F417219

General Info

Members Datasets Scaffolds Average Seq Length
347 255 307 323

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0492851|Ga0395905_0492851_39_1106
Length 355
Sequence LIVFIFSHIVYIFDQPTDALFIAMPPSQQPPIVNRVTRLLGIRYPIVQGGMMWVGRAELASAVSNAGGLGLLTALTQPTPDALSAEIERCRAMTDRPFGVNLTILPSASPPPYEAYLDAVIASGVKILETAGNNPRKFIDKAKAAGIVILHKCTAIRHALASQRNGVDIVSIDGFECAGHPGEDDIGGLVLIPQAARSLDIPVIASGGVADGRGMAAALALGAEGVNMGTRFCATVEAPIHENVKRLLVEKSERDTNLILRTLNNTGRVLKNAVSDEVVAIEHRPGGCEFADVHPLVTGARGRRTLENGDVNDGLIWASQAIGLIDDVPTCEELLQRMVRDCRAALSGAAATFEA

Samples

Sample ID Description Type Environment
1 2511231008 Pseudomonas sp. GM21 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
15 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
16 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
17 2738541307 Variovorax sp. GV008 Isolate Unclassified
18 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
19 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
20 2818991446 Variovorax sp. 1180 Isolate Unclassified
21 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
22 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
23 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
24 2885198086 Variovorax sp. 679 Isolate Unclassified
25 2885211737 Variovorax sp. 553 Isolate Unclassified
26 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
27 2899924645 Variovorax sp. 369 Isolate Unclassified
28 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
29 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
30 2928037797 Variovorax sp. 1126 Isolate Unclassified
31 2928044640 Variovorax sp. 1128 Isolate Unclassified
32 2928051484 Variovorax sp. 1133 Isolate Unclassified
33 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
34 2928070936 Variovorax gossypii 1167 Isolate Unclassified
35 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
36 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
37 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
38 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
41 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
45 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
46 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
47 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
160 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
161 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
164 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
171 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
244 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
245 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
246 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
252 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
253 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.18
Metatranscriptomes 0.29
Isolates 11.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.48
Nodule 2.02
Rhizoplane 2.31
Rhizosphere 60.23
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10037918 3300001979 Bacteria 1483
2 JGI24749J21850_1000028 3300002076 Bacteria 27218
3 JGI24751J29686_10000002 3300002459 Bacteria 160619
4 JGI25150J39212_1001210 3300002774 Bacteria 7626
5 JGI25151J46595_10001472 3300003187 Bacteria 15918
6 JGI25151J46595_10010490 3300003187 Bacteria 4301
7 Ga0006562J51391_1203045 3300003578 Bacteria 1358
8 Ga0055527_1002894 3300003760 Bacteria 2721
9 Ga0055535_1006521 3300003761 Bacteria 2348
10 Ga0055542_1000091 3300003762 Bacteria 121973
11 Ga0055536_1004713 3300003781 Bacteria 6865
12 Ga0055536_1020309 3300003781 Bacteria 2055
13 Ga0055534_1008988 3300003784 Bacteria 2211
14 Ga0055530_10002138 3300003791 Bacteria 13111
15 Ga0055540_1003997 3300003792 Bacteria 6865
16 Ga0055540_1016900 3300003792 Bacteria 2055
17 Ga0055531_10026636 3300003794 Bacteria 2055
18 Ga0055543_1001483 3300004625 Bacteria 9247
19 Ga0070670_100000012 3300005331 Bacteria 256314
20 Ga0070670_100002025 3300005331 Bacteria 16582
21 Ga0070666_10000087 3300005335 Bacteria 65028
22 Ga0070668_100060772 3300005347 Bacteria 2927
23 Ga0070668_100063902 3300005347 Bacteria 2853
24 Ga0070669_100000064 3300005353 Bacteria 107033
25 Ga0070669_100000106 3300005353 Bacteria 80614
26 Ga0070671_100000049 3300005355 Bacteria 82402
27 Ga0070667_100000761 3300005367 Bacteria 30631
28 Ga0070667_100011248 3300005367 Bacteria 7404
29 Ga0070714_100288601 3300005435 Bacteria 1526
30 Ga0070705_100005896 3300005440 Bacteria 5988
31 Ga0068855_100025470 3300005563 Bacteria 7077
32 Ga0068855_100101434 3300005563 Bacteria 3313
33 Ga0068856_100005756 3300005614 Bacteria 12212
34 Ga0068852_100101900 3300005616 Bacteria 2593
35 Ga0068859_100002508 3300005617 Bacteria 18656
36 Ga0068859_100008815 3300005617 Bacteria 10186
37 Ga0068864_100000010 3300005618 Bacteria 358723
38 Ga0068864_100000294 3300005618 Bacteria 44233
39 Ga0068861_100001479 3300005719 Bacteria 14914
40 Ga0068861_100025351 3300005719 Bacteria 4299
41 Ga0068851_10024396 3300005834 Bacteria 2960
42 Ga0068863_100008445 3300005841 Bacteria 10059
43 Ga0068858_100005873 3300005842 Bacteria 11984
44 Ga0068858_100047848 3300005842 Bacteria 3964
45 Ga0068860_100003171 3300005843 Bacteria 16969
46 Ga0068862_100000016 3300005844 Bacteria 250031
47 Ga0068862_100002699 3300005844 Bacteria 15587
48 Ga0068862_100281994 3300005844 Bacteria 1523
49 Ga0081455_10000556 3300005937 Bacteria 48587
50 Ga0075364_10000478 3300006051 Bacteria 20305
51 Ga0075432_10016057 3300006058 Bacteria 2557
52 Ga0075362_10007205 3300006177 Bacteria 4197
53 Ga0097620_100002508 3300006931 Bacteria 18656
54 Ga0097620_100008816 3300006931 Bacteria 10186
55 Ga0105240_10024782 3300009093 Bacteria 7901
56 Ga0105240_10041175 3300009093 Bacteria 5899
57 Ga0105247_10001168 3300009101 Bacteria 19504
58 Ga0105243_10024885 3300009148 Bacteria 4570
59 Ga0105243_10033894 3300009148 Bacteria 3950
60 Ga0105241_10016269 3300009174 Bacteria 5450
