ga0075434_100001236
436 Ga0075434_100065179
437 Ga0075434_100077079
438 Ga0075434_100218608
439 Ga0075434_100419330
440 Ga0075434_100708520
441 Ga0068865_100018547
442 Ga0068865_100122507
443 Ga0075436_100000332
444 Ga0075436_100045907
445 Ga0075436_100107468
446 Ga0075436_100293802
447 Ga0075436_100344977
448 Ga0097620_100425628
449 Ga0097620_101236457
450 Ga0075435_100000028
451 Ga0075435_100000392
452 Ga0075435_100252530
453 Ga0075435_100293972
454 Ga0105240_10299414
455 Ga0105240_10327913
456 Ga0105240_10746355
457 Ga0105240_11789201
458 Ga0111539_11678245
459 Ga0105245_10017820
460 Ga0105247_10173117
461 Ga0114129_10003691
462 Ga0114129_10029213
463 Ga0114129_10210114
464 Ga0114129_10364863
465 Ga0114129_11114417
466 Ga0114129_11409359
467 Ga0105242_10002350
468 Ga0105242_10003521
469 Ga0105242_10478161
470 Ga0105248_10132538
471 Ga0105248_10349599
472 Ga0105248_10641894
473 Ga0105248_10959890
474 Ga0105238_10003662
475 Ga0105249_10208369
476 Ga0105249_10682994
477 Ga0105028_100875
478 Ga0157369_11214330
479 Ga0157374_10818244
480 Ga0157378_10600227
481 Ga0157375_10757355
482 Ga0163163_11135141
483 Ga0163163_11782966
484 Ga0157380_10567545
485 Ga0157380_11149244
486 Ga0157379_10097670
487 Ga0157379_10865964
488 Ga0157376_10154469
489 Ga0163161_10418634
490 Ga0213876_10384628
491 Ga0207680_10011884
492 Ga0207680_10029157
493 Ga0207680_10102029
494 Ga0207685_10391754
495 Ga0207699_10000149
496 Ga0207645_10614903
497 Ga0207705_10116582
498 Ga0207705_10199257
499 Ga0207705_10227535
500 Ga0207684_10265594
501 Ga0207707_10454328
502 Ga0207695_10209885
503 Ga0207660_10656853
504 Ga0207646_10089253
505 Ga0207681_10410749
506 Ga0207681_10771497
507 Ga0207694_10000385
508 Ga0207687_10018879
509 Ga0207700_10498130
510 Ga0207706_10389257
511 Ga0207686_10013255
512 Ga0207686_10217429
513 Ga0207686_10340552
514 Ga0207670_10072984
515 Ga0207670_11317084
516 Ga0207669_10796756
517 Ga0207704_10011082
518 Ga0207665_10018224
519 Ga0207665_10485282
520 Ga0207711_10114832
521 Ga0207711_10277265
522 Ga0207711_10398186
523 Ga0207711_10412111
524 Ga0207651_10241139
525 Ga0207651_10750375
526 Ga0207712_10499954
527 Ga0207668_10119237
528 Ga0207640_10264768
529 Ga0207658_10081228
530 Ga0207677_10122596
531 Ga0207703_10019262
532 Ga0207639_11107362
533 Ga0207641_10400234
534 Ga0207648_10019803
535 Ga0207676_10344545
536 Ga0207676_10887914
537 Ga0207683_10141513
538 Ga0207428_10107708
539 Ga0268266_10000398
540 Ga0268266_10004618
541 Ga0268265_10000138
542 Ga0268264_10002320
543 Ga0268264_10265105
544 Ga0268264_10768283
545 Ga0265328_10010960
546 Ga0265340_10129738
547 Ga0265331_10108750
548 Ga0307508_10019277
549 Ga0316576_10004283
550 Ga0307409_100789224
551 Ga0373929_0000016
552 Ga0373953_0147575
553 Ga0373956_0115295
554 Ga0373956_0233158
555 Ga0373957_0096314
556 Ga0373943_0324102
557 Ga0373961_0013437
558 Ga0316574_0293700
559 Ga0373924_0377739
560 Ga0373935_0004985
561 Ga0373937_0428144
562 Ga0373937_0797433
563 Ga0316584_0052872
564 Ga0373925_0568431
565 Ga0436365_0704309
566 Ga0451797_0636449
567 Ga0451837_0109290
568 Ga0451843_1756998
569 Ga0439464_0042511
570 Ga0450916_018131
571 Ga0451577_0008828
572 Ga0439440_0163921
573 Ga0453684_0000481
574 Ga0453684_0137565
575 Ga0495592_0083823
576 Ga0495629_0079020
577 Ga0495629_0408285
578 Ga0495651_0480549
579 Ga0495582_0270480
580 Ga0495618_0102896
581 Ga0495628_0238745
582 Ga0495630_0436127
583 Ga0495586_0014385
584 Ga0495621_0193226
585 Ga0495645_0010850
586 Ga0495667_0032459
587 Ga0495634_0380694
588 Ga0495599_0054333
589 Ga0495658_0397232
590 Ga0495658_0735109
591 Ga0495600_0124188
592 Ga0495600_0151091
593 Ga0495680_0158474
594 Ga0495680_0223904
595 Ga0496104_0449518
596 Ga0496105_0430170
597 Ga0496106_0089649
598 Ga0496106_0781297
599 Ga0496109_0403157
600 Ga0496111_0698331
601 Ga0496113_0441271
