F417243

General Info

Members Datasets Scaffolds Average Seq Length
347 232 335 160

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0008943|Ga0466972_0008943_906_1400
Length 164
Sequence VAEQVSMSAFDATLEPERIQLEAFIEDYRTAIERTLDGLTEEQARRRLVPSATTLLGLLKHVTWMQRVWFEQCVGGTPRTEFGVQSVDESFQLGDDDTIATILAAHRKACATARSIVADLPLDTVATGHAAGPRTLRWVYLQVLRELAHHCGHADILREQILAN

Samples

Sample ID Description Type Environment
1 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
2 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
3 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
4 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
5 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
6 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
7 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
8 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
9 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
10 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
232 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 0.29
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.22
Nodule 0
Rhizoplane 10.95
Rhizosphere 70.32
Stem 0
Stem Tuber 0.29
Unclassified 9.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10119039 3300001989 Bacteria 789
2 JGI24735J21928_10085497 3300002067 Bacteria 904
3 JGI24034J26672_10037034 3300002239 Bacteria 810
4 Ga0055540_1000053 3300003792 Bacteria 142520
5 Ga0055540_1018644 3300003792 Bacteria 1896
6 Ga0070683_100092516 3300005329 Bacteria 2840
7 Ga0070683_100131570 3300005329 Bacteria 2368
8 Ga0070683_101385999 3300005329 Bacteria 676
9 Ga0070670_100721104 3300005331 Bacteria 897
10 Ga0070670_100762027 3300005331 Bacteria 873
11 Ga0068869_100472462 3300005334 Bacteria 1043
12 Ga0070666_10037097 3300005335 Bacteria 3239
13 Ga0070682_100116223 3300005337 Bacteria 1789
14 Ga0068868_100238874 3300005338 Bacteria 1526
15 Ga0068868_100245157 3300005338 Bacteria 1507
16 Ga0070689_100267368 3300005340 Bacteria 1415
17 Ga0070668_100063921 3300005347 Bacteria 2853
18 Ga0070675_100592716 3300005354 Bacteria 1005
19 Ga0070671_100004266 3300005355 Bacteria 11309
20 Ga0070671_100012106 3300005355 Bacteria 6942
21 Ga0070671_100994081 3300005355 Bacteria 735
22 Ga0070674_100837933 3300005356 Bacteria 797
23 Ga0070674_101563369 3300005356 Bacteria 594
24 Ga0070667_100018955 3300005367 Bacteria 5705
25 Ga0070667_100077833 3300005367 Bacteria 2833
26 Ga0070709_10047343 3300005434 Bacteria 2678
27 Ga0070709_10276676 3300005434 Bacteria 1218
28 Ga0070714_101011444 3300005435 Bacteria 809
29 Ga0070713_100391186 3300005436 Bacteria 1297
30 Ga0070710_10672367 3300005437 Bacteria 728
31 Ga0070711_100250621 3300005439 Bacteria 1388
32 Ga0070711_100272480 3300005439 Bacteria 1336
33 Ga0070662_100375972 3300005457 Bacteria 1169
34 Ga0070681_10331050 3300005458 Bacteria 1432
35 Ga0070685_10069195 3300005466 Bacteria 2087
36 Ga0070685_10242366 3300005466 Bacteria 1191
37 Ga0070685_10673065 3300005466 Bacteria 752
38 Ga0070679_100194856 3300005530 Bacteria 1994
39 Ga0070684_100039686 3300005535 Bacteria 4051
40 Ga0070684_100112787 3300005535 Bacteria 2439
41 Ga0068853_100539339 3300005539 Bacteria 1104
42 Ga0070672_100707952 3300005543 Bacteria 882
43 Ga0070686_100040262 3300005544 Bacteria 2915
44 Ga0070665_100008906 3300005548 Bacteria 10164
45 Ga0070665_100034821 3300005548 Bacteria 5065
46 Ga0068855_100072189 3300005563 Bacteria 4013
47 Ga0070664_100706533 3300005564 Bacteria 939
48 Ga0068857_100766220 3300005577 Bacteria 920
49 Ga0068856_100276865 3300005614 Bacteria 1694
50 Ga0068856_100805614 3300005614 Bacteria 959
51 Ga0068856_101205864 3300005614 Bacteria 773
52 Ga0068852_100353112 3300005616 Bacteria 1436
53 Ga0068852_100721786 3300005616 Bacteria 1008
54 Ga0068859_100139810 3300005617 Bacteria 2495
55 Ga0068859_100504827 3300005617 Bacteria 1304
56 Ga0068859_101704982 3300005617 Bacteria 696
57 Ga0068864_100595325 3300005618 Bacteria 1073
58 Ga0068864_101656652 3300005618 Bacteria 644
59 Ga0068864_101798442 3300005618 Bacteria 618
60 Ga0068861_100162708 3300005719 Bacteria 1842
61 Ga0068851_10093026 3300005834 Bacteria 1590
62 Ga0068870_10022884 3300005840 Bacteria 3075
63 Ga0068863_100004546 3300005841 Bacteria 13677
64 Ga0068863_100089829 3300005841 Bacteria 2913
65 Ga0068858_100233806 3300005842 Bacteria 1743
66 Ga0068860_100034942 3300005843 Bacteria 4823
67 Ga0068862_101573444 3300005844 Bacteria 664
68 Ga0081455_10076477 3300005937 Bacteria 2758
69 Ga0081539_10041606 3300005985 Bacteria 2684
70 Ga0070717_10914367 3300006028 Bacteria 799
71 Ga0070717_10921302 3300006028 Bacteria 796
72 Ga0075365_10004619 3300006038 Bacteria 7327
73 Ga0075365_10301026 3300006038 Bacteria 1128
74 Ga0075365_10588265 3300006038 Bacteria 787
75 Ga0075363_100007709 3300006048 Bacteria 4969
76 Ga0075363_100664449 3300006048 Bacteria 628
77 Ga0075364_10001156 3300006051 Bacteria 14115
78 Ga0075364_10009494 3300006051 Bacteria 5840
79 Ga0070716_100103755 3300006173 Bacteria 1749