61 Ga0105248_10000053 3300009177 Bacteria 143972
62 Ga0105237_10065722 3300009545 Bacteria 3622
63 Ga0105238_10034219 3300009551 Bacteria 5170
64 Ga0105249_10140788 3300009553 Bacteria 2313
65 Ga0105249_10227752 3300009553 Bacteria 1837
66 Ga0105239_10052934 3300010375 Bacteria 4452
67 Ga0105246_10216278 3300011119 Bacteria 1499
68 Ga0157371_10051948 3300013102 Bacteria 2912
69 Ga0157371_10111898 3300013102 Bacteria 1938
70 Ga0157369_10000126 3300013105 Bacteria 109644
71 Ga0163162_10186660 3300013306 Bacteria 2200
72 Ga0157372_10278357 3300013307 Bacteria 1945
73 Ga0163163_10083149 3300014325 Bacteria 3206
74 Ga0157380_10000025 3300014326 Bacteria 107388
75 Ga0157380_10115371 3300014326 Bacteria 2265
76 Ga0182008_10002387 3300014497 Bacteria 11802
77 Ga0182008_10008423 3300014497 Bacteria 5629
78 Ga0157379_10015538 3300014968 Bacteria 6682
79 Ga0183362_10017 3300015683 Bacteria 27390
80 Ga0163161_10028866 3300017792 Bacteria 3941
81 Ga0209672_100855 3300025228 Bacteria 13973
82 Ga0209147_100347 3300025229 Bacteria 33903
83 Ga0209258_100143 3300025242 Bacteria 165551
84 Ga0207425_1000859 3300025245 Bacteria 14877
85 Ga0209148_1000007 3300025254 Bacteria 1592273
86 Ga0209129_1000084 3300025258 Bacteria 182554
87 Ga0209129_1000731 3300025258 Bacteria 21113
88 Ga0209233_1013609 3300025261 Bacteria 2319
89 Ga0209565_1000285 3300025263 Bacteria 49572
90 Ga0209565_1000526 3300025263 Bacteria 27114
91 Ga0209565_1000658 3300025263 Bacteria 22142
92 Ga0209673_1001172 3300025273 Bacteria 28386
93 Ga0209673_1002099 3300025273 Bacteria 14969
94 Ga0209130_1000323 3300025284 Bacteria 56069
95 Ga0209675_1008198 3300025291 Bacteria 3879
96 Ga0209676_1000112 3300025292 Bacteria 208328
97 Ga0209676_1002315 3300025292 Bacteria 13839
98 Ga0209676_1002753 3300025292 Bacteria 11771
99 Ga0209025_1000709 3300025294 Bacteria 56684
100 Ga0209025_1001694 3300025294 Bacteria 26906
101 Ga0209025_1003528 3300025294 Bacteria 14680
102 Ga0209025_1065753 3300025294 Bacteria 1322
103 Ga0209564_1000108 3300025295 Bacteria 213699
104 Ga0209564_1000357 3300025295 Bacteria 85402
105 Ga0209758_1000184 3300025297 Bacteria 140021
106 Ga0209050_1000052 3300025298 Bacteria 351785
107 Ga0209050_1000445 3300025298 Bacteria 74894
108 Ga0209050_1001113 3300025298 Bacteria 32509
109 Ga0209256_1000101 3300025299 Bacteria 200246
110 Ga0209256_1000156 3300025299 Bacteria 144277
111 Ga0207426_1000049 3300025302 Bacteria 401954
112 Ga0207426_1000086 3300025302 Bacteria 292089
113 Ga0209051_1000220 3300025303 Bacteria 96404
114 Ga0209051_1002480 3300025303 Bacteria 13178
115 Ga0209051_1002994 3300025303 Bacteria 11485
116 Ga0209051_1013989 3300025303 Bacteria 3775
117 Ga0209257_1000037 3300025304 Bacteria 612915
118 Ga0209257_1000411 3300025304 Bacteria 83024
119 Ga0209257_1002770 3300025304 Bacteria 16572
120 Ga0207697_10000489 3300025315 Bacteria 22232
121 Ga0207656_10058238 3300025321 Bacteria 1687
122 Ga0207710_10021104 3300025900 Bacteria 2789
123 Ga0207680_10000076 3300025903 Bacteria 43991
124 Ga0207654_10000037 3300025911 Bacteria 108727
125 Ga0207695_10000283 3300025913 Bacteria 126108
126 Ga0207695_10112038 3300025913 Bacteria 2707
127 Ga0207671_10173704 3300025914 Bacteria 1674
128 Ga0207681_10000013 3300025923 Bacteria 357411
129 Ga0207681_10000087 3300025923 Bacteria 80999
130 Ga0207681_10159058 3300025923 Bacteria 1701
131 Ga0207694_10000330 3300025924 Bacteria 44655
132 Ga0207694_10072070 3300025924 Bacteria 2701
133 Ga0207650_10000008 3300025925 Bacteria 498534
134 Ga0207650_10002209 3300025925 Bacteria 13606
135 Ga0207644_10000058 3300025931 Bacteria 80996
136 Ga0207690_10075555 3300025932 Bacteria 2337
137 Ga0207709_10012842 3300025935 Bacteria 4618
138 Ga0207709_10014133 3300025935 Bacteria 4407
139 Ga0207711_10001598 3300025941 Bacteria 20953
140 Ga0207667_10015273 3300025949 Bacteria 8732
141 Ga0207667_10283017 3300025949 Bacteria 1694
142 Ga0207712_10006468 3300025961 Bacteria 7387
143 Ga0207668_10000787 3300025972 Bacteria 19418
144 Ga0207668_10047087 3300025972 Bacteria 2951
145 Ga0207658_10000523 3300025986 Bacteria 35047
146 Ga0207658_10023049 3300025986 Bacteria 4340
147 Ga0207703_10019874 3300026035 Bacteria 5249
148 Ga0207703_10030722 3300026035 Bacteria 4245
149 Ga0207702_10000019 3300026078 Bacteria 211843
150 Ga0207702_10273558 3300026078 Bacteria 1594
151 Ga0207641_10004856 3300026088 Bacteria 11568
152 Ga0207676_10000012 3300026095 Bacteria 353971
153 Ga0207676_10003288 3300026095 Bacteria 11488
154 Ga0207675_100000057 3300026118 Bacteria 81804
155 Ga0207675_100000434 3300026118 Bacteria 40583
156 Ga0207698_10023988 3300026142 Bacteria 4272
157 Ga0268265_10000006 3300028380 Bacteria 466482
158 Ga0268265_10000242 3300028380 Bacteria 62332
159 Ga0268265_10068868 3300028380 Bacteria 2746
160 Ga0268264_10000255 3300028381 Bacteria 97190
161 Ga0307513_10228652 3300031456 Bacteria 1674
162 Ga0307408_100044920 3300031548 Bacteria 3152
163 Ga0316576_10073867 3300031727 Bacteria 2520
164 Ga0316576_10088619 3300031727 Bacteria 2303
165 Ga0307516_10000363 3300031730 Bacteria 59029
166 Ga0307405_10003885 3300031731 Bacteria 6970
167 Ga0307405_10106333 3300031731 Bacteria 1892
168 Ga0307412_10059947 3300031911 Bacteria 2552
169 Ga0307412_10110675 3300031911 Bacteria 1960
170 Ga0307416_100025125 3300032002 Bacteria 4362
171 Ga0307416_100067614 3300032002 Bacteria 2948
172 Ga0307416_100118781 3300032002 Bacteria 2350
173 Ga0307414_10359146 3300032004 Bacteria 1253
174 Ga0307411_10008623 3300032005 Bacteria 5297
175 Ga0373936_0036229 3300035113 Bacteria 1966
176 Ga0316574_0038154 3300035398 Bacteria 2949
177 Ga0316574_0062434 3300035398 Bacteria 2341
178 Ga0316574_0119012 3300035398 Bacteria 1695
179 Ga0395900_0081948 3300037418 Bacteria 3314
180 Ga0395898_0013700 3300037466 Bacteria 8340
181 Ga0395905_0492851 3300037471 Bacteria 1125
182 Ga0439436_0001304 3300041404 Bacteria 7136
183 Ga0439438_014088 3300041405 Bacteria 2389