602 Ga0496114_0000022
603 Ga0496114_0049320
604 Ga0496114_0405796
605 Ga0496114_1100893
606 Ga0496115_0037638
607 Ga0501031_0304474
608 Ga0501032_0120245
609 Ga0501034_0246745
610 Ga0501036_0001185
611 Ga0501037_0492011
612 Ga0501038_0003926
613 Ga0501038_0024110
614 Ga0501038_0504415
615 Ga0501039_0002319
616 Ga0501039_0681630
617 Ga0501040_0064104
618 Ga0501040_0658639
619 Ga0501041_0036548
620 Ga0501042_0576158
621 Ga0501043_0073224
622 Ga0501046_0002689
623 Ga0501046_0229077
624 Ga0501048_0026910
625 Ga0501048_0407606
626 Ga0501067_0013082
627 Ga0501067_0021795
628 Ga0501068_0005358
629 Ga0501068_0013648
630 Ga0501068_0049893
631 Ga0501069_0000207
632 Ga0501070_0004092
633 Ga0501071_0293672
634 Ga0501071_0333541
635 Ga0501071_1069446
636 Ga0501072_0048104
637 Ga0501074_0022008
638 Ga0501075_0008125
639 Ga0501075_0265203
640 Ga0501075_0308675
641 Ga0501077_0000284
642 Ga0501079_0063725
643 Ga0501079_0064855
644 Ga0501079_0501039
645 Ga0501080_0002960
646 Ga0501080_0200682
647 Ga0501083_0000768
648 Ga0501083_0002752
649 Ga0501083_0435527
650 Ga0501035_0022457
651 Ga0501035_0959689
652 Ga0501044_0239982
653 Ga0501045_0187194
654 Ga0501045_0231809
655 nmdc:mga0yw44_300434_c1
656 nmdc:mga05p37_1439541_c1
657 nmdc:mga05p37_330832_c1
658 nmdc:mga05p37_405556_c1
659 nmdc:mga05p37_7993_c2
660 nmdc:mga09592_57727_c1
661 nmdc:mga0qj67_347622_c1
662 nmdc:mga06r32_3417_c1
663 nmdc:mga08y16_298259_c1
664 nmdc:mga08y16_412707_c1
665 nmdc:mga0n895_11521_c1
666 nmdc:mga0n895_194985_c1
667 nmdc:mga0n895_31666_c1
668 nmdc:mga0n895_429922_c1
669 nmdc:mga0n895_66049_c1
670 nmdc:mga0n895_758_c1
671 nmdc:mga0n895_91821_c1
672 nmdc:mga0rr50_225360_c1
673 nmdc:mga0rr50_33553_c1
674 nmdc:mga0rr50_540986_c1
675 nmdc:mga0rr50_8_c1
676 nmdc:mga08x19_141608_c1
677 nmdc:mga08x19_40598_c1
678 nmdc:mga08x19_429_c1
679 nmdc:mga08x19_592_c1
680 nmdc:mga08x19_83530_c1
681 nmdc:mga0a205_665519_c1
682 nmdc:mga0a205_966792_c1
683 Ga0495601_0012107
684 Ga0495601_0081663
685 Ga0495595_0310184
686 Ga0495619_0010555
687 Ga0495619_0091843
688 Ga0495619_0145978
689 Ga0500588_0000065
690 Ga0501082_0000011
691 Ga0501082_0484437
692 Ga0530510_0253157
693 Ga0530510_0895812
694 2883293171

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

46

194

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.98 2 171
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9744 2 171
4mb6-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from yersinia pseudotuberculosis. 0.9714 2 171
7xi2-assembly1.cif.gz_B crystal structure of escherichia coli adenine phosphoribosyltransferase (aprt) in complex with phosphate 0.9691 2 171
6fd6-assembly1.cif.gz_B crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) 0.9685 2 171
ID Description Score Start End Superfamily
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9818 2 171 3.40.50.2020
af_P12426_6_182_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.969 2 171 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9679 2 139 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9646 2 173 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9595 2 171 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A849EMC6-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9994 67 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A7J4CZX2-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9977 54 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A3D2PUB3-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9967 114 173 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A7C6XFA1-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9962 2 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A535E6K3-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9958 4 171 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map