80 Ga0070712_100030396 3300006175 Bacteria 3628
81 Ga0070712_100092372 3300006175 Bacteria 2219
82 Ga0075362_10345635 3300006177 Bacteria 744
83 Ga0075367_10036713 3300006178 Bacteria 2844
84 Ga0075369_10003724 3300006186 Bacteria 5578
85 Ga0075370_10021826 3300006353 Bacteria 3509
86 Ga0075370_10065013 3300006353 Bacteria 2081
87 Ga0075370_10392727 3300006353 Bacteria 832
88 Ga0075431_101147821 3300006847 Bacteria 741
89 Ga0097620_100139811 3300006931 Bacteria 2495
90 Ga0097620_100504821 3300006931 Bacteria 1304
91 Ga0097620_101705287 3300006931 Bacteria 696
92 Ga0099795_10393831 3300007788 Bacteria 628
93 Ga0111539_11479772 3300009094 Bacteria 788
94 Ga0111539_12367991 3300009094 Bacteria 616
95 Ga0105245_10120295 3300009098 Bacteria 2452
96 Ga0105245_11272090 3300009098 Bacteria 784
97 Ga0105247_10180936 3300009101 Bacteria 1407
98 Ga0105247_10371352 3300009101 Bacteria 1011
99 Ga0105243_10145150 3300009148 Bacteria 2030
100 Ga0105243_12136208 3300009148 Bacteria 596
101 Ga0105242_10191913 3300009176 Bacteria 1809
102 Ga0105248_10755116 3300009177 Bacteria 1098
103 Ga0105237_11671869 3300009545 Bacteria 644
104 Ga0105238_10195841 3300009551 Bacteria 1996
105 Ga0105238_10201529 3300009551 Bacteria 1965
106 Ga0105238_11110364 3300009551 Bacteria 814
107 Ga0105249_10435499 3300009553 Bacteria 1347
108 Ga0105249_10719911 3300009553 Bacteria 1059
109 Ga0105249_11091998 3300009553 Bacteria 868
110 Ga0105239_10021909 3300010375 Bacteria 7044
111 Ga0105239_10310617 3300010375 Bacteria 1777
112 Ga0105246_10039747 3300011119 Bacteria 3171
113 Ga0157369_10765449 3300013105 Bacteria 993
114 Ga0163162_10931204 3300013306 Bacteria 981
115 Ga0157372_12489481 3300013307 Bacteria 594
116 Ga0157375_10447488 3300013308 Bacteria 1457
117 Ga0157377_10231419 3300014745 Bacteria 1188
118 Ga0157379_10073109 3300014968 Bacteria 3068
119 Ga0157379_11774223 3300014968 Bacteria 606
120 Ga0157376_10372592 3300014969 Bacteria 1373
121 Ga0213876_10020259 3300021384 Bacteria 3514
122 Ga0209051_1000021 3300025303 Bacteria 507633
123 Ga0209051_1001074 3300025303 Bacteria 25369
124 Ga0209051_1011309 3300025303 Bacteria 4416
125 Ga0207692_10276254 3300025898 Bacteria 1015
126 Ga0207710_10171802 3300025900 Bacteria 1060
127 Ga0207688_10055069 3300025901 Bacteria 2232
128 Ga0207680_10013381 3300025903 Bacteria 4213
129 Ga0207680_10384003 3300025903 Bacteria 990
130 Ga0207699_10224455 3300025906 Bacteria 1284
131 Ga0207643_10101516 3300025908 Bacteria 1687
132 Ga0207654_10240205 3300025911 Bacteria 1210
133 Ga0207707_10891290 3300025912 Bacteria 736
134 Ga0207671_10015571 3300025914 Bacteria 5948
135 Ga0207671_11365684 3300025914 Bacteria 550
136 Ga0207693_10174023 3300025915 Bacteria 1694
137 Ga0207693_10568250 3300025915 Bacteria 884
138 Ga0207693_10893842 3300025915 Bacteria 682
139 Ga0207663_10166436 3300025916 Bacteria 1562
140 Ga0207663_10283881 3300025916 Bacteria 1231
141 Ga0207662_11133075 3300025918 Bacteria 556
142 Ga0207657_10302968 3300025919 Bacteria 1266
143 Ga0207649_10846417 3300025920 Bacteria 715
144 Ga0207652_10588507 3300025921 Bacteria 998
145 Ga0207694_10821103 3300025924 Bacteria 785
146 Ga0207650_10066706 3300025925 Bacteria 2699
147 Ga0207650_10705129 3300025925 Bacteria 853
148 Ga0207650_11292863 3300025925 Bacteria 621
149 Ga0207659_10445761 3300025926 Bacteria 1089
150 Ga0207687_10275196 3300025927 Bacteria 1347
151 Ga0207700_10438228 3300025928 Bacteria 1150
152 Ga0207700_10471172 3300025928 Bacteria 1109
153 Ga0207664_10945697 3300025929 Bacteria 773
154 Ga0207644_10001978 3300025931 Bacteria 13252
155 Ga0207690_10015445 3300025932 Bacteria 4628
156 Ga0207706_10228575 3300025933 Bacteria 1628
157 Ga0207709_10277473 3300025935 Bacteria 1236
158 Ga0207709_11050624 3300025935 Bacteria 667
159 Ga0207709_11301713 3300025935 Bacteria 600
160 Ga0207670_10246879 3300025936 Bacteria 1378
161 Ga0207689_10100727 3300025942 Bacteria 2373
162 Ga0207661_10194909 3300025944 Bacteria 1778
163 Ga0207667_10241957 3300025949 Bacteria 1846
164 Ga0207712_10766732 3300025961 Bacteria 846
165 Ga0207640_11764545 3300025981 Bacteria 559
166 Ga0207658_10384619 3300025986 Bacteria 1230
167 Ga0207658_11153643 3300025986 Bacteria 708
168 Ga0207677_10429608 3300026023 Bacteria 1127
169 Ga0207703_10365009 3300026035 Bacteria 1332
170 Ga0207678_10065274 3300026067 Bacteria 3126
171 Ga0207678_10702210 3300026067 Bacteria 890
172 Ga0207641_10012951 3300026088 Bacteria 6842
173 Ga0207641_10233649 3300026088 Bacteria 1710
174 Ga0207676_10038687 3300026095 Bacteria 3643
175 Ga0207676_10053470 3300026095 Bacteria 3161
176 Ga0207674_10037787 3300026116 Bacteria 5017
177 Ga0207674_11131828 3300026116 Bacteria 752
178 Ga0207683_10296998 3300026121 Bacteria 1478
179 Ga0207698_11207615 3300026142 Bacteria 770
180 Ga0268266_10003652 3300028379 Bacteria 15207
181 Ga0268266_10100727 3300028379 Bacteria 2545
182 Ga0268265_10360434 3300028380 Bacteria 1331
183 Ga0268264_10005987 3300028381 Bacteria 10298