184 Ga0439447_001199 3300041407 Bacteria 9446
185 Ga0439466_0015388 3300041411 Bacteria 2778
186 Ga0451795_0564355 3300041456 Bacteria 4334
187 Ga0439433_0006840 3300041999 Bacteria 2458
188 Ga0439433_0017283 3300041999 Bacteria 1601
189 Ga0439442_010245 3300042002 Bacteria 1899
190 Ga0439432_010746 3300042006 Bacteria 3165
191 Ga0439449_0006202 3300042007 Bacteria 4570
192 Ga0439449_0010672 3300042007 Bacteria 3471
193 Ga0439449_0029997 3300042007 Bacteria 2026
194 Ga0439452_000097 3300042010 Bacteria 74034
195 Ga0439452_005406 3300042010 Bacteria 4112
196 Ga0439457_016657 3300042014 Bacteria 1637
197 Ga0439462_0004521 3300042015 Bacteria 3401
198 Ga0450911_000546 3300042115 Bacteria 11687
199 Ga0450923_004550 3300042125 Bacteria 2182
200 Ga0450898_022544 3300042134 Bacteria 1115
201 Ga0450910_002811 3300042147 Bacteria 2290
202 Ga0439434_0010364 3300042435 Bacteria 2747
203 Ga0451577_0019192 3300042876 Bacteria 6287
204 Ga0466969_0010389 3300044656 Bacteria 4936
205 Ga0453683_0139355 3300044673 Bacteria 1530
206 Ga0466965_0009957 3300044683 Bacteria 4423
207 Ga0466966_0000033 3300044684 Bacteria 101862
208 Ga0466966_0037387 3300044684 Bacteria 3131
209 Ga0466961_0000444 3300044693 Bacteria 26403
210 Ga0466961_0013357 3300044693 Bacteria 5256
211 Ga0466963_0029468 3300044694 Bacteria 3534
212 Ga0453684_0044353 3300044712 Bacteria 5952
213 Ga0453684_0171567 3300044712 Bacteria 2556
214 Ga0453684_0175758 3300044712 Bacteria 2518
215 Ga0466971_0010379 3300044719 Bacteria 4068
216 Ga0466970_0024963 3300044765 Bacteria 3127
217 Ga0466960_0016271 3300044901 Bacteria 3223
218 Ga0466959_0043867 3300045049 Bacteria 3295
219 Ga0451576_0024043 3300045051 Bacteria 6585
220 Ga0451576_0039280 3300045051 Bacteria 5009
221 Ga0451576_0083262 3300045051 Bacteria 3328
222 Ga0495617_010426 3300046452 Bacteria 3183
223 Ga0495638_0000140 3300046460 Bacteria 114677
224 Ga0495580_0001199 3300046472 Bacteria 22801
225 Ga0495584_0002946 3300046491 Bacteria 9476
226 Ga0495606_0000499 3300046507 Bacteria 64051
227 Ga0495606_0131809 3300046507 Bacteria 1485
228 Ga0495616_0000730 3300046513 Bacteria 24186
229 Ga0495616_0022032 3300046513 Bacteria 3443
230 Ga0495631_0005034 3300046518 Bacteria 6959
231 Ga0495637_0002763 3300046520 Bacteria 9520
232 Ga0495637_0042293 3300046520 Bacteria 1950
233 Ga0495648_0052653 3300046524 Bacteria 2471
234 Ga0495663_0013157 3300046525 Bacteria 2313
235 Ga0495666_0000006 3300046526 Bacteria 114619
236 Ga0495640_0094199 3300046533 Bacteria 1973
237 Ga0495621_0014456 3300046539 Bacteria 2498
238 Ga0495597_0000783 3300046542 Bacteria 25099
239 Ga0495633_0000200 3300046558 Bacteria 76743
240 Ga0495633_0099931 3300046558 Bacteria 1347
241 Ga0495656_0003531 3300046615 Bacteria 5291
242 Ga0495668_0108116 3300046616 Bacteria 1521
243 Ga0495625_0123999 3300046660 Bacteria 1755
244 Ga0495658_0187791 3300046683 Bacteria 1284
245 Ga0495671_0013565 3300046692 Bacteria 4406
246 Ga0495660_0017615 3300046810 Bacteria 4111
247 Ga0495660_0135935 3300046810 Bacteria 1228
248 Ga0495674_0000106 3300047319 Bacteria 61645
249 Ga0495672_0050870 3300047320 Bacteria 2443
250 Ga0495676_0172133 3300047321 Bacteria 1523
251 Ga0495673_0003963 3300047469 Bacteria 9483
252 Ga0495614_0069812 3300048089 Bacteria 1513
253 Ga0496102_0118603 3300048905 Bacteria 2470
254 Ga0496104_0225582 3300048907 Bacteria 1786
255 Ga0496107_0294361 3300048910 Bacteria 1208
256 Ga0496114_0364919 3300048917 Bacteria 1278
257 Ga0496116_0018342 3300048919 Bacteria 5398
258 Ga0496117_0202235 3300048920 Bacteria 1121
259 Ga0496118_0088759 3300048921 Bacteria 2137
260 Ga0496121_0005437 3300048924 Bacteria 16329
261 Ga0496121_0023761 3300048924 Bacteria 5889
262 Ga0496122_0035963 3300048925 Bacteria 4017
263 Ga0496122_0116591 3300048925 Bacteria 1736
264 Ga0496122_0178636 3300048925 Bacteria 1269
265 Ga0496123_0027648 3300048926 Bacteria 4220
266 Ga0496123_0064457 3300048926 Bacteria 2335
267 Ga0496123_0130337 3300048926 Bacteria 1394
268 Ga0496124_0006199 3300048927 Bacteria 13104
269 Ga0496124_0020166 3300048927 Bacteria 6171
270 Ga0496124_0125100 3300048927 Bacteria 2049
271 Ga0496125_0008409 3300048928 Bacteria 10808
272 Ga0496125_0022039 3300048928 Bacteria 5923
273 Ga0496125_0215305 3300048928 Bacteria 1243
274 Ga0496126_0042368 3300048929 Bacteria 4205
275 Ga0501034_0000124 3300049571 Bacteria 142890
276 Ga0501034_0001734 3300049571 Bacteria 28043
277 Ga0501047_0436345 3300049581 Bacteria 1140
278 Ga0501068_0039309 3300049584 Bacteria 2837
279 Ga0501071_0000879 3300049587 Bacteria 16236
280 Ga0501076_0053456 3300049592 Bacteria 3201
281 Ga0501080_0000541 3300049742 Bacteria 29739
282 Ga0501081_0021162 3300049743 Bacteria 4341
283 Ga0501280_000445 3300049776 Bacteria 9894
284 nmdc:mga03683_4580_c1 3300050489 Bacteria 4600
285 nmdc:mga03683_8543_c1 3300050489 Bacteria 3605
286 nmdc:mga00v17_1674_c1 3300050491 Bacteria 11533
287 nmdc:mga0k408_19267_c1 3300050493 Bacteria 3811
288 nmdc:mga07m45_287586_c1 3300050496 Unclassified 956
289 Ga0500610_0000988 3300053079 Bacteria 9250
290 Ga0500643_018401 3300053087 Bacteria 2319
291 Ga0500651_0000030 3300053093 Bacteria 112247
292 Ga0500651_0000151 3300053093 Bacteria 44350
293 Ga0500651_0001165 3300053093 Bacteria 13062
294 Ga0500562_038494 3300053108 Bacteria 1270
295 Ga0500571_003441 3300053110 Bacteria 8114
296 Ga0500626_025937 3300053128 Bacteria 2635
297 Ga0500655_000588 3300053133 Bacteria 7311
298 Ga0500564_092058 3300053138 Bacteria 1348
299 Ga0500568_0025222 3300053139 Bacteria 2510
300 Ga0500616_0101251 3300053153 Bacteria 1407
301 Ga0500622_0000412 3300053156 Bacteria 40697
302 Ga0500627_0113027 3300053158 Bacteria 1223
303 Ga0500638_071657 3300053162 Bacteria 1656
304 Ga0500637_0011276 3300053178 Bacteria 4614
305 Ga0500625_010069 3300053729 Bacteria 4235
306 Ga0466962_0016782 3300061719 Bacteria 3530
307 Ga0466962_0099198 3300061719 Bacteria 1398

