F417158

General Info

Members Datasets Scaffolds Average Seq Length
347 196 694 452

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10026994|Ga0157379_100269944
Length 515
Sequence MSDLFDLPFEEDDDVGPPLVADVPASGAGRQRPAVDRQPSTVDTPRSTVPPQPPGASARRAPGDERPVAPVVTRRVFSVTELTLGIRDLLETEFFEVWVEGEISNCKVWNTGHLYFTLKDSGAQVRSVIFRSALRYLKFKPADGLRVVARGRVSVYEPKGEYQLVCEHMEPHGLGALQLAFDQLKKRLQQEGLFDAARKRPLPALPRKIGIVTSLDGAAIRDIIKVLSRRYTNAHLVIRPARVQGDGAALDIARGLRAIARLPGVDVIIVGRGGGSIEDLWAFNEEIVARAIVGSPVPVISAVGHESDVTIADFVADLRAPTPSAAAEMVVVRKDEFAARIDRLAGRLVATTRARVHALSRAVHLISGRPALAGVPGRVAMRGRHVAELTHTLAREIRSALTLRHRRLQQLQRQLDAFDPGRCLGGVRTRLVTADSRLTAATRRAHHQADARLRGCASRLDSLSPLAVLGRGYAVCWTADGARILRASTDVSVGEPVRVTLASGELDCIVRRTTN

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
126 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
139 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
140 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
196 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 2.59
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10026994 3300014968 Bacteria 5110
2 Ga0065707_10085306 3300005295 Bacteria 6268
3 Ga0070676_10001436 3300005328 Bacteria 12032
4 Ga0070676_10048646 3300005328 Bacteria 2479
5 Ga0070690_100020851 3300005330 Bacteria 3996
6 Ga0070690_100026105 3300005330 Bacteria 3600
7 Ga0070670_100004731 3300005331 Bacteria 11423
8 Ga0070670_100155880 3300005331 Bacteria 1978
9 Ga0068869_100103482 3300005334 Bacteria 2157
10 Ga0068869_100220671 3300005334 Bacteria 1502
11 Ga0070666_10060375 3300005335 Bacteria 2566
12 Ga0070680_100065511 3300005336 Bacteria 2977
13 Ga0068868_100008101 3300005338 Bacteria 7516
14 Ga0068868_100013300 3300005338 Bacteria 6031
15 Ga0068868_100066063 3300005338 Bacteria 2875
16 Ga0070660_100084783 3300005339 Bacteria 2491
17 Ga0070689_100004875 3300005340 Bacteria 9111
18 Ga0070689_100011650 3300005340 Bacteria 6305
19 Ga0070691_10066880 3300005341 Bacteria 1738
20 Ga0070687_100016036 3300005343 Bacteria 3404
21 Ga0070668_100152382 3300005347 Bacteria 1870
22 Ga0070669_100007108 3300005353 Bacteria 8043
23 Ga0070669_100087623 3300005353 Bacteria 2328
24 Ga0070669_100152861 3300005353 Bacteria 1788
25 Ga0070671_100007176 3300005355 Bacteria 8908
26 Ga0070674_100001500 3300005356 Bacteria 12440
27 Ga0070674_100005863 3300005356 Bacteria 7145
28 Ga0070673_100001513 3300005364 Bacteria 13666
29 Ga0070673_100007858 3300005364 Bacteria 7065
30 Ga0070673_100067941 3300005364 Bacteria 2852
31 Ga0070688_100008035 3300005365 Bacteria 5709
32 Ga0070688_100020794 3300005365 Bacteria 3823
33 Ga0070659_100041428 3300005366 Bacteria 3600
34 Ga0070667_100010567 3300005367 Bacteria 7620
35 Ga0070667_100028673 3300005367 Bacteria 4635
36 Ga0070714_100009663 3300005435 Bacteria 7595
37 Ga0070701_10002082 3300005438 Bacteria 7593
38 Ga0070701_10003091 3300005438 Bacteria 6522
39 Ga0070701_10008615 3300005438 Bacteria 4423
40 Ga0070705_100056891 3300005440 Bacteria 2305
41 Ga0070705_100094391 3300005440 Bacteria 1873
42 Ga0070700_100004777 3300005441 Bacteria 7109