184 Ga0268264_11217612 3300028381 Bacteria 762
185 Ga0265760_10173274 3300031090 Bacteria 717
186 Ga0265327_10003585 3300031251 Bacteria 14659
187 Ga0307513_10056489 3300031456 Bacteria 4190
188 Ga0307508_10236621 3300031616 Bacteria 1424
189 Ga0307508_10433073 3300031616 Bacteria 907
190 Ga0307510_10357096 3300033180 Bacteria 910
191 Ga0373923_0388948 3300035111 Bacteria 670
192 Ga0373936_0204597 3300035113 Bacteria 872
193 Ga0373945_0057384 3300035116 Bacteria 1446
194 Ga0373931_0617856 3300035691 Bacteria 710
195 Ga0373935_0394267 3300035692 Bacteria 993
196 Ga0373933_0457390 3300035724 Bacteria 835
197 Ga0373947_0501400 3300035725 Bacteria 825
198 Ga0373937_0139432 3300036401 Bacteria 2268
199 Ga0373937_0166741 3300036401 Bacteria 2066
200 Ga0373925_0026641 3300037068 Bacteria 4231
201 Ga0395898_0393744 3300037466 Bacteria 1321
202 Ga0395901_1625393 3300038443 Bacteria 599
203 Ga0436365_0222005 3300039437 Bacteria 15346
204 Ga0451800_1151343 3300041459 Bacteria 692
205 Ga0451853_1144723 3300041512 Bacteria 810
206 Ga0439448_0023207 3300042005 Bacteria 1933
207 Ga0439449_0068503 3300042007 Bacteria 1308
208 Ga0466969_0031824 3300044656 Bacteria 2684
209 Ga0466969_0509072 3300044656 Bacteria 550
210 Ga0466972_0008943 3300044658 Bacteria 5023
211 Ga0466972_0478965 3300044658 Bacteria 585
212 Ga0466965_0027362 3300044683 Bacteria 2768
213 Ga0466968_0001308 3300044735 Bacteria 8900
214 Ga0466970_0008273 3300044765 Bacteria 5229
215 Ga0466970_0019547 3300044765 Bacteria 3512
216 Ga0466970_0135860 3300044765 Bacteria 1352
217 Ga0466970_0556352 3300044765 Bacteria 663
218 Ga0466970_0754201 3300044765 Bacteria 569
219 Ga0466957_0101242 3300044842 Bacteria 1816
220 Ga0466957_0194764 3300044842 Bacteria 1329
221 Ga0466960_0002658 3300044901 Bacteria 6740
222 Ga0466959_0131864 3300045049 Bacteria 1771
223 Ga0466959_0146855 3300045049 Bacteria 1663
224 Ga0466959_0234678 3300045049 Bacteria 1269
225 Ga0466958_0078271 3300045836 Bacteria 2032
226 Ga0466958_0517812 3300045836 Bacteria 774
227 Ga0466967_0209208 3300045976 Bacteria 1850
228 Ga0466967_1629292 3300045976 Bacteria 643
229 Ga0495629_0338395 3300046459 Bacteria 1028
230 Ga0495651_0593098 3300046462 Bacteria 700
231 Ga0495653_0196995 3300046463 Bacteria 1370
232 Ga0495650_0020697 3300046471 Bacteria 3201
233 Ga0495664_0073795 3300046477 Bacteria 2040
234 Ga0495608_0450557 3300046511 Bacteria 783
235 Ga0495628_0097916 3300046516 Bacteria 2266
236 Ga0495630_0379486 3300046517 Bacteria 1083
237 Ga0495666_0477417 3300046526 Bacteria 558
238 Ga0495652_0349008 3300046529 Bacteria 1061
239 Ga0495640_0042947 3300046533 Bacteria 3151
240 Ga0495586_0215385 3300046535 Bacteria 1091
241 Ga0495645_0270894 3300046543 Bacteria 1121
242 Ga0495646_0085953 3300046680 Bacteria 1825
243 Ga0495649_0353729 3300046694 Bacteria 742
244 Ga0495674_0006057 3300047319 Bacteria 11605
245 Ga0495684_0110762 3300047471 Bacteria 2072
246 Ga0495602_0380008 3300048088 Bacteria 1012
247 Ga0496100_0000074 3300048903 Bacteria 55196
248 Ga0496100_0001023 3300048903 Bacteria 13514
249 Ga0496100_0602694 3300048903 Bacteria 853
250 Ga0496100_0856032 3300048903 Bacteria 713
251 Ga0496101_0000017 3300048904 Bacteria 239153
252 Ga0496101_0000446 3300048904 Bacteria 26313
253 Ga0496101_1310948 3300048904 Bacteria 566
254 Ga0496102_0000007 3300048905 Bacteria 417224
255 Ga0496102_0024906 3300048905 Bacteria 5322
256 Ga0496103_0000071 3300048906 Bacteria 119931
257 Ga0496103_0077276 3300048906 Bacteria 2090
258 Ga0496104_0023408 3300048907 Bacteria 5679
259 Ga0496104_0450478 3300048907 Bacteria 1199
260 Ga0496104_0641837 3300048907 Bacteria 971
261 Ga0496106_0000742 3300048909 Bacteria 23500
262 Ga0496106_0015503 3300048909 Bacteria 5639
263 Ga0496107_0000138 3300048910 Bacteria 35984
264 Ga0496107_0164749 3300048910 Bacteria 1643
265 Ga0496107_1198744 3300048910 Bacteria 546
266 Ga0496108_0022666 3300048911 Bacteria 5165
267 Ga0496108_0089192 3300048911 Bacteria 2621
268 Ga0496108_0450599 3300048911 Bacteria 1124
269 Ga0496109_0000240 3300048912 Bacteria 53111
270 Ga0496109_0161086 3300048912 Bacteria 2102
271 Ga0496110_0039812 3300048913 Bacteria 4093
272 Ga0496110_0101903 3300048913 Bacteria 2574
273 Ga0496110_0536597 3300048913 Bacteria 1064
274 Ga0496111_0044160 3300048914 Bacteria 3203
275 Ga0496111_0190386 3300048914 Bacteria 1525
276 Ga0496112_0188054 3300048915 Bacteria 2028
277 Ga0496112_0892917 3300048915 Bacteria 811
278 Ga0496113_0024067 3300048916 Bacteria 4324
279 Ga0496113_0047460 3300048916 Bacteria 3191
280 Ga0496113_0111764 3300048916 Bacteria 2128
281 Ga0496114_0000337 3300048917 Bacteria 34136
282 Ga0496114_0516527 3300048917 Bacteria 1056
283 Ga0496115_0430530 3300048918 Bacteria 1068
284 Ga0496116_0000033 3300048919 Bacteria 418191
285 Ga0496116_0013533 3300048919 Bacteria 6567
286 Ga0496117_0000025 3300048920 Bacteria 418106
287 Ga0496118_0000023 3300048921 Bacteria 418106
288 Ga0496118_0013831 3300048921 Bacteria 7597