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_1674_c1 nmdc:mga00v17_1674_c1_5827_6774 270
2 3300006051 Ga0075364_10000478 Ga0075364_1000047811 277
3 3300014497 Ga0182008_10008423 Ga0182008_100084232 288
4 3300046472 Ga0495580_0001199 Ga0495580_0001199_5111_6112 289
5 3300050496 nmdc:mga07m45_287586_c1 nmdc:mga07m45_287586_c1_27_941 289
6 3300013102 Ga0157371_10051948 Ga0157371_100519482 290
7 3300013105 Ga0157369_10000126 Ga0157369_1000012663 290
8 3300046683 Ga0495658_0187791 Ga0495658_0187791_28_945 290
9 3300015683 Ga0183362_10017 Ga0183362_1001725 297
10 3300041456 Ga0451795_0564355 Ga0451795_0564355_2071_3015 298
11 iso_pu_bacteria 2883577096 2883578676 299
12 iso_pu_bacteria 2857537821 2857539375 301
13 3300042876 Ga0451577_0019192 Ga0451577_0019192_5321_6274 302
14 3300044673 Ga0453683_0139355 Ga0453683_0139355_103_1056 302
15 3300044712 Ga0453684_0044353 Ga0453684_0044353_1915_2868 302
16 3300044712 Ga0453684_0171567 Ga0453684_0171567_1189_2142 302
17 3300045051 Ga0451576_0024043 Ga0451576_0024043_4286_5239 302
18 3300045051 Ga0451576_0083262 Ga0451576_0083262_545_1498 302
19 iso_pu_bacteria 2738541307 2738882424 303
20 iso_pu_bacteria 2738541307 2738883818 303
21 iso_pu_bacteria 2896253425 2896253865 303
22 iso_pu_bacteria 2513237150 2513957403 304
23 iso_pu_bacteria 2513237165 2514040288 304
24 iso_pu_bacteria 2551306416 2553004214 304
25 iso_pu_bacteria 2599185214 2599620986 304
26 iso_pu_bacteria 2599185226 2599674208 304
27 iso_pu_bacteria 2599185227 2599678398 304
28 iso_pu_bacteria 2599185229 2599690497 304
29 iso_pu_bacteria 2643221658 2644326182 304
30 iso_pu_bacteria 2643221672 2644400848 304
31 iso_pu_bacteria 2643221683 2644466077 304
32 iso_pu_bacteria 2818991446 2819602097 304
33 iso_pu_bacteria 2838054893 2838055044 304
34 iso_pu_bacteria 2885198086 2885201965 304
35 iso_pu_bacteria 2885211737 2885215325 304
36 iso_pu_bacteria 2899924645 2899927135 304
37 iso_pu_bacteria 2923510766 2923512051 304
38 iso_pu_bacteria 2928037797 2928043983 304
39 iso_pu_bacteria 2928044640 2928048631 304
40 iso_pu_bacteria 2928051484 2928054955 304
41 iso_pu_bacteria 2928064002 2928068390 304
42 iso_pu_bacteria 2928070936 2928073717 304
43 iso_pu_bacteria 2928084124 2928090711 304
44 iso_pu_bacteria 644736347 644750648 304
45 3300048928 Ga0496125_0215305 Ga0496125_0215305_234_1187 305
46 3300049587 Ga0501071_0000879 Ga0501071_0000879_8078_9049 305
47 3300049592 Ga0501076_0053456 Ga0501076_0053456_1252_2223 305
48 3300049742 Ga0501080_0000541 Ga0501080_0000541_4025_4996 305
49 3300049743 Ga0501081_0021162 Ga0501081_0021162_2534_3505 305
50 3300053093 Ga0500651_0000151 Ga0500651_0000151_4273_5235 305
51 iso_pu_bacteria 2511231008 2511275726 305
52 iso_pu_bacteria 2738541275 2738708973 305
53 iso_pu_bacteria 2738541301 2738847398 305
54 iso_pu_bacteria 2738541304 2738863127 305
55 iso_pu_bacteria 2738543022 2739295645 305
56 iso_pu_bacteria 2738543033 2739357323 305
57 iso_pu_bacteria 2902682994 2902686425 305
58 iso_pu_bacteria 2928100450 2928102269 305
59 iso_pu_bacteria 2928959182 2928961229 305
60 iso_pu_bacteria 3007619802 3007625601 305
61 3300005435 Ga0070714_100288601 Ga0070714_1002886012 306
62 3300046452 Ga0495617_010426 Ga0495617_010426_983_1948 306
63 3300046491 Ga0495584_0002946 Ga0495584_0002946_2501_3466 306
64 3300046507 Ga0495606_0000499 Ga0495606_0000499_50933_51898 306
65 3300046513 Ga0495616_0000730 Ga0495616_0000730_20593_21558 306
66 3300046520 Ga0495637_0002763 Ga0495637_0002763_1218_2183 306
67 3300046558 Ga0495633_0000200 Ga0495633_0000200_62130_63095 306
68 3300046810 Ga0495660_0017615 Ga0495660_0017615_1609_2574 306
69 3300047320 Ga0495672_0050870 Ga0495672_0050870_43_1008 306
70 3300047469 Ga0495673_0003963 Ga0495673_0003963_7458_8423 306
71 3300049584 Ga0501068_0039309 Ga0501068_0039309_298_1269 306
72 3300049776 Ga0501280_000445 Ga0501280_000445_4898_5863 306
73 3300002076 JGI24749J21850_1000028 JGI24749J21850_100002815 307
74 3300002459 JGI24751J29686_10000002 JGI24751J29686_1000000275 307
75 3300005331 Ga0070670_100000012 Ga0070670_100000012125 307
76 3300005347 Ga0070668_100063902 Ga0070668_1000639022 307
77 3300005353 Ga0070669_100000064 Ga0070669_10000006485 307
78 3300005367 Ga0070667_100000761 Ga0070667_10000076121 307
79 3300005563 Ga0068855_100025470 Ga0068855_1000254703 307
80 3300005616 Ga0068852_100101900 Ga0068852_1001019002 307
81 3300005617 Ga0068859_100002508 Ga0068859_1000025089 307
82 3300005618 Ga0068864_100000010 Ga0068864_100000010221 307
83 3300005719 Ga0068861_100001479 Ga0068861_1000014793 307
84 3300005842 Ga0068858_100047848 Ga0068858_1000478484 307
85 3300005844 Ga0068862_100000016 Ga0068862_100000016118 307
86 3300005844 Ga0068862_100281994 Ga0068862_1002819942 307
87 3300006931 Ga0097620_100002508 Ga0097620_1000025089 307
88 3300009093 Ga0105240_10041175 Ga0105240_100411754 307
89 3300009177 Ga0105248_10000053 Ga0105248_1000005367 307
90 3300009553 Ga0105249_10227752 Ga0105249_102277522 307
91 3300010375 Ga0105239_10052934 Ga0105239_100529345 307
92 3300014326 Ga0157380_10000025 Ga0157380_10000025106 307
93 3300025913 Ga0207695_10112038 Ga0207695_101120383 307