43 Ga0070700_100010283 3300005441 Bacteria 5163
44 Ga0070700_100044865 3300005441 Bacteria 2725
45 Ga0070694_100007724 3300005444 Bacteria 6561
46 Ga0070694_100032804 3300005444 Bacteria 3412
47 Ga0070678_100022786 3300005456 Bacteria 4159
48 Ga0070678_100039934 3300005456 Bacteria 3316
49 Ga0070678_100106710 3300005456 Bacteria 2183
50 Ga0070678_100114816 3300005456 Bacteria 2113
51 Ga0070662_100105371 3300005457 Bacteria 2140
52 Ga0070681_10068998 3300005458 Bacteria 3502
53 Ga0068867_100050891 3300005459 Bacteria 3055
54 Ga0068867_100087249 3300005459 Bacteria 2362
55 Ga0070707_100064337 3300005468 Bacteria 3522
56 Ga0070707_100199367 3300005468 Bacteria 1951
57 Ga0070707_100259460 3300005468 Bacteria 1691
58 Ga0070699_100110895 3300005518 Bacteria 2409
59 Ga0070679_100033013 3300005530 Bacteria 5123
60 Ga0070684_100035871 3300005535 Bacteria 4247
61 Ga0070697_100169779 3300005536 Bacteria 1845
62 Ga0070695_100000481 3300005545 Bacteria 20745
63 Ga0070695_100001237 3300005545 Bacteria 14040
64 Ga0070695_100045350 3300005545 Unclassified 2802
65 Ga0070696_100062422 3300005546 Bacteria 2608
66 Ga0070696_100103607 3300005546 Unclassified 2042
67 Ga0070665_100012196 3300005548 Bacteria 8665
68 Ga0070665_100031333 3300005548 Bacteria 5351
69 Ga0070704_100001748 3300005549 Bacteria 11869
70 Ga0070704_100004766 3300005549 Bacteria 7851
71 Ga0070704_100011670 3300005549 Bacteria 5396
72 Ga0070704_100081911 3300005549 Bacteria 2378
73 Ga0068855_100046860 3300005563 Bacteria 5109
74 Ga0068857_100033732 3300005577 Bacteria 4527
75 Ga0068854_100061997 3300005578 Bacteria 2709
76 Ga0068856_100105637 3300005614 Bacteria 2810
77 Ga0070702_100005462 3300005615 Bacteria 5924
78 Ga0068852_100036771 3300005616 Bacteria 4100
79 Ga0068859_100001952 3300005617 Bacteria 21030
80 Ga0068859_100044995 3300005617 Bacteria 4435
81 Ga0068859_100193992 3300005617 Bacteria 2115
82 Ga0068864_100146741 3300005618 Bacteria 2133
83 Ga0068864_100239193 3300005618 Bacteria 1682
84 Ga0068861_100049827 3300005719 Bacteria 3172
85 Ga0068861_100060837 3300005719 Bacteria 2896
86 Ga0068863_100305578 3300005841 Bacteria 1543
87 Ga0068858_100024924 3300005842 Bacteria 5567
88 Ga0068858_100026222 3300005842 Bacteria 5418
89 Ga0068858_100041409 3300005842 Bacteria 4270
90 Ga0068858_100142128 3300005842 Bacteria 2253
91 Ga0068860_100029873 3300005843 Bacteria 5243
92 Ga0068862_100006547 3300005844 Bacteria 9666
93 Ga0068862_100019606 3300005844 Bacteria 5647
94 Ga0081540_1063145 3300005983 Bacteria 1754
95 Ga0081539_10074971 3300005985 Bacteria 1799
96 Ga0075362_10000801 3300006177 Bacteria 9387
97 Ga0075366_10000530 3300006195 Bacteria 17699
98 Ga0097621_100014512 3300006237 Bacteria 5898
99 Ga0097621_100082623 3300006237 Bacteria 2675
100 Ga0068871_100109241 3300006358 Bacteria 2325
101 Ga0075428_100008690 3300006844 Bacteria 11268
102 Ga0075428_100057629 3300006844 Bacteria 4252
103 Ga0075428_100082490 3300006844 Bacteria 3508
104 Ga0075430_100007940 3300006846 Bacteria 8968
105 Ga0075430_100011667 3300006846 Bacteria 7477
