F417277

General Info

Members Datasets Scaffolds Average Seq Length
347 200 694 355

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0005467|Ga0495613_0005467_5834_7015
Length 393
Sequence MRIGFFGFPQTGKSTLFRLLTGAAEVPPGARDAVQIGVAKVPDRRLDKLSEMHKPKKTTPATVEYMDLAAIEKGEVADALPLDQLRTVDALAHVTRAFRDESVAHVEGTIDAARDASTMETELILADHTIAERRLEKLEMAVKKQNREEDKKDLDTLKKCLAALEKETPLRNLEFTEDEVKRLRGFTFLSLKPLLVVVNADETDAAKLSQGPAAFGLAAFSERPNTEVVALSAKIETEISQLDAADAAAFRAELSIAEPALDRMIRASYHLLGRLSFFTAGEDECRAWTIRRGTKARQAAGTIHSDIEKGFIRAELCAYDDLVSAGSWAACRDRGTLRLEGKEYVMQDGDVVNFRFNVWGDSYLISLPRISVGRFQRPFPIACGSIAASRGRE

Samples

Sample ID Description Type Environment
1 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0
Rhizoplane 0.86
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 3.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495613_0005467 3300046689 Bacteria 9542
2 Ga0065707_10007591 3300005295 Bacteria 4106
3 Ga0065707_10030466 3300005295 Bacteria 1466
4 Ga0070658_10415125 3300005327 Bacteria 1157
5 Ga0070676_10017606 3300005328 Bacteria 3954
6 Ga0070690_100028900 3300005330 Bacteria 3436
7 Ga0068869_100000964 3300005334 Bacteria 16738
8 Ga0068869_100080967 3300005334 Bacteria 2424
9 Ga0068869_100113198 3300005334 Bacteria 2066
10 Ga0070666_10032972 3300005335 Bacteria 3424
11 Ga0070680_100203027 3300005336 Bacteria 1672
12 Ga0068868_100283245 3300005338 Bacteria 1403
13 Ga0070689_100001368 3300005340 Bacteria 15482
14 Ga0070689_100007372 3300005340 Bacteria 7683
15 Ga0070689_100038600 3300005340 Bacteria 3654
16 Ga0070687_100000876 3300005343 Bacteria 10116
17 Ga0070669_100000006 3300005353 Bacteria 268982
18 Ga0070669_100363693 3300005353 Bacteria 1177
19 Ga0070675_100000001 3300005354 Bacteria 448137
20 Ga0070674_100001871 3300005356 Bacteria 11420
21 Ga0070673_100014017 3300005364 Bacteria 5567
22 Ga0070673_100023651 3300005364 Bacteria 4492
23 Ga0070688_100004724 3300005365 Bacteria 7117
24 Ga0070688_100047635 3300005365 Bacteria 2660
25 Ga0070667_100020949 3300005367 Bacteria 5431
26 Ga0070667_100102230 3300005367 Bacteria 2476
27 Ga0070709_10000020 3300005434 Bacteria 135699
28 Ga0070713_100251268 3300005436 Bacteria 1613
29 Ga0070701_10012922 3300005438 Bacteria 3783
30 Ga0070705_100097757 3300005440 Bacteria 1846
31 Ga0070700_100000098 3300005441 Bacteria 56917
32 Ga0070663_100006632 3300005455 Bacteria 6979
33 Ga0070678_100003316 3300005456 Bacteria 8955
34 Ga0070662_100282865 3300005457 Bacteria 1343
35 Ga0068867_100002075 3300005459 Bacteria 14042
36 Ga0068867_100024901 3300005459 Unclassified 4291
37 Ga0070685_10020933 3300005466 Bacteria 3547
38 Ga0070685_10026452 3300005466 Bacteria 3198
39 Ga0070706_100031048 3300005467 Bacteria 4926
40 Ga0070706_100094114 3300005467 Bacteria 2780
41 Ga0070706_100173306 3300005467 Unclassified 2014
42 Ga0070707_100208910 3300005468 Bacteria 1903
43 Ga0070699_100089024 3300005518 Unclassified 2697
44 Ga0070699_100099725 3300005518 Bacteria 2545
45 Ga0068853_100057998 3300005539 Bacteria 3342
46 Ga0070672_100001706 3300005543 Bacteria 13702
47 Ga0070672_100171860 3300005543 Bacteria 1803
48 Ga0070672_100177902 3300005543 Bacteria 1772
49 Ga0070695_100002479 3300005545 Bacteria 10620
50 Ga0070665_100000260 3300005548 Bacteria 86762
51 Ga0070704_100310385 3300005549 Bacteria 1318
52 Ga0068857_100038555 3300005577 Bacteria 4232
53 Ga0068857_100105121 3300005577 Bacteria 2535
54 Ga0070702_100101651 3300005615 Bacteria 1765