94 3300025923 Ga0207681_10000013 Ga0207681_10000013207 307
95 3300025925 Ga0207650_10000008 Ga0207650_10000008288 307
96 3300025932 Ga0207690_10075555 Ga0207690_100755553 307
97 3300025941 Ga0207711_10001598 Ga0207711_1000159814 307
98 3300025972 Ga0207668_10047087 Ga0207668_100470873 307
99 3300025986 Ga0207658_10000523 Ga0207658_1000052312 307
100 3300026035 Ga0207703_10030722 Ga0207703_100307224 307
101 3300026078 Ga0207702_10273558 Ga0207702_102735581 307
102 3300026095 Ga0207676_10000012 Ga0207676_10000012109 307
103 3300026118 Ga0207675_100000057 Ga0207675_10000005769 307
104 3300026142 Ga0207698_10023988 Ga0207698_100239884 307
105 3300028380 Ga0268265_10000006 Ga0268265_10000006318 307
106 3300031727 Ga0316576_10073867 Ga0316576_100738673 307
107 3300031727 Ga0316576_10088619 Ga0316576_100886192 307
108 3300035398 Ga0316574_0062434 Ga0316574_0062434_1235_2206 307
109 3300035398 Ga0316574_0119012 Ga0316574_0119012_578_1549 307
110 3300044901 Ga0466960_0016271 Ga0466960_0016271_301_1293 307
111 3300046507 Ga0495606_0131809 Ga0495606_0131809_240_1208 307
112 3300048905 Ga0496102_0118603 Ga0496102_0118603_518_1486 307
113 3300048907 Ga0496104_0225582 Ga0496104_0225582_64_1032 307
114 3300048925 Ga0496122_0116591 Ga0496122_0116591_308_1276 307
115 3300048925 Ga0496122_0178636 Ga0496122_0178636_183_1151 307
116 3300048926 Ga0496123_0027648 Ga0496123_0027648_1989_2957 307
117 3300048926 Ga0496123_0130337 Ga0496123_0130337_126_1094 307
118 3300048927 Ga0496124_0020166 Ga0496124_0020166_95_1063 307
119 3300050489 nmdc:mga03683_4580_c1 nmdc:mga03683_4580_c1_3335_4303 307
120 3300053093 Ga0500651_0001165 Ga0500651_0001165_11969_12946 307
121 3300002774 JGI25150J39212_1001210 JGI25150J39212_10012102 308
122 3300003187 JGI25151J46595_10001472 JGI25151J46595_1000147218 308
123 3300003187 JGI25151J46595_10010490 JGI25151J46595_100104904 308
124 3300003578 Ga0006562J51391_1203045 Ga0006562J51391_12030451 308
125 3300003760 Ga0055527_1002894 Ga0055527_10028941 308
126 3300003761 Ga0055535_1006521 Ga0055535_10065213 308
127 3300003762 Ga0055542_1000091 Ga0055542_1000091108 308
128 3300003781 Ga0055536_1004713 Ga0055536_10047132 308
129 3300003781 Ga0055536_1020309 Ga0055536_10203092 308
130 3300003784 Ga0055534_1008988 Ga0055534_10089882 308
131 3300003791 Ga0055530_10002138 Ga0055530_100021382 308
132 3300003792 Ga0055540_1003997 Ga0055540_10039977 308
133 3300003792 Ga0055540_1016900 Ga0055540_10169002 308
134 3300003794 Ga0055531_10026636 Ga0055531_100266362 308
135 3300004625 Ga0055543_1001483 Ga0055543_10014837 308
136 3300005331 Ga0070670_100002025 Ga0070670_10000202513 308
137 3300005335 Ga0070666_10000087 Ga0070666_1000008751 308
138 3300005347 Ga0070668_100060772 Ga0070668_1000607723 308
139 3300005353 Ga0070669_100000106 Ga0070669_10000010610 308
140 3300005355 Ga0070671_100000049 Ga0070671_10000004969 308
141 3300005367 Ga0070667_100011248 Ga0070667_1000112484 308
142 3300005440 Ga0070705_100005896 Ga0070705_1000058963 308
143 3300005563 Ga0068855_100101434 Ga0068855_1001014344 308
144 3300005614 Ga0068856_100005756 Ga0068856_1000057563 308
145 3300005617 Ga0068859_100008815 Ga0068859_1000088152 308
146 3300005618 Ga0068864_100000294 Ga0068864_1000002949 308
147 3300005719 Ga0068861_100025351 Ga0068861_1000253513 308
148 3300005834 Ga0068851_10024396 Ga0068851_100243962 308
149 3300005841 Ga0068863_100008445 Ga0068863_1000084453 308
150 3300005842 Ga0068858_100005873 Ga0068858_1000058734 308
151 3300005843 Ga0068860_100003171 Ga0068860_10000317116 308
152 3300005844 Ga0068862_100002699 Ga0068862_1000026996 308
153 3300005937 Ga0081455_10000556 Ga0081455_1000055641 308
154 3300006058 Ga0075432_10016057 Ga0075432_100160572 308
155 3300006931 Ga0097620_100008816 Ga0097620_1000088162 308
156 3300009093 Ga0105240_10024782 Ga0105240_100247824 308
157 3300009101 Ga0105247_10001168 Ga0105247_1000116810 308
158 3300009148 Ga0105243_10024885 Ga0105243_100248855 308
159 3300009148 Ga0105243_10033894 Ga0105243_100338943 308
160 3300009545 Ga0105237_10065722 Ga0105237_100657222 308
161 3300009551 Ga0105238_10034219 Ga0105238_100342194 308
162 3300009553 Ga0105249_10140788 Ga0105249_101407883 308
163 3300011119 Ga0105246_10216278 Ga0105246_102162782 308
164 3300013102 Ga0157371_10111898 Ga0157371_101118982 308
165 3300013306 Ga0163162_10186660 Ga0163162_101866602 308
166 3300013307 Ga0157372_10278357 Ga0157372_102783572 308
167 3300014325 Ga0163163_10083149 Ga0163163_100831493 308
168 3300014326 Ga0157380_10115371 Ga0157380_101153712 308
169 3300014497 Ga0182008_10002387 Ga0182008_100023872 308
170 3300014968 Ga0157379_10015538 Ga0157379_100155383 308
171 3300017792 Ga0163161_10028866 Ga0163161_100288663 308
172 3300025228 Ga0209672_100855 Ga0209672_1008552 308
173 3300025229 Ga0209147_100347 Ga0209147_1003473 308
174 3300025242 Ga0209258_100143 Ga0209258_1001433 308
175 3300025245 Ga0207425_1000859 Ga0207425_10008597 308
176 3300025254 Ga0209148_1000007 Ga0209148_10000071348 308
177 3300025258 Ga0209129_1000084 Ga0209129_1000084129 308
178 3300025258 Ga0209129_1000731 Ga0209129_10007312 308
179 3300025263 Ga0209565_1000285 Ga0209565_100028518 308
180 3300025263 Ga0209565_1000526 Ga0209565_100052613 308