106 Ga0075430_100057396 3300006846 Bacteria 3275
107 Ga0075431_100004728 3300006847 Bacteria 13381
108 Ga0075431_100031624 3300006847 Bacteria 5450
109 Ga0075431_100108235 3300006847 Bacteria 2868
110 Ga0075433_10009188 3300006852 Bacteria 7899
111 Ga0075433_10159396 3300006852 Bacteria 2008
112 Ga0075433_10231963 3300006852 Bacteria 1639
113 Ga0075434_100038568 3300006871 Bacteria 4731
114 Ga0075434_100064046 3300006871 Bacteria 3660
115 Ga0075434_100077864 3300006871 Bacteria 3311
116 Ga0075434_100192192 3300006871 Bacteria 2062
117 Ga0075429_100012552 3300006880 Bacteria 7350
118 Ga0075429_100052468 3300006880 Bacteria 3548
119 Ga0068865_100017474 3300006881 Bacteria 4613
120 Ga0068865_100079258 3300006881 Bacteria 2352
121 Ga0068865_100091677 3300006881 Bacteria 2206
122 Ga0075436_100008930 3300006914 Bacteria 6863
123 Ga0097620_100001952 3300006931 Bacteria 21030
124 Ga0097620_100044994 3300006931 Bacteria 4435
125 Ga0097620_100193994 3300006931 Bacteria 2115
126 Ga0075435_100000706 3300007076 Bacteria 20658
127 Ga0075435_100010574 3300007076 Bacteria 6754
128 Ga0075435_100123546 3300007076 Bacteria 2162
129 Ga0075435_100202810 3300007076 Bacteria 1681
130 Ga0105240_10006418 3300009093 Bacteria 17287
131 Ga0105240_10051976 3300009093 Bacteria 5153
132 Ga0111539_10001774 3300009094 Bacteria 28680
133 Ga0111539_10002365 3300009094 Bacteria 25074
134 Ga0111539_10002665 3300009094 Bacteria 23642
135 Ga0111539_10007274 3300009094 Bacteria 14174
136 Ga0111539_10078744 3300009094 Bacteria 3877
137 Ga0111539_10100266 3300009094 Bacteria 3401
138 Ga0111539_10180046 3300009094 Bacteria 2469
139 Ga0105247_10015547 3300009101 Bacteria 4557
140 Ga0114129_10003079 3300009147 Bacteria 23397
141 Ga0114129_10003085 3300009147 Bacteria 23382
142 Ga0114129_10006591 3300009147 Bacteria 16480
143 Ga0114129_10010707 3300009147 Bacteria 13075
144 Ga0114129_10011496 3300009147 Bacteria 12605
145 Ga0114129_10016775 3300009147 Bacteria 10427
146 Ga0114129_10029480 3300009147 Bacteria 7773
147 Ga0114129_10061238 3300009147 Bacteria 5259
148 Ga0114129_10164829 3300009147 Bacteria 3025
149 Ga0105242_10001388 3300009176 Bacteria 19073
150 Ga0105242_10019944 3300009176 Bacteria 5252
151 Ga0105248_10030068 3300009177 Bacteria 6062
152 Ga0105248_10058431 3300009177 Bacteria 4332
153 Ga0105248_10078857 3300009177 Bacteria 3702
154 Ga0105248_10207244 3300009177 Bacteria 2209
155 Ga0105249_10001334 3300009553 Bacteria 21606
156 Ga0105249_10043919 3300009553 Bacteria 4065
157 Ga0105249_10065938 3300009553 Bacteria 3332
158 Ga0105246_10021871 3300011119 Bacteria 4122
159 Ga0157375_10018181 3300013308 Bacteria 6370
160 Ga0163163_10015742 3300014325 Bacteria 7003
161 Ga0163163_10270488 3300014325 Bacteria 1751
162 Ga0157380_10003886 3300014326 Bacteria 10304
163 Ga0157380_10007439 3300014326 Bacteria 7775
164 Ga0157380_10058997 3300014326 Bacteria 3061
165 Ga0157380_10226727 3300014326 Bacteria 1675
166 Ga0157377_10015219 3300014745 Bacteria 3929
167 Ga0157379_10003739 3300014968 Bacteria 12939
168 Ga0157379_10013864 3300014968 Bacteria 7066