55 Ga0068859_100002191 3300005617 Bacteria 19839
56 Ga0068859_100007914 3300005617 Bacteria 10781
57 Ga0068859_100010819 3300005617 Bacteria 9184
58 Ga0068859_100458005 3300005617 Bacteria 1371
59 Ga0068864_100185537 3300005618 Bacteria 1904
60 Ga0068861_100036549 3300005719 Bacteria 3646
61 Ga0068861_100080201 3300005719 Unclassified 2553
62 Ga0068861_100100910 3300005719 Bacteria 2295
63 Ga0068861_100170367 3300005719 Bacteria 1804
64 Ga0068863_100007204 3300005841 Bacteria 10910
65 Ga0068863_100239018 3300005841 Bacteria 1753
66 Ga0068858_100000223 3300005842 Bacteria 61546
67 Ga0068858_100255168 3300005842 Bacteria 1666
68 Ga0068860_100017112 3300005843 Bacteria 7067
69 Ga0068860_100023224 3300005843 Bacteria 5993
70 Ga0068862_100001184 3300005844 Bacteria 24564
71 Ga0068862_100059475 3300005844 Bacteria 3282
72 Ga0075365_10001234 3300006038 Bacteria 11312
73 Ga0075368_10045381 3300006042 Bacteria 1736
74 Ga0075363_100079559 3300006048 Bacteria 1791
75 Ga0075362_10004535 3300006177 Bacteria 5005
76 Ga0075367_10008035 3300006178 Bacteria 5441
77 Ga0075366_10000322 3300006195 Bacteria 21867
78 Ga0097621_100084196 3300006237 Bacteria 2651
79 Ga0075428_100001446 3300006844 Bacteria 25375
80 Ga0075428_100007388 3300006844 Bacteria 12186
81 Ga0075428_100009291 3300006844 Bacteria 10901
82 Ga0075428_100014476 3300006844 Bacteria 8760
83 Ga0075428_100025654 3300006844 Bacteria 6526
84 Ga0075428_100111938 3300006844 Bacteria 2973
85 Ga0075428_100172493 3300006844 Bacteria 2344
86 Ga0075428_100177707 3300006844 Bacteria 2305
87 Ga0075428_100312763 3300006844 Bacteria 1688
88 Ga0075431_100000373 3300006847 Bacteria 35683
89 Ga0075431_100393791 3300006847 Bacteria 1387
90 Ga0075433_10254095 3300006852 Bacteria 1559
91 Ga0075433_10416262 3300006852 Bacteria 1185
92 Ga0075434_100086237 3300006871 Bacteria 3140
93 Ga0075429_100031394 3300006880 Bacteria 4616
94 Ga0075429_100038477 3300006880 Bacteria 4164
95 Ga0075429_100087902 3300006880 Bacteria 2709
96 Ga0075429_100136816 3300006880 Bacteria 2144
97 Ga0068865_100014920 3300006881 Bacteria 4946
98 Ga0068865_100203596 3300006881 Bacteria 1538
99 Ga0075436_100001914 3300006914 Bacteria 14306
100 Ga0075436_100015596 3300006914 Bacteria 5202
101 Ga0097620_100002191 3300006931 Bacteria 19839
102 Ga0097620_100007914 3300006931 Bacteria 10781
103 Ga0097620_100010819 3300006931 Bacteria 9184
104 Ga0097620_100458022 3300006931 Bacteria 1371
105 Ga0075435_100003713 3300007076 Bacteria 10397
106 Ga0075435_100015475 3300007076 Bacteria 5735
107 Ga0105244_10044262 3300009036 Bacteria 2294
108 Ga0111539_10000017 3300009094 Bacteria 275456
109 Ga0111539_10000156 3300009094 Bacteria 77946
110 Ga0111539_10008484 3300009094 Bacteria 13060
111 Ga0111539_10020485 3300009094 Bacteria 8145
112 Ga0111539_10052496 3300009094 Bacteria 4853
113 Ga0105245_10000248 3300009098 Bacteria 51367
114 Ga0114129_10004469 3300009147 Bacteria 19721
115 Ga0114129_10191446 3300009147 Bacteria 2777
116 Ga0114129_10292083 3300009147 Bacteria 2175
117 Ga0114129_10306433 3300009147 Bacteria 2115
118 Ga0105243_10325855 3300009148 Bacteria 1401
119 Ga0105242_10004158 3300009176 Bacteria 11271
120 Ga0105248_10013204 3300009177 Bacteria 9093
121 Ga0105249_10226365 3300009553 Bacteria 1843
122 Ga0157378_10424270 3300013297 Bacteria 1315
123 Ga0163162_10366128 3300013306 Bacteria 1574
124 Ga0157375_10000018 3300013308 Bacteria 285123
125 Ga0157375_10209981 3300013308 Bacteria 2104