181 3300025263 Ga0209565_1000658 Ga0209565_10006588 308
182 3300025273 Ga0209673_1001172 Ga0209673_100117218 308
183 3300025273 Ga0209673_1002099 Ga0209673_100209913 308
184 3300025284 Ga0209130_1000323 Ga0209130_100032312 308
185 3300025291 Ga0209675_1008198 Ga0209675_10081984 308
186 3300025292 Ga0209676_1000112 Ga0209676_100011235 308
187 3300025292 Ga0209676_1002315 Ga0209676_10023153 308
188 3300025292 Ga0209676_1002753 Ga0209676_10027533 308
189 3300025294 Ga0209025_1000709 Ga0209025_100070954 308
190 3300025294 Ga0209025_1001694 Ga0209025_10016945 308
191 3300025294 Ga0209025_1003528 Ga0209025_10035288 308
192 3300025294 Ga0209025_1065753 Ga0209025_10657532 308
193 3300025295 Ga0209564_1000108 Ga0209564_1000108144 308
194 3300025295 Ga0209564_1000357 Ga0209564_100035728 308
195 3300025297 Ga0209758_1000184 Ga0209758_100018491 308
196 3300025298 Ga0209050_1000052 Ga0209050_1000052151 308
197 3300025298 Ga0209050_1000445 Ga0209050_100044535 308
198 3300025298 Ga0209050_1001113 Ga0209050_100111330 308
199 3300025299 Ga0209256_1000101 Ga0209256_100010114 308
200 3300025299 Ga0209256_1000156 Ga0209256_100015683 308
201 3300025302 Ga0207426_1000049 Ga0207426_100004955 308
202 3300025302 Ga0207426_1000086 Ga0207426_1000086144 308
203 3300025303 Ga0209051_1000220 Ga0209051_100022065 308
204 3300025303 Ga0209051_1002480 Ga0209051_100248013 308
205 3300025303 Ga0209051_1002994 Ga0209051_10029943 308
206 3300025303 Ga0209051_1013989 Ga0209051_10139891 308
207 3300025304 Ga0209257_1000037 Ga0209257_1000037148 308
208 3300025304 Ga0209257_1000411 Ga0209257_100041153 308
209 3300025304 Ga0209257_1002770 Ga0209257_10027708 308
210 3300025315 Ga0207697_10000489 Ga0207697_1000048910 308
211 3300025900 Ga0207710_10021104 Ga0207710_100211042 308
212 3300025903 Ga0207680_10000076 Ga0207680_1000007623 308
213 3300025914 Ga0207671_10173704 Ga0207671_101737042 308
214 3300025923 Ga0207681_10000087 Ga0207681_1000008710 308
215 3300025923 Ga0207681_10159058 Ga0207681_101590583 308
216 3300025924 Ga0207694_10072070 Ga0207694_100720702 308
217 3300025925 Ga0207650_10002209 Ga0207650_100022093 308
218 3300025931 Ga0207644_10000058 Ga0207644_1000005810 308
219 3300025935 Ga0207709_10012842 Ga0207709_100128423 308
220 3300025935 Ga0207709_10014133 Ga0207709_100141334 308
221 3300025949 Ga0207667_10015273 Ga0207667_100152732 308
222 3300025961 Ga0207712_10006468 Ga0207712_100064684 308
223 3300025972 Ga0207668_10000787 Ga0207668_100007873 308
224 3300025986 Ga0207658_10023049 Ga0207658_100230493 308
225 3300026035 Ga0207703_10019874 Ga0207703_100198743 308
226 3300026088 Ga0207641_10004856 Ga0207641_1000485612 308
227 3300026095 Ga0207676_10003288 Ga0207676_100032884 308
228 3300026118 Ga0207675_100000434 Ga0207675_10000043428 308
229 3300028380 Ga0268265_10000242 Ga0268265_100002422 308
230 3300028380 Ga0268265_10068868 Ga0268265_100688683 308
231 3300028381 Ga0268264_10000255 Ga0268264_1000025510 308
232 3300031730 Ga0307516_10000363 Ga0307516_1000036310 308
233 3300031731 Ga0307405_10003885 Ga0307405_100038853 308
234 3300031731 Ga0307405_10106333 Ga0307405_101063331 308
235 3300031911 Ga0307412_10110675 Ga0307412_101106752 308
236 3300032002 Ga0307416_100025125 Ga0307416_1000251252 308
237 3300032005 Ga0307411_10008623 Ga0307411_100086235 308
238 3300042007 Ga0439449_0029997 Ga0439449_0029997_510_1481 308
239 3300042014 Ga0439457_016657 Ga0439457_016657_381_1352 308
240 3300042115 Ga0450911_000546 Ga0450911_000546_9183_10163 308
241 3300042125 Ga0450923_004550 Ga0450923_004550_617_1588 308
242 3300042134 Ga0450898_022544 Ga0450898_022544_64_1035 308
243 3300044712 Ga0453684_0175758 Ga0453684_0175758_1336_2346 308
244 3300045051 Ga0451576_0039280 Ga0451576_0039280_1335_2345 308
245 3300046513 Ga0495616_0022032 Ga0495616_0022032_432_1403 308
246 3300046518 Ga0495631_0005034 Ga0495631_0005034_1385_2356 308
247 3300046520 Ga0495637_0042293 Ga0495637_0042293_347_1318 308
248 3300046525 Ga0495663_0013157 Ga0495663_0013157_1019_1990 308
249 3300046526 Ga0495666_0000006 Ga0495666_0000006_33396_34409 308
250 3300046539 Ga0495621_0014456 Ga0495621_0014456_324_1295 308
251 3300046558 Ga0495633_0099931 Ga0495633_0099931_254_1225 308
252 3300046615 Ga0495656_0003531 Ga0495656_0003531_338_1309 308
253 3300046616 Ga0495668_0108116 Ga0495668_0108116_203_1174 308
254 3300046660 Ga0495625_0123999 Ga0495625_0123999_251_1222 308
255 3300046692 Ga0495671_0013565 Ga0495671_0013565_3236_4207 308
256 3300046810 Ga0495660_0135935 Ga0495660_0135935_72_1043 308
257 3300047319 Ga0495674_0000106 Ga0495674_0000106_32557_33570 308
258 3300047321 Ga0495676_0172133 Ga0495676_0172133_121_1092 308
259 3300048089 Ga0495614_0069812 Ga0495614_0069812_104_1075 308
260 3300048910 Ga0496107_0294361 Ga0496107_0294361_77_1048 308
261 3300048917 Ga0496114_0364919 Ga0496114_0364919_236_1207 308
262 3300048919 Ga0496116_0018342 Ga0496116_0018342_3646_4617 308
263 3300048920 Ga0496117_0202235 Ga0496117_0202235_22_993 308
264 3300048921 Ga0496118_0088759 Ga0496118_0088759_343_1314 308
265 3300048924 Ga0496121_0005437 Ga0496121_0005437_15021_15992 308
266 3300048924 Ga0496121_0023761 Ga0496121_0023761_145_1116 308