169 Ga0157379_10037352 3300014968 Bacteria 4330
170 Ga0157376_10009597 3300014969 Bacteria 7038
171 Ga0157376_10057545 3300014969 Bacteria 3253
172 Ga0207697_10001514 3300025315 Bacteria 12621
173 Ga0207682_10001841 3300025893 Bacteria 9661
174 Ga0207688_10001443 3300025901 Bacteria 12425
175 Ga0207680_10049789 3300025903 Bacteria 2496
176 Ga0207645_10002829 3300025907 Bacteria 13470
177 Ga0207643_10020319 3300025908 Bacteria 3644
178 Ga0207705_10090377 3300025909 Bacteria 2241
179 Ga0207662_10002054 3300025918 Bacteria 9973
180 Ga0207662_10002248 3300025918 Bacteria 9648
181 Ga0207657_10093963 3300025919 Bacteria 2497
182 Ga0207652_10018662 3300025921 Bacteria 5692
183 Ga0207646_10053917 3300025922 Bacteria 3597
184 Ga0207646_10064569 3300025922 Bacteria 3268
185 Ga0207646_10079753 3300025922 Bacteria 2927
186 Ga0207681_10023762 3300025923 Bacteria 3925
187 Ga0207681_10140167 3300025923 Bacteria 1800
188 Ga0207659_10005636 3300025926 Bacteria 7615
189 Ga0207687_10014295 3300025927 Bacteria 5193
190 Ga0207644_10037261 3300025931 Bacteria 3420
191 Ga0207690_10035132 3300025932 Bacteria 3235
192 Ga0207686_10014004 3300025934 Bacteria 4453
193 Ga0207670_10051307 3300025936 Bacteria 2769
194 Ga0207669_10001529 3300025937 Bacteria 9860
195 Ga0207704_10031756 3300025938 Bacteria 2979
196 Ga0207704_10066093 3300025938 Bacteria 2268
197 Ga0207691_10005705 3300025940 Bacteria 12037
198 Ga0207711_10022416 3300025941 Bacteria 5280
199 Ga0207711_10031445 3300025941 Bacteria 4481
200 Ga0207689_10000831 3300025942 Bacteria 29759
201 Ga0207679_10032912 3300025945 Bacteria 3645
202 Ga0207651_10001622 3300025960 Bacteria 10322
203 Ga0207712_10002418 3300025961 Bacteria 12069
204 Ga0207658_10022805 3300025986 Bacteria 4361
205 Ga0207677_10021249 3300026023 Bacteria 3962
206 Ga0207677_10056451 3300026023 Bacteria 2691
207 Ga0207703_10006046 3300026035 Bacteria 9681
208 Ga0207703_10167767 3300026035 Bacteria 1928
209 Ga0207708_10000690 3300026075 Bacteria 25620
210 Ga0207708_10002607 3300026075 Bacteria 13262
211 Ga0207702_10138797 3300026078 Bacteria 2197
212 Ga0207648_10001594 3300026089 Bacteria 24839
213 Ga0207676_10080485 3300026095 Bacteria 2644
214 Ga0207674_10043449 3300026116 Bacteria 4633
215 Ga0207675_100001401 3300026118 Bacteria 24104
216 Ga0207675_100004015 3300026118 Bacteria 14272
217 Ga0207675_100045021 3300026118 Bacteria 4123
218 Ga0207675_100070037 3300026118 Bacteria 3278
219 Ga0207683_10019861 3300026121 Bacteria 5741
220 Ga0207428_10002217 3300027907 Bacteria 19496
221 Ga0207428_10003096 3300027907 Bacteria 16357
222 Ga0207428_10008381 3300027907 Bacteria 9336
223 Ga0268266_10005725 3300028379 Bacteria 11509
224 Ga0268266_10051839 3300028379 Bacteria 3523
225 Ga0268265_10018031 3300028380 Bacteria 4886
226 Ga0268265_10049130 3300028380 Bacteria 3171
227 Ga0268265_10066118 3300028380 Bacteria 2793
228 Ga0268265_10094318 3300028380 Bacteria 2400
229 Ga0268265_10156747 3300028380 Bacteria 1928
230 Ga0265330_10000034 3300031235 Bacteria 123933
231 Ga0265332_10000236 3300031238 Bacteria 44137