126 Ga0157380_10070402 3300014326 Bacteria 2826
127 Ga0157380_10123543 3300014326 Bacteria 2197
128 Ga0157380_10181169 3300014326 Bacteria 1851
129 Ga0157379_10069715 3300014968 Bacteria 3145
130 Ga0207680_10008459 3300025903 Bacteria 5053
131 Ga0207680_10085109 3300025903 Bacteria 1997
132 Ga0207699_10000026 3300025906 Bacteria 152387
133 Ga0207645_10023944 3300025907 Bacteria 3963
134 Ga0207643_10012589 3300025908 Bacteria 4568
135 Ga0207660_10278403 3300025917 Bacteria 1327
136 Ga0207660_10317761 3300025917 Bacteria 1243
137 Ga0207681_10000006 3300025923 Bacteria 496979
138 Ga0207681_10041530 3300025923 Bacteria 3067
139 Ga0207659_10000004 3300025926 Bacteria 476977
140 Ga0207659_10029316 3300025926 Bacteria 3749
141 Ga0207687_10002375 3300025927 Bacteria 12778
142 Ga0207644_10010882 3300025931 Bacteria 6007
143 Ga0207706_10058868 3300025933 Bacteria 3383
144 Ga0207686_10003139 3300025934 Bacteria 8886
145 Ga0207670_10000685 3300025936 Bacteria 17884
146 Ga0207670_10177482 3300025936 Bacteria 1602
147 Ga0207669_10122703 3300025937 Bacteria 1767
148 Ga0207691_10003359 3300025940 Bacteria 15571
149 Ga0207689_10005018 3300025942 Bacteria 11923
150 Ga0207689_10152543 3300025942 Bacteria 1904
151 Ga0207651_10014432 3300025960 Bacteria 4561
152 Ga0207651_10069502 3300025960 Bacteria 2487
153 Ga0207712_10024881 3300025961 Bacteria 3972
154 Ga0207658_10097713 3300025986 Bacteria 2293
155 Ga0207658_10123382 3300025986 Bacteria 2069
156 Ga0207677_10245269 3300026023 Bacteria 1451
157 Ga0207703_10000307 3300026035 Bacteria 53582
158 Ga0207703_10008893 3300026035 Bacteria 7913
159 Ga0207703_10472999 3300026035 Bacteria 1173
160 Ga0207639_10000003 3300026041 Bacteria 806887
161 Ga0207678_10002372 3300026067 Bacteria 17087
162 Ga0207708_10000027 3300026075 Bacteria 166457
163 Ga0207708_10015602 3300026075 Bacteria 5698
164 Ga0207641_10069927 3300026088 Bacteria 3015
165 Ga0207648_10021347 3300026089 Bacteria 5820
166 Ga0207676_10024620 3300026095 Bacteria 4457
167 Ga0207674_10120096 3300026116 Bacteria 2596
168 Ga0207674_10150480 3300026116 Bacteria 2285
169 Ga0207675_100032256 3300026118 Bacteria 4880
170 Ga0207675_100419568 3300026118 Bacteria 1321
171 Ga0207683_10036080 3300026121 Bacteria 4302
172 Ga0207428_10000010 3300027907 Bacteria 397329
173 Ga0207428_10000070 3300027907 Bacteria 147650
174 Ga0207428_10033586 3300027907 Bacteria 4212
175 Ga0268266_10000524 3300028379 Bacteria 53682
176 Ga0268266_10249892 3300028379 Bacteria 1640
177 Ga0268265_10000248 3300028380 Bacteria 61738
178 Ga0268265_10037463 3300028380 Bacteria 3560
179 Ga0268265_10204794 3300028380 Bacteria 1714
180 Ga0268264_10000818 3300028381 Bacteria 33491
181 Ga0268264_10305384 3300028381 Bacteria 1499
182 Ga0265337_1000130 3300028556 Bacteria 38125
183 Ga0265326_10004386 3300028558 Unclassified 4526
184 Ga0265319_1000232 3300028563 Bacteria 41905
185 Ga0265319_1000288 3300028563 Bacteria 37315
186 Ga0265334_10012410 3300028573 Bacteria 3580
187 Ga0265318_10007015 3300028577 Bacteria 5131
188 Ga0265318_10022564 3300028577 Bacteria 2515
189 Ga0265323_10002237 3300028653 Bacteria 9004
190 Ga0265323_10002521 3300028653 Bacteria 8349
191 Ga0265322_10004641 3300028654 Unclassified 4082
192 Ga0265336_10000148 3300028666 Bacteria 49967
193 Ga0265336_10002809 3300028666 Bacteria 7030
194 Ga0265338_10000434 3300028800 Bacteria 75119
195 Ga0265338_10010771 3300028800 Bacteria 10664