267 3300048926 Ga0496123_0064457 Ga0496123_0064457_180_1151 308
268 3300048927 Ga0496124_0006199 Ga0496124_0006199_5848_6819 308
269 3300048927 Ga0496124_0125100 Ga0496124_0125100_772_1746 308
270 3300048928 Ga0496125_0008409 Ga0496125_0008409_9162_10133 308
271 3300048928 Ga0496125_0022039 Ga0496125_0022039_708_1688 308
272 3300048929 Ga0496126_0042368 Ga0496126_0042368_406_1377 308
273 3300049571 Ga0501034_0000124 Ga0501034_0000124_118461_119435 308
274 3300049571 Ga0501034_0001734 Ga0501034_0001734_18114_19085 308
275 3300049581 Ga0501047_0436345 Ga0501047_0436345_81_1052 308
276 3300053079 Ga0500610_0000988 Ga0500610_0000988_136_1107 308
277 3300053087 Ga0500643_018401 Ga0500643_018401_1086_2057 308
278 3300053093 Ga0500651_0000030 Ga0500651_0000030_109575_110546 308
279 3300053108 Ga0500562_038494 Ga0500562_038494_48_1019 308
280 3300053110 Ga0500571_003441 Ga0500571_003441_6953_7924 308
281 3300053128 Ga0500626_025937 Ga0500626_025937_416_1387 308
282 3300053133 Ga0500655_000588 Ga0500655_000588_987_1958 308
283 3300053138 Ga0500564_092058 Ga0500564_092058_190_1161 308
284 3300053139 Ga0500568_0025222 Ga0500568_0025222_497_1468 308
285 3300053153 Ga0500616_0101251 Ga0500616_0101251_419_1390 308
286 3300053156 Ga0500622_0000412 Ga0500622_0000412_8244_9215 308
287 3300053158 Ga0500627_0113027 Ga0500627_0113027_47_1018 308
288 3300053162 Ga0500638_071657 Ga0500638_071657_245_1216 308
289 3300053178 Ga0500637_0011276 Ga0500637_0011276_2034_3005 308
290 3300053729 Ga0500625_010069 Ga0500625_010069_3118_4089 308
291 3300031548 Ga0307408_100044920 Ga0307408_1000449203 309
292 3300032002 Ga0307416_100118781 Ga0307416_1001187812 309
293 3300035113 Ga0373936_0036229 Ga0373936_0036229_760_1737 309
294 3300037471 Ga0395905_0492851 Ga0395905_0492851_39_1106 309
295 3300041407 Ga0439447_001199 Ga0439447_001199_5521_6495 309
296 3300041411 Ga0439466_0015388 Ga0439466_0015388_1391_2386 309
297 3300041999 Ga0439433_0006840 Ga0439433_0006840_1058_2125 309
298 3300042007 Ga0439449_0010672 Ga0439449_0010672_1333_2400 309
299 3300042010 Ga0439452_000097 Ga0439452_000097_13833_14828 309
300 3300044656 Ga0466969_0010389 Ga0466969_0010389_3342_4319 309
301 3300044683 Ga0466965_0009957 Ga0466965_0009957_520_1497 309
302 3300044684 Ga0466966_0000033 Ga0466966_0000033_89617_90594 309
303 3300044684 Ga0466966_0037387 Ga0466966_0037387_738_1715 309
304 3300044693 Ga0466961_0000444 Ga0466961_0000444_1823_2800 309
305 3300044693 Ga0466961_0013357 Ga0466961_0013357_1633_2610 309
306 3300044694 Ga0466963_0029468 Ga0466963_0029468_1936_2913 309
307 3300044719 Ga0466971_0010379 Ga0466971_0010379_1242_2219 309
308 3300044765 Ga0466970_0024963 Ga0466970_0024963_796_1773 309
309 3300045049 Ga0466959_0043867 Ga0466959_0043867_1826_2803 309
310 3300046460 Ga0495638_0000140 Ga0495638_0000140_14680_15654 309
311 3300046533 Ga0495640_0094199 Ga0495640_0094199_545_1519 309
312 3300046542 Ga0495597_0000783 Ga0495597_0000783_19145_20119 309
313 3300061719 Ga0466962_0016782 Ga0466962_0016782_1695_2672 309
314 3300061719 Ga0466962_0099198 Ga0466962_0099198_57_1034 309
315 3300006177 Ga0075362_10007205 Ga0075362_100072052 310
316 3300031456 Ga0307513_10228652 Ga0307513_102286522 310
317 3300031911 Ga0307412_10059947 Ga0307412_100599473 310
318 3300032002 Ga0307416_100067614 Ga0307416_1000676143 310
319 3300032004 Ga0307414_10359146 Ga0307414_103591462 310
320 3300035398 Ga0316574_0038154 Ga0316574_0038154_1072_2052 310
321 3300041404 Ga0439436_0001304 Ga0439436_0001304_182_1159 310
322 3300041405 Ga0439438_014088 Ga0439438_014088_195_1172 310
323 3300041999 Ga0439433_0017283 Ga0439433_0017283_47_1024 310
324 3300042002 Ga0439442_010245 Ga0439442_010245_62_1039 310
325 3300042006 Ga0439432_010746 Ga0439432_010746_1530_2507 310
326 3300042007 Ga0439449_0006202 Ga0439449_0006202_463_1440 310
327 3300042010 Ga0439452_005406 Ga0439452_005406_299_1276 310
328 3300042015 Ga0439462_0004521 Ga0439462_0004521_184_1161 310
329 3300042147 Ga0450910_002811 Ga0450910_002811_1110_2087 310
330 3300042435 Ga0439434_0010364 Ga0439434_0010364_956_1933 310
331 3300050489 nmdc:mga03683_8543_c1 nmdc:mga03683_8543_c1_2468_3445 310
332 3300050493 nmdc:mga0k408_19267_c1 nmdc:mga0k408_19267_c1_381_1358 310
333 3300046524 Ga0495648_0052653 Ga0495648_0052653_830_1813 311
334 iso_pu_bacteria 2513237104 2513723686 311
335 iso_pu_bacteria 2524023205 2524442651 311
336 3300037418 Ga0395900_0081948 Ga0395900_0081948_1395_2399 314
337 3300037466 Ga0395898_0013700 Ga0395898_0013700_3400_4404 314
338 3300048925 Ga0496122_0035963 Ga0496122_0035963_1549_2550 316
339 3300001979 JGI24740J21852_10037918 JGI24740J21852_100379181 322
340 3300009174 Ga0105241_10016269 Ga0105241_100162693 322
341 3300025261 Ga0209233_1013609 Ga0209233_10136092 322
342 3300025321 Ga0207656_10058238 Ga0207656_100582382 322
343 3300025911 Ga0207654_10000037 Ga0207654_1000003784 322
344 3300025913 Ga0207695_10000283 Ga0207695_1000028387 322
345 3300025924 Ga0207694_10000330 Ga0207694_1000033028 322
346 3300025949 Ga0207667_10283017 Ga0207667_102830171 322
347 3300026078 Ga0207702_10000019 Ga0207702_1000001923 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