232 Ga0265316_10000057 3300031344 Bacteria 119213
233 Ga0307408_100035547 3300031548 Bacteria 3497
234 Ga0316575_10021295 3300031665 Bacteria 2494
235 Ga0316579_10002456 3300031691 Bacteria 7003
236 Ga0265314_10000039 3300031711 Bacteria 220957
237 Ga0265342_10000475 3300031712 Bacteria 43531
238 Ga0316578_10002726 3300031728 Bacteria 7857
239 Ga0307405_10015488 3300031731 Bacteria 4132
240 Ga0316577_10003699 3300031733 Bacteria 7783
241 Ga0307406_10014542 3300031901 Bacteria 4532
242 Ga0307407_10004539 3300031903 Bacteria 5910
243 Ga0307416_100187770 3300032002 Bacteria 1945
244 Ga0307416_100273766 3300032002 Bacteria 1659
245 Ga0307416_100294025 3300032002 Bacteria 1610
246 Ga0307414_10156696 3300032004 Bacteria 1804
247 Ga0307411_10008301 3300032005 Bacteria 5367
248 Ga0307411_10047981 3300032005 Bacteria 2764
249 Ga0307411_10205608 3300032005 Bacteria 1516
250 Ga0307415_100009527 3300032126 Bacteria 5450
251 Ga0316583_10000796 3300032133 Bacteria 9934
252 Ga0316585_10001922 3300032137 Bacteria 5549
253 Ga0373948_0007332 3300034817 Bacteria 1852
254 Ga0373940_0002102 3300035088 Bacteria 3793
255 Ga0373949_0007478 3300035090 Bacteria 2392
256 Ga0373952_0014519 3300035092 Bacteria 1578
257 Ga0373932_0015582 3300035112 Bacteria 1928
258 Ga0373961_0006165 3300035241 Bacteria 2881
259 Ga0373931_0022676 3300035691 Bacteria 3162
260 Ga0373937_0095996 3300036401 Bacteria 2749
261 Ga0316582_0001195 3300036647 Bacteria 11141
262 Ga0395905_0040669 3300037471 Bacteria 4362
263 Ga0439450_000447 3300042008 Bacteria 5354
264 Ga0439460_0014685 3300042461 Bacteria 2060
265 Ga0453684_0088249 3300044712 Bacteria 3840
266 Ga0451576_0047449 3300045051 Bacteria 4516
267 Ga0451576_0253696 3300045051 Bacteria 1838
268 Ga0495629_0186616 3300046459 Bacteria 1436
269 Ga0495658_0127590 3300046683 Bacteria 1545
270 Ga0496100_0003996 3300048903 Bacteria 7755
271 Ga0496104_0031178 3300048907 Bacteria 4957
272 Ga0496105_0122966 3300048908 Bacteria 2140
273 Ga0496107_0099798 3300048910 Bacteria 2128
274 Ga0496108_0054911 3300048911 Bacteria 3343
275 Ga0496112_0014053 3300048915 Bacteria 7411
276 Ga0496112_0080596 3300048915 Bacteria 3219
277 Ga0496113_0090843 3300048916 Bacteria 2353
278 Ga0496114_0007297 3300048917 Bacteria 8730
279 Ga0501032_0075152 3300049569 Unclassified 2250
280 Ga0501034_0062838 3300049571 Bacteria 3728
281 Ga0501034_0089402 3300049571 Bacteria 3078
282 Ga0501036_0153024 3300049572 Unclassified 1945
283 Ga0501038_0010451 3300049574 Bacteria 8490
284 Ga0501041_0005261 3300049577 Bacteria 7561
285 Ga0501042_0015069 3300049578 Bacteria 5287
286 Ga0501046_0032638 3300049580 Bacteria 4215
287 Ga0501046_0184558 3300049580 Bacteria 1558
288 Ga0501047_0076323 3300049581 Bacteria 3225
289 Ga0501047_0100838 3300049581 Bacteria 2766
290 Ga0501048_0019441 3300049582 Bacteria 4983
291 Ga0501048_0046252 3300049582 Bacteria 3107
292 Ga0501048_0069226 3300049582 Bacteria 2493
293 Ga0501048_0082864 3300049582 Bacteria 2262
294 Ga0501071_0187571 3300049587 Bacteria 1550
295 Ga0501075_0006302 3300049591 Bacteria 8152