196 Ga0265338_10026898 3300028800 Bacteria 5788
197 Ga0265324_10001627 3300029957 Bacteria 12462
198 Ga0265324_10001852 3300029957 Bacteria 11441
199 Ga0265324_10014417 3300029957 Bacteria 2926
200 Ga0265330_10000006 3300031235 Bacteria 215296
201 Ga0265330_10000581 3300031235 Bacteria 23797
202 Ga0265330_10010907 3300031235 Bacteria 4270
203 Ga0265332_10000057 3300031238 Bacteria 102893
204 Ga0265332_10000430 3300031238 Bacteria 29626
205 Ga0265328_10013109 3300031239 Bacteria 3287
206 Ga0265320_10003793 3300031240 Bacteria 10031
207 Ga0265320_10011138 3300031240 Bacteria 5307
208 Ga0265325_10017901 3300031241 Bacteria 3935
209 Ga0265325_10031039 3300031241 Unclassified 2863
210 Ga0265325_10037342 3300031241 Bacteria 2568
211 Ga0265329_10007949 3300031242 Bacteria 4062
212 Ga0265329_10031726 3300031242 Bacteria 1715
213 Ga0265329_10058424 3300031242 Bacteria 1222
214 Ga0265340_10024100 3300031247 Bacteria 3093
215 Ga0265339_10014679 3300031249 Unclassified 4715
216 Ga0265339_10014977 3300031249 Bacteria 4662
217 Ga0265339_10025037 3300031249 Bacteria 3432
218 Ga0265331_10007368 3300031250 Bacteria 6374
219 Ga0265331_10027953 3300031250 Unclassified 2823
220 Ga0265316_10000023 3300031344 Bacteria 172893
221 Ga0265316_10052230 3300031344 Bacteria 3207
222 Ga0265316_10198183 3300031344 Unclassified 1489
223 Ga0265313_10006413 3300031595 Bacteria 8335
224 Ga0307508_10008654 3300031616 Bacteria 9396
225 Ga0316579_10009071 3300031691 Bacteria 4173
226 Ga0265314_10000019 3300031711 Bacteria 326248
227 Ga0265314_10000422 3300031711 Bacteria 56826
228 Ga0265314_10000489 3300031711 Bacteria 51534
229 Ga0265342_10000010 3300031712 Bacteria 210877
230 Ga0265342_10000508 3300031712 Bacteria 41617
231 Ga0265342_10000749 3300031712 Bacteria 33363
232 Ga0265342_10010556 3300031712 Bacteria 6392
233 Ga0316576_10000763 3300031727 Bacteria 16057
234 Ga0316576_10044493 3300031727 Bacteria 3207
235 Ga0316578_10003420 3300031728 Bacteria 7257
236 Ga0316578_10036624 3300031728 Bacteria 2824
237 Ga0316577_10001709 3300031733 Bacteria 10543
238 Ga0373929_0000036 3300035085 Bacteria 37547
239 Ga0316574_0197954 3300035398 Bacteria 1291
240 Ga0373935_0028005 3300035692 Bacteria 3482
241 Ga0373937_0052178 3300036401 Bacteria 3749
242 Ga0373937_0263175 3300036401 Bacteria 1627
243 Ga0316582_0000974 3300036647 Bacteria 11900
244 Ga0316582_0016711 3300036647 Unclassified 4227
245 Ga0316582_0088070 3300036647 Bacteria 2039
246 Ga0316582_0162107 3300036647 Unclassified 1515
247 Ga0316584_0000413 3300036712 Bacteria 22346
248 Ga0316584_0031660 3300036712 Bacteria 3911
249 Ga0395900_0136134 3300037418 Bacteria 2516
250 Ga0395905_0242560 3300037471 Bacteria 1684
251 Ga0451807_2614649 3300041486 Bacteria 2986
252 Ga0451577_0004852 3300042876 Bacteria 14029
253 Ga0451577_0005792 3300042876 Bacteria 12520
254 Ga0451577_0063485 3300042876 Bacteria 3294
255 Ga0453683_0000016 3300044673 Bacteria 310845
256 Ga0453683_0212960 3300044673 Bacteria 1228
257 Ga0466966_0002191 3300044684 Bacteria 12688
258 Ga0466963_0030991 3300044694 Bacteria 3454
259 Ga0453684_0003523 3300044712 Bacteria 35031
260 Ga0453684_0013020 3300044712 Bacteria 13585
261 Ga0453684_0019822 3300044712 Bacteria 10203
262 Ga0453684_0103117 3300044712 Bacteria 3487
263 Ga0453684_0306742 3300044712 Unclassified 1803
264 Ga0451576_0000011 3300045051 Bacteria 676436
265 Ga0451576_0000645 3300045051 Bacteria 72068
266 Ga0451576_0007251 3300045051 Bacteria 13342