289 Ga0496119_0003841 3300048922 Bacteria 15343
290 Ga0496120_0000281 3300048923 Bacteria 85648
291 Ga0496120_0249904 3300048923 Bacteria 833
292 Ga0496121_0000014 3300048924 Bacteria 609379
293 Ga0496121_0000642 3300048924 Bacteria 65239
294 Ga0496122_0000097 3300048925 Bacteria 199223
295 Ga0496122_0045093 3300048925 Bacteria 3431
296 Ga0496123_0010054 3300048926 Bacteria 8421
297 Ga0496123_0013708 3300048926 Bacteria 6778
298 Ga0496124_0000019 3300048927 Bacteria 436995
299 Ga0496125_0000014 3300048928 Bacteria 610124
300 Ga0496126_0000017 3300048929 Bacteria 610676
301 Ga0496126_0000027 3300048929 Bacteria 396518
302 Ga0496126_0000189 3300048929 Bacteria 138921
303 Ga0496126_0003469 3300048929 Bacteria 19899
304 Ga0501033_0024256 3300049570 Bacteria 4576
305 Ga0501034_0789506 3300049571 Bacteria 843
306 Ga0501036_0057765 3300049572 Bacteria 3287
307 Ga0501041_0381728 3300049577 Bacteria 892
308 Ga0501046_0150645 3300049580 Bacteria 1755
309 Ga0501047_0035390 3300049581 Bacteria 4824
310 Ga0501047_0372081 3300049581 Bacteria 1264
311 Ga0501070_0017640 3300049586 Bacteria 5993
312 Ga0501071_0645041 3300049587 Bacteria 815
313 Ga0501080_0760434 3300049742 Bacteria 852
314 Ga0501044_0001844 3300049823 Bacteria 24644
315 Ga0501044_0206367 3300049823 Bacteria 1921
316 Ga0501045_0032234 3300049824 Bacteria 3797
317 nmdc:mga03683_73642_c1 3300050489 Bacteria 1464
318 nmdc:mga03n38_15068_c1 3300050490 Bacteria 2978
319 nmdc:mga03n38_75663_c1 3300050490 Bacteria 1569
320 nmdc:mga00v17_15636_c1 3300050491 Bacteria 4262
321 nmdc:mga00v17_20888_c1 3300050491 Bacteria 3757
322 nmdc:mga0yw44_286131_c1 3300050492 Bacteria 1102
323 nmdc:mga0yw44_29880_c1 3300050492 Bacteria 3151
324 nmdc:mga06z11_66817_c1 3300050494 Bacteria 1891
325 nmdc:mga06z11_741170_c1 3300050494 Bacteria 599
326 nmdc:mga04h51_355558_c1 3300050495 Bacteria 606
327 nmdc:mga06r32_1153839_c1 3300050510 Bacteria 722
328 nmdc:mga08y16_1140539_c1 3300050511 Bacteria 753
329 nmdc:mga08y16_1269494_c1 3300050511 Bacteria 704
330 nmdc:mga08y16_1467074_c1 3300050511 Bacteria 643
331 nmdc:mga0sz30_11719_c1 3300050516 Bacteria 3394
332 nmdc:mga0sz30_44164_c1 3300050516 Bacteria 1877
333 Ga0495601_0188856 3300053077 Bacteria 1347
334 Ga0500556_0018664 3300053104 Bacteria 2193
335 Ga0500616_0018803 3300053153 Bacteria 3903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0789506 Ga0501034_0789506_246_725 146
2 3300009098 Ga0105245_11272090 Ga0105245_112720902 151
3 3300042005 Ga0439448_0023207 Ga0439448_0023207_1418_1903 151
4 3300002067 JGI24735J21928_10085497 JGI24735J21928_100854971 152
5 3300002239 JGI24034J26672_10037034 JGI24034J26672_100370342 152
6 3300005331 Ga0070670_100721104 Ga0070670_1007211041 152
7 3300005355 Ga0070671_100012106 Ga0070671_1000121062 152
8 3300005367 Ga0070667_100077833 Ga0070667_1000778332 152
9 3300005843 Ga0068860_100034942 Ga0068860_1000349425 152
10 3300025925 Ga0207650_11292863 Ga0207650_112928631 152
11 3300025986 Ga0207658_10384619 Ga0207658_103846192 152
12 3300028379 Ga0268266_10003652 Ga0268266_100036522 152
13 3300028381 Ga0268264_10005987 Ga0268264_1000598711 152
14 3300049570 Ga0501033_0024256 Ga0501033_0024256_2954_3442 152
15 3300049823 Ga0501044_0001844 Ga0501044_0001844_954_1442 152
16 3300050511 nmdc:mga08y16_1140539_c1 nmdc:mga08y16_1140539_c1_130_609 152
17 3300041459 Ga0451800_1151343 Ga0451800_1151343_122_601 153
18 iso_pu_bacteria 2675903058 2676474639 155
19 iso_pu_bacteria 2791354901 2791911797 155
20 iso_pu_bacteria 2808606522 2809588865 155
21 iso_pu_bacteria 2818991472 2819746043 155
22 iso_pu_bacteria 2827628540 2827632887 155
23 iso_pu_bacteria 2870721527 2870725089 155
24 iso_pu_bacteria 2899370129 2899374953 155
25 iso_pu_bacteria 2995463766 2995466844 155
26 3300014968 Ga0157379_11774223 Ga0157379_117742231 156
27 iso_pu_bacteria 2902792274 2902797844 157
28 3300044656 Ga0466969_0509072 Ga0466969_0509072_11_487 158
29 3300044658 Ga0466972_0008943 Ga0466972_0008943_906_1400 158
30 3300044683 Ga0466965_0027362 Ga0466965_0027362_645_1139 158
31 3300044735 Ga0466968_0001308 Ga0466968_0001308_4234_4728 158
32 3300044765 Ga0466970_0008273 Ga0466970_0008273_3963_4457 158
33 3300044842 Ga0466957_0101242 Ga0466957_0101242_1072_1566 158
34 3300044901 Ga0466960_0002658 Ga0466960_0002658_4046_4540 158
35 3300045049 Ga0466959_0146855 Ga0466959_0146855_809_1303 158
36 3300045976 Ga0466967_0209208 Ga0466967_0209208_33_527 158
37 3300005329 Ga0070683_100131570 Ga0070683_1001315703 159
38 3300005329 Ga0070683_101385999 Ga0070683_1013859992 159
39 3300005338 Ga0068868_100245157 Ga0068868_1002451572 159
40 3300005347 Ga0070668_100063921 Ga0070668_1000639212 159
41 3300005355 Ga0070671_100004266 Ga0070671_1000042662 159
42 3300005355 Ga0070671_100994081 Ga0070671_1009940811 159
43 3300005356 Ga0070674_100837933 Ga0070674_1008379332 159
44 3300005367 Ga0070667_100018955 Ga0070667_1000189552 159
45 3300005434 Ga0070709_10276676 Ga0070709_102766762 159