178

252

0.9

PF03060

NMO

Nitronate monooxygenase

34

341

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e2a-assembly1.cif.gz_A crystal structure of nadh:quinone reductase pa1024 from pseudomonas aeruginosa pao1 in complex with nad+ 0.9769 1 309
6e2a-assembly1.cif.gz_A crystal structure of nadh:quinone reductase pa1024 from pseudomonas aeruginosa pao1 in complex with nad+ 0.9351 1 309
2z6i-assembly1.cif.gz_A crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) 0.9299 1 305
4iql-assembly1.cif.gz_B crystal structure of porphyromonas gingivalis enoyl-acp reductase ii (fabk) with cofactors nadph and fmn 0.9185 2 302
2z6i-assembly1.cif.gz_B crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) 0.9183 1 307
ID Description Score Start End Superfamily
2gjnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9762 1 307 3.20.20.70
2gjnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9284 1 307 3.20.20.70
af_A4I9N1_3_315_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9089 2 305 3.20.20.70
2z6iA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9041 2 305 3.20.20.70
2z6iA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.887 2 305 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7S0DSG1-F1-model_v4 Nitronate monooxygenase domain-containing protein 0.9937 1 90 GO:0018580
AF-A0A8A8V8R7-F1-model_v4 deleted 0.9916 1 305
AF-A0A257WAP8-F1-model_v4 deleted 0.9911 1 305
AF-A0A1W6L642-F1-model_v4 Nitronate monooxygenase 0.9905 1 304 GO:0018580
AF-E3HY34-F1-model_v4 2-nitropropane dioxygenase family protein 7 0.9904 1 308 GO:0018580
GO:0051213

Feature Viewer

pLDDT pTM Quality
90.96 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map