267 Ga0451576_0012063 3300045051 Bacteria 9754
268 Ga0451576_0051085 3300045051 Bacteria 4335
269 Ga0451576_0217536 3300045051 Bacteria 1995
270 Ga0495629_0000315 3300046459 Bacteria 41389
271 Ga0495638_0025481 3300046460 Bacteria 3844
272 Ga0495582_0073480 3300046473 Bacteria 1893
273 Ga0495620_0008487 3300046515 Bacteria 5512
274 Ga0495644_0116430 3300046523 Bacteria 1016
275 Ga0495635_0011042 3300046663 Bacteria 6333
276 Ga0495647_0040793 3300046681 Bacteria 1765
277 Ga0495658_0000708 3300046683 Bacteria 18050
278 Ga0495669_0051128 3300046684 Bacteria 1854
279 Ga0495581_0000556 3300047315 Bacteria 19333
280 Ga0495672_0000242 3300047320 Bacteria 76766
281 Ga0495676_0028487 3300047321 Bacteria 4768
282 Ga0495680_0005933 3300047322 Bacteria 11416
283 Ga0495614_0002981 3300048089 Bacteria 7543
284 Ga0495615_0004630 3300048090 Bacteria 2416
285 Ga0496107_0034385 3300048910 Bacteria 3631
286 Ga0496114_0000026 3300048917 Bacteria 205625
287 Ga0501031_0152737 3300049568 Bacteria 1509
288 Ga0501036_0027095 3300049572 Bacteria 4842
289 Ga0501037_0336480 3300049573 Bacteria 1043
290 Ga0501040_0059609 3300049576 Bacteria 2623
291 Ga0501041_0096016 3300049577 Bacteria 1832
292 Ga0501047_0070298 3300049581 Bacteria 3371
293 Ga0501048_0147667 3300049582 Bacteria 1663
294 Ga0501067_0048205 3300049583 Bacteria 2362
295 Ga0501068_0071244 3300049584 Bacteria 2122
296 Ga0501074_0049997 3300049590 Bacteria 3018
297 Ga0501075_0003090 3300049591 Bacteria 11125
298 Ga0501075_0058544 3300049591 Bacteria 2902
299 Ga0501076_0005951 3300049592 Bacteria 8808
300 Ga0501076_0030376 3300049592 Bacteria 4208
301 Ga0501077_0000847 3300049593 Bacteria 18496
302 Ga0501080_0002908 3300049742 Bacteria 15069
303 Ga0501081_0013888 3300049743 Bacteria 5301
304 Ga0501083_0000271 3300049744 Bacteria 33188
305 nmdc:mga03n38_52153_c1 3300050490 Bacteria 1829
306 nmdc:mga00v17_110078_c1 3300050491 Bacteria 1747
307 nmdc:mga0k408_1023_c1 3300050493 Bacteria 15335
308 nmdc:mga06z11_12137_c1 3300050494 Bacteria 3738
309 nmdc:mga05p37_147195_c1 3300050507 Bacteria 2882
310 nmdc:mga05p37_22566_c1 3300050507 Bacteria 7632
311 nmdc:mga05p37_276849_c1 3300050507 Bacteria 2003
312 nmdc:mga05p37_314026_c1 3300050507 Bacteria 1857
313 nmdc:mga05p37_355746_c1 3300050507 Bacteria 1723
314 nmdc:mga05p37_411762_c1 3300050507 Bacteria 1576
315 nmdc:mga09592_145463_c1 3300050508 Bacteria 2044
316 nmdc:mga09592_99980_c2 3300050508 Bacteria 2143
317 nmdc:mga0qj67_21774_c1 3300050509 Bacteria 4917
318 nmdc:mga06r32_3504_c1 3300050510 Bacteria 14009
319 nmdc:mga06r32_694019_c1 3300050510 Bacteria 984
320 nmdc:mga08y16_1478_c1 3300050511 Bacteria 23587
321 nmdc:mga08y16_15_c1 3300050511 Bacteria 397324
322 nmdc:mga08y16_1915_c1 3300050511 Bacteria 21221
323 nmdc:mga08y16_35336_c1 3300050511 Bacteria 5247
324 nmdc:mga08y16_39190_c1 3300050511 Bacteria 4971
325 nmdc:mga08y16_47930_c1 3300050511 Bacteria 4472
326 nmdc:mga0n895_187805_c1 3300050512 Bacteria 2098
327 nmdc:mga0n895_261733_c1 3300050512 Bacteria 1755
328 nmdc:mga0n895_68103_c1 3300050512 Bacteria 3526
329 nmdc:mga0n895_69024_c1 3300050512 Bacteria 3501
330 nmdc:mga0n895_98583_c1 3300050512 Bacteria 2929
331 nmdc:mga0rr50_24133_c1 3300050513 Bacteria 4208
332 nmdc:mga0rr50_8604_c1 3300050513 Bacteria 6360
333 nmdc:mga08x19_24020_c1 3300050514 Bacteria 3785
334 nmdc:mga08x19_35489_c1 3300050514 Bacteria 3155
335 nmdc:mga0a205_151701_c1 3300050515 Bacteria 2216