46 3300005435 Ga0070714_101011444 Ga0070714_1010114441 159
47 3300005437 Ga0070710_10672367 Ga0070710_106723671 159
48 3300005439 Ga0070711_100272480 Ga0070711_1002724801 159
49 3300005458 Ga0070681_10331050 Ga0070681_103310501 159
50 3300005466 Ga0070685_10069195 Ga0070685_100691952 159
51 3300005466 Ga0070685_10673065 Ga0070685_106730651 159
52 3300005530 Ga0070679_100194856 Ga0070679_1001948563 159
53 3300005535 Ga0070684_100039686 Ga0070684_1000396866 159
54 3300005544 Ga0070686_100040262 Ga0070686_1000402622 159
55 3300005548 Ga0070665_100008906 Ga0070665_1000089066 159
56 3300005577 Ga0068857_100766220 Ga0068857_1007662202 159
57 3300005614 Ga0068856_100805614 Ga0068856_1008056142 159
58 3300005614 Ga0068856_101205864 Ga0068856_1012058642 159
59 3300005617 Ga0068859_100139810 Ga0068859_1001398102 159
60 3300005617 Ga0068859_100504827 Ga0068859_1005048273 159
61 3300005618 Ga0068864_101656652 Ga0068864_1016566521 159
62 3300005618 Ga0068864_101798442 Ga0068864_1017984422 159
63 3300005841 Ga0068863_100004546 Ga0068863_10000454610 159
64 3300005844 Ga0068862_101573444 Ga0068862_1015734441 159
65 3300005937 Ga0081455_10076477 Ga0081455_100764772 159
66 3300005985 Ga0081539_10041606 Ga0081539_100416062 159
67 3300006028 Ga0070717_10914367 Ga0070717_109143672 159
68 3300006028 Ga0070717_10921302 Ga0070717_109213021 159
69 3300006038 Ga0075365_10004619 Ga0075365_100046198 159
70 3300006038 Ga0075365_10301026 Ga0075365_103010262 159
71 3300006038 Ga0075365_10588265 Ga0075365_105882651 159
72 3300006048 Ga0075363_100007709 Ga0075363_1000077092 159
73 3300006048 Ga0075363_100664449 Ga0075363_1006644492 159
74 3300006051 Ga0075364_10001156 Ga0075364_100011562 159
75 3300006051 Ga0075364_10009494 Ga0075364_100094944 159
76 3300006175 Ga0070712_100092372 Ga0070712_1000923722 159
77 3300006177 Ga0075362_10345635 Ga0075362_103456352 159
78 3300006186 Ga0075369_10003724 Ga0075369_100037246 159
79 3300006353 Ga0075370_10065013 Ga0075370_100650131 159
80 3300006353 Ga0075370_10392727 Ga0075370_103927271 159
81 3300006847 Ga0075431_101147821 Ga0075431_1011478211 159
82 3300006931 Ga0097620_100139811 Ga0097620_1001398112 159
83 3300006931 Ga0097620_100504821 Ga0097620_1005048213 159
84 3300007788 Ga0099795_10393831 Ga0099795_103938311 159
85 3300009094 Ga0111539_12367991 Ga0111539_123679911 159
86 3300009101 Ga0105247_10180936 Ga0105247_101809362 159
87 3300009148 Ga0105243_12136208 Ga0105243_121362081 159
88 3300009545 Ga0105237_11671869 Ga0105237_116718691 159
89 3300009551 Ga0105238_11110364 Ga0105238_111103642 159
90 3300009553 Ga0105249_10435499 Ga0105249_104354992 159
91 3300009553 Ga0105249_10719911 Ga0105249_107199112 159
92 3300009553 Ga0105249_11091998 Ga0105249_110919981 159
93 3300013105 Ga0157369_10765449 Ga0157369_107654492 159
94 3300013307 Ga0157372_12489481 Ga0157372_124894811 159
95 3300025303 Ga0209051_1011309 Ga0209051_10113091 159
96 3300025898 Ga0207692_10276254 Ga0207692_102762541 159
97 3300025914 Ga0207671_11365684 Ga0207671_113656841 159
98 3300025915 Ga0207693_10568250 Ga0207693_105682501 159
99 3300025915 Ga0207693_10893842 Ga0207693_108938421 159
100 3300025916 Ga0207663_10283881 Ga0207663_102838812 159
101 3300025919 Ga0207657_10302968 Ga0207657_103029681 159
102 3300025920 Ga0207649_10846417 Ga0207649_108464171 159
103 3300025921 Ga0207652_10588507 Ga0207652_105885072 159
104 3300025925 Ga0207650_10066706 Ga0207650_100667062 159
105 3300025928 Ga0207700_10438228 Ga0207700_104382281 159
106 3300025929 Ga0207664_10945697 Ga0207664_109456971 159
107 3300025931 Ga0207644_10001978 Ga0207644_1000197813 159
108 3300025935 Ga0207709_11050624 Ga0207709_110506241 159
109 3300025935 Ga0207709_11301713 Ga0207709_113017131 159
110 3300025961 Ga0207712_10766732 Ga0207712_107667321 159
111 3300026035 Ga0207703_10365009 Ga0207703_103650092 159
112 3300026067 Ga0207678_10702210 Ga0207678_107022101 159
113 3300026088 Ga0207641_10012951 Ga0207641_100129514 159
114 3300026095 Ga0207676_10038687 Ga0207676_100386874 159
115 3300026116 Ga0207674_11131828 Ga0207674_111318281 159
116 3300028379 Ga0268266_10100727 Ga0268266_101007272 159
117 3300028380 Ga0268265_10360434 Ga0268265_103604342 159
118 3300028381 Ga0268264_11217612 Ga0268264_112176121 159
119 3300031090 Ga0265760_10173274 Ga0265760_101732741 159
120 3300031616 Ga0307508_10236621 Ga0307508_102366211 159
121 3300031616 Ga0307508_10433073 Ga0307508_104330731 159
122 3300033180 Ga0307510_10357096 Ga0307510_103570962 159
123 3300035111 Ga0373923_0388948 Ga0373923_0388948_128_607 159
124 3300035113 Ga0373936_0204597 Ga0373936_0204597_31_510 159
125 3300035116 Ga0373945_0057384 Ga0373945_0057384_61_540 159
126 3300035691 Ga0373931_0617856 Ga0373931_0617856_177_656 159
127 3300035692 Ga0373935_0394267 Ga0373935_0394267_24_503 159
128 3300035724 Ga0373933_0457390 Ga0373933_0457390_45_524 159
129 3300035725 Ga0373947_0501400 Ga0373947_0501400_87_566 159
130 3300036401 Ga0373937_0139432 Ga0373937_0139432_1579_2058 159