296 Ga0501075_0043267 3300049591 Bacteria 3378
297 Ga0501076_0030415 3300049592 Bacteria 4206
298 Ga0501076_0264585 3300049592 Bacteria 1408
299 Ga0501079_0071641 3300049741 Bacteria 2678
300 Ga0501080_0043835 3300049742 Bacteria 4166
301 Ga0501080_0127622 3300049742 Bacteria 2355
302 Ga0501081_0011827 3300049743 Bacteria 5716
303 Ga0501045_0028727 3300049824 Bacteria 4013
304 Ga0501045_0103943 3300049824 Bacteria 2104
305 nmdc:mga03683_28234_c1 3300050489 Bacteria 2230
306 nmdc:mga00v17_2954_c1 3300050491 Bacteria 8726
307 nmdc:mga00v17_77518_c1 3300050491 Bacteria 2069
308 nmdc:mga0k408_19012_c1 3300050493 Bacteria 3835
309 nmdc:mga05p37_181794_c1 3300050507 Bacteria 2558
310 nmdc:mga05p37_1909_c1 3300050507 Bacteria 24257
311 nmdc:mga05p37_20228_c1 3300050507 Bacteria 4619
312 nmdc:mga05p37_4985_c1 3300050507 Bacteria 15559
313 nmdc:mga05p37_50248_c1 3300050507 Bacteria 5128
314 nmdc:mga05p37_61833_c1 3300050507 Bacteria 4609
315 nmdc:mga05p37_8400_c1 3300050507 Bacteria 12208
316 nmdc:mga09592_11592_c1 3300050508 Bacteria 7169
317 nmdc:mga09592_127930_c1 3300050508 Bacteria 2184
318 nmdc:mga0qj67_22171_c1 3300050509 Bacteria 4876
319 nmdc:mga0qj67_42209_c1 3300050509 Bacteria 3590
320 nmdc:mga06r32_111270_c1 3300050510 Bacteria 2695
321 nmdc:mga06r32_78722_c1 3300050510 Bacteria 3205
322 nmdc:mga08y16_119311_c1 3300050511 Bacteria 2745
323 nmdc:mga08y16_12914_c1 3300050511 Bacteria 8786
324 nmdc:mga08y16_142330_c1 3300050511 Bacteria 2493
325 nmdc:mga08y16_2853_c1 3300050511 Bacteria 17774
326 nmdc:mga08y16_34682_c1 3300050511 Bacteria 5301
327 nmdc:mga08y16_99414_c1 3300050511 Bacteria 3029
328 nmdc:mga0n895_39130_c1 3300050512 Bacteria 4599
329 nmdc:mga0n895_81489_c1 3300050512 Bacteria 3225
330 nmdc:mga0n895_86419_c1 3300050512 Bacteria 3132
331 nmdc:mga0n895_98608_c1 3300050512 Bacteria 2929
332 nmdc:mga0rr50_21346_c1 3300050513 Bacteria 4419
333 nmdc:mga0rr50_99718_c1 3300050513 Bacteria 2279
334 nmdc:mga08x19_18998_c1 3300050514 Bacteria 3598
335 nmdc:mga08x19_2140_c1 3300050514 Bacteria 12069
336 nmdc:mga0a205_1497_c1 3300050515 Bacteria 19917
337 nmdc:mga0a205_229907_c1 3300050515 Bacteria 1738
338 nmdc:mga0a205_37160_c1 3300050515 Bacteria 4682
339 nmdc:mga0a205_42998_c1 3300050515 Bacteria 4355
340 nmdc:mga0a205_4601_c1 3300050515 Bacteria 12370
341 nmdc:mga0a205_57897_c1 3300050515 Bacteria 3742
342 nmdc:mga0a205_82700_c1 3300050515 Bacteria 3101
343 Ga0500568_0001345 3300053139 Bacteria 16034
344 Ga0501084_0130788 3300054114 Bacteria 2113
345 Ga0501082_0195545 3300060353 Bacteria 1759
346 Ga0530510_0029041 3300061734 Bacteria 3968
347 2787508844 2786546548 Bacteria 4745694
348 Ga0157379_10026994
349 Ga0065707_10085306
350 Ga0070676_10001436
351 Ga0070676_10048646
352 Ga0070690_100020851
353 Ga0070690_100026105
354 Ga0070670_100004731
355 Ga0070670_100155880
356 Ga0068869_100103482
357 Ga0068869_100220671
358 Ga0070666_10060375
359 Ga0070680_100065511
360 Ga0068868_100008101
361 Ga0068868_100013300
362 Ga0068868_100066063
363 Ga0070660_100084783
364 Ga0070689_100004875