336 nmdc:mga0a205_59882_c1 3300050515 Bacteria 3678
337 Ga0495655_0003395 3300053083 Bacteria 2625
338 Ga0495619_0002595 3300053085 Bacteria 11807
339 Ga0501084_0171413 3300054114 Bacteria 1832
340 Ga0501084_0407934 3300054114 Bacteria 1148
341 Ga0501082_0000334 3300060353 Bacteria 41775
342 Ga0501082_0033330 3300060353 Bacteria 4444
343 Ga0501082_0188536 3300060353 Bacteria 1794
344 Ga0501082_0252367 3300060353 Bacteria 1535
345 Ga0501082_0288430 3300060353 Bacteria 1429
346 Ga0530510_0059527 3300061734 Bacteria 2763
347 Ga0530510_0208141 3300061734 Bacteria 1453
348 Ga0495613_0005467
349 Ga0065707_10007591
350 Ga0065707_10030466
351 Ga0070658_10415125
352 Ga0070676_10017606
353 Ga0070690_100028900
354 Ga0068869_100000964
355 Ga0068869_100080967
356 Ga0068869_100113198
357 Ga0070666_10032972
358 Ga0070680_100203027
359 Ga0068868_100283245
360 Ga0070689_100001368
361 Ga0070689_100007372
362 Ga0070689_100038600
363 Ga0070687_100000876
364 Ga0070669_100000006
365 Ga0070669_100363693
366 Ga0070675_100000001
367 Ga0070674_100001871
368 Ga0070673_100014017
369 Ga0070673_100023651
370 Ga0070688_100004724
371 Ga0070688_100047635
372 Ga0070667_100020949
373 Ga0070667_100102230
374 Ga0070709_10000020
375 Ga0070713_100251268
376 Ga0070701_10012922
377 Ga0070705_100097757
378 Ga0070700_100000098
379 Ga0070663_100006632
380 Ga0070678_100003316
381 Ga0070662_100282865
382 Ga0068867_100002075
383 Ga0068867_100024901
384 Ga0070685_10020933
385 Ga0070685_10026452
386 Ga0070706_100031048
387 Ga0070706_100094114
388 Ga0070706_100173306
389 Ga0070707_100208910
390 Ga0070699_100089024
391 Ga0070699_100099725
392 Ga0068853_100057998
393 Ga0070672_100001706
394 Ga0070672_100171860
395 Ga0070672_100177902
396 Ga0070695_100002479
397 Ga0070665_100000260
398 Ga0070704_100310385
399 Ga0068857_100038555
400 Ga0068857_100105121
401 Ga0070702_100101651
402 Ga0068859_100002191
403 Ga0068859_100007914
404 Ga0068859_100010819
405 Ga0068859_100458005
406 Ga0068864_100185537
407 Ga0068861_100036549
408 Ga0068861_100080201
409 Ga0068861_100100910
410 Ga0068861_100170367
411 Ga0068863_100007204
412 Ga0068863_100239018
413 Ga0068858_100000223
414 Ga0068858_100255168
415 Ga0068860_100017112
416 Ga0068860_100023224
417 Ga0068862_100001184
418 Ga0068862_100059475
419 Ga0075365_10001234
420 Ga0075368_10045381
421 Ga0075363_100079559
422 Ga0075362_10004535
423 Ga0075367_10008035
424 Ga0075366_10000322
425 Ga0097621_100084196
426 Ga0075428_100001446
427 Ga0075428_100007388
428 Ga0075428_100009291
429 Ga0075428_100014476
430 Ga0075428_100025654
431 Ga0075428_100111938
432 Ga0075428_100172493
433 Ga0075428_100177707
434 Ga0075428_100312763
435 Ga0075431_100000373
436 Ga0075431_100393791
437 Ga0075433_10254095
438 Ga0075433_10416262
439 Ga0075434_100086237
440 Ga0075429_100031394
441 Ga0075429_100038477
442 Ga0075429_100087902
443 Ga0075429_100136816
444 Ga0068865_100014920
445 Ga0068865_100203596
446 Ga0075436_100001914
447 Ga0075436_100015596
448 Ga0097620_100002191
449 Ga0097620_100007914
450 Ga0097620_100010819
451 Ga0097620_100458022
452 Ga0075435_100003713
453 Ga0075435_100015475
454 Ga0105244_10044262
455 Ga0111539_10000017
456 Ga0111539_10000156
457 Ga0111539_10008484
458 Ga0111539_10020485
459 Ga0111539_10052496
460 Ga0105245_10000248
461 Ga0114129_10004469
462 Ga0114129_10191446
463 Ga0114129_10292083
464 Ga0114129_10306433
465 Ga0105243_10325855
466 Ga0105242_10004158
467 Ga0105248_10013204