131 3300037068 Ga0373925_0026641 Ga0373925_0026641_3464_3943 159
132 3300037466 Ga0395898_0393744 Ga0395898_0393744_62_541 159
133 3300038443 Ga0395901_1625393 Ga0395901_1625393_68_547 159
134 3300041512 Ga0451853_1144723 Ga0451853_1144723_272_751 159
135 3300042007 Ga0439449_0068503 Ga0439449_0068503_155_634 159
136 3300044656 Ga0466969_0031824 Ga0466969_0031824_1094_1573 159
137 3300044658 Ga0466972_0478965 Ga0466972_0478965_50_532 159
138 3300044765 Ga0466970_0019547 Ga0466970_0019547_1683_2162 159
139 3300044765 Ga0466970_0135860 Ga0466970_0135860_33_524 159
140 3300044765 Ga0466970_0556352 Ga0466970_0556352_11_490 159
141 3300044765 Ga0466970_0754201 Ga0466970_0754201_69_548 159
142 3300044842 Ga0466957_0194764 Ga0466957_0194764_675_1154 159
143 3300045049 Ga0466959_0131864 Ga0466959_0131864_673_1209 159
144 3300045049 Ga0466959_0234678 Ga0466959_0234678_486_965 159
145 3300045836 Ga0466958_0078271 Ga0466958_0078271_1129_1608 159
146 3300045836 Ga0466958_0517812 Ga0466958_0517812_218_754 159
147 3300045976 Ga0466967_1629292 Ga0466967_1629292_61_540 159
148 3300046459 Ga0495629_0338395 Ga0495629_0338395_356_835 159
149 3300046462 Ga0495651_0593098 Ga0495651_0593098_189_668 159
150 3300046463 Ga0495653_0196995 Ga0495653_0196995_40_519 159
151 3300046471 Ga0495650_0020697 Ga0495650_0020697_390_869 159
152 3300046477 Ga0495664_0073795 Ga0495664_0073795_1274_1753 159
153 3300046511 Ga0495608_0450557 Ga0495608_0450557_138_617 159
154 3300046516 Ga0495628_0097916 Ga0495628_0097916_1754_2233 159
155 3300046517 Ga0495630_0379486 Ga0495630_0379486_427_906 159
156 3300046526 Ga0495666_0477417 Ga0495666_0477417_10_489 159
157 3300046529 Ga0495652_0349008 Ga0495652_0349008_143_622 159
158 3300046533 Ga0495640_0042947 Ga0495640_0042947_2468_2947 159
159 3300046535 Ga0495586_0215385 Ga0495586_0215385_71_550 159
160 3300046543 Ga0495645_0270894 Ga0495645_0270894_88_567 159
161 3300046680 Ga0495646_0085953 Ga0495646_0085953_1167_1646 159
162 3300047319 Ga0495674_0006057 Ga0495674_0006057_545_1024 159
163 3300047471 Ga0495684_0110762 Ga0495684_0110762_115_594 159
164 3300048088 Ga0495602_0380008 Ga0495602_0380008_223_702 159
165 3300048903 Ga0496100_0602694 Ga0496100_0602694_274_753 159
166 3300048903 Ga0496100_0856032 Ga0496100_0856032_82_561 159
167 3300048904 Ga0496101_1310948 Ga0496101_1310948_17_496 159
168 3300048905 Ga0496102_0024906 Ga0496102_0024906_1371_1850 159
169 3300048906 Ga0496103_0077276 Ga0496103_0077276_135_614 159
170 3300048907 Ga0496104_0023408 Ga0496104_0023408_5070_5549 159
171 3300048907 Ga0496104_0641837 Ga0496104_0641837_153_632 159
172 3300048910 Ga0496107_1198744 Ga0496107_1198744_35_514 159
173 3300048911 Ga0496108_0089192 Ga0496108_0089192_2097_2576 159
174 3300048912 Ga0496109_0161086 Ga0496109_0161086_1504_1983 159
175 3300048913 Ga0496110_0101903 Ga0496110_0101903_1947_2426 159
176 3300048914 Ga0496111_0190386 Ga0496111_0190386_418_897 159
177 3300048915 Ga0496112_0188054 Ga0496112_0188054_549_1028 159
178 3300048916 Ga0496113_0047460 Ga0496113_0047460_2600_3079 159
179 3300048918 Ga0496115_0430530 Ga0496115_0430530_237_716 159
180 3300048923 Ga0496120_0249904 Ga0496120_0249904_49_528 159
181 3300048925 Ga0496122_0045093 Ga0496122_0045093_1668_2147 159
182 3300048926 Ga0496123_0013708 Ga0496123_0013708_4771_5250 159
183 3300048929 Ga0496126_0003469 Ga0496126_0003469_6026_6505 159
184 3300049580 Ga0501046_0150645 Ga0501046_0150645_137_616 159
185 3300049581 Ga0501047_0035390 Ga0501047_0035390_545_1024 159
186 3300049586 Ga0501070_0017640 Ga0501070_0017640_1190_1669 159
187 3300049823 Ga0501044_0206367 Ga0501044_0206367_435_914 159
188 3300050489 nmdc:mga03683_73642_c1 nmdc:mga03683_73642_c1_732_1211 159
189 3300050490 nmdc:mga03n38_15068_c1 nmdc:mga03n38_15068_c1_1242_1721 159
190 3300050490 nmdc:mga03n38_75663_c1 nmdc:mga03n38_75663_c1_12_491 159
191 3300050491 nmdc:mga00v17_15636_c1 nmdc:mga00v17_15636_c1_2833_3312 159
192 3300050491 nmdc:mga00v17_20888_c1 nmdc:mga00v17_20888_c1_1034_1513 159
193 3300050492 nmdc:mga0yw44_286131_c1 nmdc:mga0yw44_286131_c1_441_920 159
194 3300050492 nmdc:mga0yw44_29880_c1 nmdc:mga0yw44_29880_c1_1064_1543 159
195 3300050494 nmdc:mga06z11_741170_c1 nmdc:mga06z11_741170_c1_34_513 159
196 3300050495 nmdc:mga04h51_355558_c1 nmdc:mga04h51_355558_c1_38_517 159
197 3300050510 nmdc:mga06r32_1153839_c1 nmdc:mga06r32_1153839_c1_20_499 159
198 3300050511 nmdc:mga08y16_1269494_c1 nmdc:mga08y16_1269494_c1_151_630 159
199 3300050516 nmdc:mga0sz30_11719_c1 nmdc:mga0sz30_11719_c1_1965_2444 159
200 3300050516 nmdc:mga0sz30_44164_c1 nmdc:mga0sz30_44164_c1_613_1092 159
201 3300053077 Ga0495601_0188856 Ga0495601_0188856_205_684 159
202 iso_pu_bacteria 8047710418 8047713361 159
203 iso_pu_bacteria 8054472261 8054477936 159
204 3300003792 Ga0055540_1018644 Ga0055540_10186442 160
205 3300005329 Ga0070683_100092516 Ga0070683_1000925163 160
206 3300005331 Ga0070670_100762027 Ga0070670_1007620272 160