468 Ga0105249_10226365
469 Ga0157378_10424270
470 Ga0163162_10366128
471 Ga0157375_10000018
472 Ga0157375_10209981
473 Ga0157380_10070402
474 Ga0157380_10123543
475 Ga0157380_10181169
476 Ga0157379_10069715
477 Ga0207680_10008459
478 Ga0207680_10085109
479 Ga0207699_10000026
480 Ga0207645_10023944
481 Ga0207643_10012589
482 Ga0207660_10278403
483 Ga0207660_10317761
484 Ga0207681_10000006
485 Ga0207681_10041530
486 Ga0207659_10000004
487 Ga0207659_10029316
488 Ga0207687_10002375
489 Ga0207644_10010882
490 Ga0207706_10058868
491 Ga0207686_10003139
492 Ga0207670_10000685
493 Ga0207670_10177482
494 Ga0207669_10122703
495 Ga0207691_10003359
496 Ga0207689_10005018
497 Ga0207689_10152543
498 Ga0207651_10014432
499 Ga0207651_10069502
500 Ga0207712_10024881
501 Ga0207658_10097713
502 Ga0207658_10123382
503 Ga0207677_10245269
504 Ga0207703_10000307
505 Ga0207703_10008893
506 Ga0207703_10472999
507 Ga0207639_10000003
508 Ga0207678_10002372
509 Ga0207708_10000027
510 Ga0207708_10015602
511 Ga0207641_10069927
512 Ga0207648_10021347
513 Ga0207676_10024620
514 Ga0207674_10120096
515 Ga0207674_10150480
516 Ga0207675_100032256
517 Ga0207675_100419568
518 Ga0207683_10036080
519 Ga0207428_10000010
520 Ga0207428_10000070
521 Ga0207428_10033586
522 Ga0268266_10000524
523 Ga0268266_10249892
524 Ga0268265_10000248
525 Ga0268265_10037463
526 Ga0268265_10204794
527 Ga0268264_10000818
528 Ga0268264_10305384
529 Ga0265337_1000130
530 Ga0265326_10004386
531 Ga0265319_1000232
532 Ga0265319_1000288
533 Ga0265334_10012410
534 Ga0265318_10007015
535 Ga0265318_10022564
536 Ga0265323_10002237
537 Ga0265323_10002521
538 Ga0265322_10004641
539 Ga0265336_10000148
540 Ga0265336_10002809
541 Ga0265338_10000434
542 Ga0265338_10010771
543 Ga0265338_10026898
544 Ga0265324_10001627
545 Ga0265324_10001852
546 Ga0265324_10014417
547 Ga0265330_10000006
548 Ga0265330_10000581
549 Ga0265330_10010907
550 Ga0265332_10000057
551 Ga0265332_10000430
552 Ga0265328_10013109
553 Ga0265320_10003793
554 Ga0265320_10011138
555 Ga0265325_10017901
556 Ga0265325_10031039
557 Ga0265325_10037342
558 Ga0265329_10007949
559 Ga0265329_10031726
560 Ga0265329_10058424
561 Ga0265340_10024100
562 Ga0265339_10014679
563 Ga0265339_10014977
564 Ga0265339_10025037
565 Ga0265331_10007368
566 Ga0265331_10027953
567 Ga0265316_10000023
568 Ga0265316_10052230
569 Ga0265316_10198183
570 Ga0265313_10006413
571 Ga0307508_10008654
572 Ga0316579_10009071
573 Ga0265314_10000019
574 Ga0265314_10000422
575 Ga0265314_10000489
576 Ga0265342_10000010
577 Ga0265342_10000508
578 Ga0265342_10000749
579 Ga0265342_10010556
580 Ga0316576_10000763
581 Ga0316576_10044493
582 Ga0316578_10003420
583 Ga0316578_10036624
584 Ga0316577_10001709
585 Ga0373929_0000036
586 Ga0316574_0197954
587 Ga0373935_0028005
588 Ga0373937_0052178
589 Ga0373937_0263175
590 Ga0316582_0000974
591 Ga0316582_0016711
592 Ga0316582_0088070
593 Ga0316582_0162107
594 Ga0316584_0000413
595 Ga0316584_0031660
596 Ga0395900_0136134
597 Ga0395905_0242560
598 Ga0451807_2614649
599 Ga0451577_0004852
600 Ga0451577_0005792
601 Ga0451577_0063485
602 Ga0453683_0000016
603 Ga0453683_0212960
604 Ga0466966_0002191
605 Ga0466963_0030991
606 Ga0453684_0003523
607 Ga0453684_0013020
608 Ga0453684_0019822
609 Ga0453684_0103117
610 Ga0453684_0306742
611 Ga0451576_0000011
612 Ga0451576_0000645
613 Ga0451576_0007251
614 Ga0451576_0012063
615 Ga0451576_0051085
616 Ga0451576_0217536
617 Ga0495629_0000315
618 Ga0495638_0025481
619 Ga0495582_0073480
620 Ga0495620_0008487
621 Ga0495644_0116430
622 Ga0495635_0011042
623 Ga0495647_0040793
624 Ga0495658_0000708
625 Ga0495669_0051128
626 Ga0495581_0000556
627 Ga0495672_0000242
628 Ga0495676_0028487
629 Ga0495680_0005933
630 Ga0495614_0002981
631 Ga0495615_0004630
632 Ga0496107_0034385
633 Ga0496114_0000026
634 Ga0501031_0152737
635 Ga0501036_0027095
636 Ga0501037_0336480
637 Ga0501040_0059609
638 Ga0501041_0096016
639 Ga0501047_0070298
640 Ga0501048_0147667
641 Ga0501067_0048205
642 Ga0501068_0071244
643 Ga0501074_0049997
644 Ga0501075_0003090
645 Ga0501075_0058544
646 Ga0501076_0005951
647 Ga0501076_0030376
648 Ga0501077_0000847
649 Ga0501080_0002908
650 Ga0501081_0013888
651 Ga0501083_0000271
652 nmdc:mga03n38_52153_c1
653 nmdc:mga00v17_110078_c1
654 nmdc:mga0k408_1023_c1
655 nmdc:mga06z11_12137_c1
656 nmdc:mga05p37_147195_c1
657 nmdc:mga05p37_22566_c1
658 nmdc:mga05p37_276849_c1
659 nmdc:mga05p37_314026_c1
660 nmdc:mga05p37_355746_c1
661 nmdc:mga05p37_411762_c1
662 nmdc:mga09592_145463_c1
663 nmdc:mga09592_99980_c2
664 nmdc:mga0qj67_21774_c1
665 nmdc:mga06r32_3504_c1
666 nmdc:mga06r32_694019_c1
667 nmdc:mga08y16_1478_c1
668 nmdc:mga08y16_15_c1
669 nmdc:mga08y16_1915_c1
670 nmdc:mga08y16_35336_c1
671 nmdc:mga08y16_39190_c1
672 nmdc:mga08y16_47930_c1
673 nmdc:mga0n895_187805_c1
674 nmdc:mga0n895_261733_c1
675 nmdc:mga0n895_68103_c1
676 nmdc:mga0n895_69024_c1
677 nmdc:mga0n895_98583_c1
678 nmdc:mga0rr50_24133_c1
679 nmdc:mga0rr50_8604_c1
680 nmdc:mga08x19_24020_c1
681 nmdc:mga08x19_35489_c1
682 nmdc:mga0a205_151701_c1
683 nmdc:mga0a205_59882_c1
684 Ga0495655_0003395
685 Ga0495619_0002595
686 Ga0501084_0171413
687 Ga0501084_0407934
688 Ga0501082_0000334
689 Ga0501082_0033330
690 Ga0501082_0188536
691 Ga0501082_0252367
692 Ga0501082_0288430
693 Ga0530510_0059527
694 Ga0530510_0208141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06071

YchF-GTPase_C

Protein of unknown function (DUF933)

275

357

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ovu-assembly3.cif.gz_D crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form i) 0.9729 124 166
1lt1-assembly1.cif.gz_B sliding helix induced change of coordination geometry in a model di-mn(ii) protein 0.9655 124 166
1ovv-assembly4.cif.gz_D crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form ii) 0.9653 124 166
1ec5-assembly1.cif.gz_A-2 crystal structure of four-helix bundle model 0.9637 124 166
1jm0-assembly2.cif.gz_D crystal structure of four-helix bundle model 0.9632 124 166
ID Description Score Start End Superfamily
af_K7L8F3_337_419_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9944 276 357 3.10.20.30
af_Q7ZU42_294_388_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9937 264 357 3.10.20.30
1lt1D00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9904 124 166 1.20.5.420
af_Q6Z1J6_301_384_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9857 273 354 3.10.20.30
2dbyA02 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9758 275 356 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V5WYR3-F1-model_v4 Redox-regulated ATPase YchF 1.005 286 358 GO:0005737
GO:0016887
AF-S8E599-F1-model_v4 TGS domain-containing protein 0.9972 287 357 GO:0005737
GO:0016887
AF-A0A350VGP6-F1-model_v4 deleted 0.9972 288 358
AF-Q3EN81-F1-model_v4 deleted 0.9952 295 358
AF-A0A095YEM4-F1-model_v4 GTP-binding protein 0.994 261 358 GO:0005737
GO:0016887

Map