207 3300005334 Ga0068869_100472462 Ga0068869_1004724621 160
208 3300005337 Ga0070682_100116223 Ga0070682_1001162233 160
209 3300005338 Ga0068868_100238874 Ga0068868_1002388743 160
210 3300005340 Ga0070689_100267368 Ga0070689_1002673682 160
211 3300005354 Ga0070675_100592716 Ga0070675_1005927163 160
212 3300005436 Ga0070713_100391186 Ga0070713_1003911862 160
213 3300005457 Ga0070662_100375972 Ga0070662_1003759721 160
214 3300005466 Ga0070685_10242366 Ga0070685_102423662 160
215 3300005535 Ga0070684_100112787 Ga0070684_1001127873 160
216 3300005543 Ga0070672_100707952 Ga0070672_1007079521 160
217 3300005548 Ga0070665_100034821 Ga0070665_1000348212 160
218 3300005564 Ga0070664_100706533 Ga0070664_1007065332 160
219 3300005614 Ga0068856_100276865 Ga0068856_1002768653 160
220 3300005616 Ga0068852_100721786 Ga0068852_1007217863 160
221 3300005618 Ga0068864_100595325 Ga0068864_1005953252 160
222 3300005719 Ga0068861_100162708 Ga0068861_1001627081 160
223 3300005834 Ga0068851_10093026 Ga0068851_100930263 160
224 3300005840 Ga0068870_10022884 Ga0068870_100228841 160
225 3300005841 Ga0068863_100089829 Ga0068863_1000898293 160
226 3300005842 Ga0068858_100233806 Ga0068858_1002338064 160
227 3300009094 Ga0111539_11479772 Ga0111539_114797722 160
228 3300009098 Ga0105245_10120295 Ga0105245_101202953 160
229 3300009101 Ga0105247_10371352 Ga0105247_103713522 160
230 3300009148 Ga0105243_10145150 Ga0105243_101451502 160
231 3300009176 Ga0105242_10191913 Ga0105242_101919132 160
232 3300009177 Ga0105248_10755116 Ga0105248_107551163 160
233 3300009551 Ga0105238_10201529 Ga0105238_102015294 160
234 3300010375 Ga0105239_10310617 Ga0105239_103106172 160
235 3300011119 Ga0105246_10039747 Ga0105246_100397473 160
236 3300013306 Ga0163162_10931204 Ga0163162_109312042 160
237 3300013308 Ga0157375_10447488 Ga0157375_104474883 160
238 3300014745 Ga0157377_10231419 Ga0157377_102314193 160
239 3300014968 Ga0157379_10073109 Ga0157379_100731095 160
240 3300014969 Ga0157376_10372592 Ga0157376_103725923 160
241 3300025303 Ga0209051_1001074 Ga0209051_100107418 160
242 3300025900 Ga0207710_10171802 Ga0207710_101718021 160
243 3300025901 Ga0207688_10055069 Ga0207688_100550693 160
244 3300025903 Ga0207680_10384003 Ga0207680_103840032 160
245 3300025908 Ga0207643_10101516 Ga0207643_101015163 160
246 3300025911 Ga0207654_10240205 Ga0207654_102402053 160
247 3300025912 Ga0207707_10891290 Ga0207707_108912901 160
248 3300025924 Ga0207694_10821103 Ga0207694_108211032 160
249 3300025925 Ga0207650_10705129 Ga0207650_107051291 160
250 3300025926 Ga0207659_10445761 Ga0207659_104457613 160
251 3300025927 Ga0207687_10275196 Ga0207687_102751963 160
252 3300025928 Ga0207700_10471172 Ga0207700_104711721 160
253 3300025932 Ga0207690_10015445 Ga0207690_100154454 160
254 3300025933 Ga0207706_10228575 Ga0207706_102285753 160
255 3300025935 Ga0207709_10277473 Ga0207709_102774733 160
256 3300025936 Ga0207670_10246879 Ga0207670_102468791 160
257 3300025942 Ga0207689_10100727 Ga0207689_101007271 160
258 3300025944 Ga0207661_10194909 Ga0207661_101949093 160
259 3300025981 Ga0207640_11764545 Ga0207640_117645451 160
260 3300026023 Ga0207677_10429608 Ga0207677_104296083 160
261 3300026067 Ga0207678_10065274 Ga0207678_100652743 160
262 3300026088 Ga0207641_10233649 Ga0207641_102336493 160
263 3300026095 Ga0207676_10053470 Ga0207676_100534703 160
264 3300026116 Ga0207674_10037787 Ga0207674_100377873 160
265 3300026121 Ga0207683_10296998 Ga0207683_102969983 160
266 3300026142 Ga0207698_11207615 Ga0207698_112076152 160
267 3300048907 Ga0496104_0450478 Ga0496104_0450478_293_838 160
268 3300048911 Ga0496108_0450599 Ga0496108_0450599_562_1107 160
269 3300048915 Ga0496112_0892917 Ga0496112_0892917_78_623 160
270 3300048916 Ga0496113_0111764 Ga0496113_0111764_153_635 160
271 3300048917 Ga0496114_0516527 Ga0496114_0516527_506_988 160
272 3300050511 nmdc:mga08y16_1467074_c1 nmdc:mga08y16_1467074_c1_140_622 160
273 iso_pu_bacteria 2891326441 2891330558 160
274 3300003792 Ga0055540_1000053 Ga0055540_100005335 161
275 3300005335 Ga0070666_10037097 Ga0070666_100370972 161
276 3300005434 Ga0070709_10047343 Ga0070709_100473432 161
277 3300005439 Ga0070711_100250621 Ga0070711_1002506212 161
278 3300005539 Ga0068853_100539339 Ga0068853_1005393392 161
279 3300005563 Ga0068855_100072189 Ga0068855_1000721894 161
280 3300005616 Ga0068852_100353112 Ga0068852_1003531122 161
281 3300005617 Ga0068859_101704982 Ga0068859_1017049822 161
282 3300006175 Ga0070712_100030396 Ga0070712_1000303964 161
283 3300006178 Ga0075367_10036713 Ga0075367_100367132 161
284 3300006353 Ga0075370_10021826 Ga0075370_100218262 161
285 3300006931 Ga0097620_101705287 Ga0097620_1017052872 161
286 3300009551 Ga0105238_10195841 Ga0105238_101958412 161
287 3300010375 Ga0105239_10021909 Ga0105239_100219095 161
288 3300025303 Ga0209051_1000021 Ga0209051_1000021242 161
289 3300025903 Ga0207680_10013381 Ga0207680_100133811 161
290 3300025906 Ga0207699_10224455 Ga0207699_102244552 161
291 3300025914 Ga0207671_10015571 Ga0207671_100155712 161
292 3300025915 Ga0207693_10174023 Ga0207693_101740232 161
293 3300025916 Ga0207663_10166436 Ga0207663_101664362 161
294 3300025949 Ga0207667_10241957 Ga0207667_102419572 161
295 3300031251 Ga0265327_10003585 Ga0265327_1000358513 161
296 3300046694 Ga0495649_0353729 Ga0495649_0353729_28_513 161
297 3300048903 Ga0496100_0000074 Ga0496100_0000074_33529_34014 161
298 3300048903 Ga0496100_0001023 Ga0496100_0001023_4712_5197 161
299 3300048904 Ga0496101_0000017 Ga0496101_0000017_30069_30554 161
300 3300048904 Ga0496101_0000446 Ga0496101_0000446_7707_8192 161
301 3300048905 Ga0496102_0000007 Ga0496102_0000007_88654_89139 161
302 3300048906 Ga0496103_0000071 Ga0496103_0000071_30787_31272 161
303 3300048909 Ga0496106_0000742 Ga0496106_0000742_15216_15701 161
304 3300048909 Ga0496106_0015503 Ga0496106_0015503_2209_2694 161
305 3300048910 Ga0496107_0000138 Ga0496107_0000138_22485_22970 161
306 3300048910 Ga0496107_0164749 Ga0496107_0164749_188_673 161
307 3300048911 Ga0496108_0022666 Ga0496108_0022666_3048_3533 161
308 3300048912 Ga0496109_0000240 Ga0496109_0000240_34666_35151 161
309 3300048913 Ga0496110_0039812 Ga0496110_0039812_2460_2945 161
310 3300048913 Ga0496110_0536597 Ga0496110_0536597_291_791 161
311 3300048914 Ga0496111_0044160 Ga0496111_0044160_337_822 161
312 3300048916 Ga0496113_0024067 Ga0496113_0024067_1896_2381 161
313 3300048917 Ga0496114_0000337 Ga0496114_0000337_12279_12764 161
314 3300048919 Ga0496116_0000033 Ga0496116_0000033_329032_329517 161
315 3300048919 Ga0496116_0013533 Ga0496116_0013533_2260_2745 161
316 3300048920 Ga0496117_0000025 Ga0496117_0000025_328962_329447 161
317 3300048921 Ga0496118_0000023 Ga0496118_0000023_88660_89145 161
318 3300048921 Ga0496118_0013831 Ga0496118_0013831_4441_4926 161
319 3300048922 Ga0496119_0003841 Ga0496119_0003841_1731_2216 161
320 3300048923 Ga0496120_0000281 Ga0496120_0000281_35112_35597 161
321 3300048924 Ga0496121_0000014 Ga0496121_0000014_182550_183035 161
322 3300048924 Ga0496121_0000642 Ga0496121_0000642_57693_58178 161
323 3300048925 Ga0496122_0000097 Ga0496122_0000097_182543_183028 161
324 3300048926 Ga0496123_0010054 Ga0496123_0010054_4451_4936 161
325 3300048927 Ga0496124_0000019 Ga0496124_0000019_182550_183035 161
326 3300048928 Ga0496125_0000014 Ga0496125_0000014_182550_183035 161
327 3300048929 Ga0496126_0000017 Ga0496126_0000017_427642_428127 161
328 3300048929 Ga0496126_0000027 Ga0496126_0000027_26692_27177 161
329 3300048929 Ga0496126_0000189 Ga0496126_0000189_49428_49913 161
330 3300049572 Ga0501036_0057765 Ga0501036_0057765_2595_3080 161
331 3300049577 Ga0501041_0381728 Ga0501041_0381728_308_793 161
332 3300049587 Ga0501071_0645041 Ga0501071_0645041_12_497 161
333 3300049742 Ga0501080_0760434 Ga0501080_0760434_178_663 161
334 3300049824 Ga0501045_0032234 Ga0501045_0032234_1953_2438 161
335 3300050494 nmdc:mga06z11_66817_c1 nmdc:mga06z11_66817_c1_395_880 161
336 3300053104 Ga0500556_0018664 Ga0500556_0018664_990_1475 161
337 3300053153 Ga0500616_0018803 Ga0500616_0018803_2180_2665 161
338 3300049581 Ga0501047_0372081 Ga0501047_0372081_609_1097 162
339 3300006173 Ga0070716_100103755 Ga0070716_1001037552 163
340 3300021384 Ga0213876_10020259 Ga0213876_100202593 163
341 3300036401 Ga0373937_0166741 Ga0373937_0166741_1565_2056 163
342 3300039437 Ga0436365_0222005 Ga0436365_0222005_9296_9787 163
343 3300005356 Ga0070674_101563369 Ga0070674_1015633691 164
344 3300025918 Ga0207662_11133075 Ga0207662_111330751 164
345 3300031456 Ga0307513_10056489 Ga0307513_100564894 164
346 3300001989 JGI24739J22299_10119039 JGI24739J22299_101190392 165
347 3300025986 Ga0207658_11153643 Ga0207658_111536432 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

20

163

0.96

PF12867

DinB_2

DinB superfamily

25

154

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7988 15 152
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7772 15 153
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.7748 9 159
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7703 15 152
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.7696 15 155
ID Description Score Start End Superfamily
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8187 18 153 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7728 18 153 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7583 10 159 1.20.120.450
af_O53773_242_434_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7457 10 155 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7438 10 159 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A5S5CMZ7-F1-model_v4 Uncharacterized protein DUF664 0.9877 38 159
AF-A0A6G9YUF9-F1-model_v4 DUF664 domain-containing protein 0.9861 6 158
AF-A0A3N0DVL0-F1-model_v4 DinB family protein 0.9854 6 161
AF-A0A0C1E155-F1-model_v4 deleted 0.9849 6 157
AF-A0A345VG50-F1-model_v4 Mini-circle protein 0.9848 2 161

Feature Viewer

pLDDT pTM Quality
93.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map