365 Ga0070689_100011650
366 Ga0070691_10066880
367 Ga0070687_100016036
368 Ga0070668_100152382
369 Ga0070669_100007108
370 Ga0070669_100087623
371 Ga0070669_100152861
372 Ga0070671_100007176
373 Ga0070674_100001500
374 Ga0070674_100005863
375 Ga0070673_100001513
376 Ga0070673_100007858
377 Ga0070673_100067941
378 Ga0070688_100008035
379 Ga0070688_100020794
380 Ga0070659_100041428
381 Ga0070667_100010567
382 Ga0070667_100028673
383 Ga0070714_100009663
384 Ga0070701_10002082
385 Ga0070701_10003091
386 Ga0070701_10008615
387 Ga0070705_100056891
388 Ga0070705_100094391
389 Ga0070700_100004777
390 Ga0070700_100010283
391 Ga0070700_100044865
392 Ga0070694_100007724
393 Ga0070694_100032804
394 Ga0070678_100022786
395 Ga0070678_100039934
396 Ga0070678_100106710
397 Ga0070678_100114816
398 Ga0070662_100105371
399 Ga0070681_10068998
400 Ga0068867_100050891
401 Ga0068867_100087249
402 Ga0070707_100064337
403 Ga0070707_100199367
404 Ga0070707_100259460
405 Ga0070699_100110895
406 Ga0070679_100033013
407 Ga0070684_100035871
408 Ga0070697_100169779
409 Ga0070695_100000481
410 Ga0070695_100001237
411 Ga0070695_100045350
412 Ga0070696_100062422
413 Ga0070696_100103607
414 Ga0070665_100012196
415 Ga0070665_100031333
416 Ga0070704_100001748
417 Ga0070704_100004766
418 Ga0070704_100011670
419 Ga0070704_100081911
420 Ga0068855_100046860
421 Ga0068857_100033732
422 Ga0068854_100061997
423 Ga0068856_100105637
424 Ga0070702_100005462
425 Ga0068852_100036771
426 Ga0068859_100001952
427 Ga0068859_100044995
428 Ga0068859_100193992
429 Ga0068864_100146741
430 Ga0068864_100239193
431 Ga0068861_100049827
432 Ga0068861_100060837
433 Ga0068863_100305578
434 Ga0068858_100024924
435 Ga0068858_100026222
436 Ga0068858_100041409
437 Ga0068858_100142128
438 Ga0068860_100029873
439 Ga0068862_100006547
440 Ga0068862_100019606
441 Ga0081540_1063145
442 Ga0081539_10074971
443 Ga0075362_10000801
444 Ga0075366_10000530
445 Ga0097621_100014512
446 Ga0097621_100082623
447 Ga0068871_100109241
448 Ga0075428_100008690
449 Ga0075428_100057629
450 Ga0075428_100082490
451 Ga0075430_100007940
452 Ga0075430_100011667
453 Ga0075430_100057396
454 Ga0075431_100004728
455 Ga0075431_100031624
456 Ga0075431_100108235
457 Ga0075433_10009188
458 Ga0075433_10159396
459 Ga0075433_10231963
460 Ga0075434_100038568
461 Ga0075434_100064046
462 Ga0075434_100077864
463 Ga0075434_100192192
464 Ga0075429_100012552
465 Ga0075429_100052468
466 Ga0068865_100017474
467 Ga0068865_100079258
468 Ga0068865_100091677
469 Ga0075436_100008930
470 Ga0097620_100001952
471 Ga0097620_100044994
472 Ga0097620_100193994
473 Ga0075435_100000706
474 Ga0075435_100010574
475 Ga0075435_100123546
476 Ga0075435_100202810
477 Ga0105240_10006418
478 Ga0105240_10051976
479 Ga0111539_10001774
480 Ga0111539_10002365
481 Ga0111539_10002665
482 Ga0111539_10007274
483 Ga0111539_10078744
484 Ga0111539_10100266
485 Ga0111539_10180046
486 Ga0105247_10015547
487 Ga0114129_10003079
488 Ga0114129_10003085
489 Ga0114129_10006591
490 Ga0114129_10010707
491 Ga0114129_10011496
492 Ga0114129_10016775
493 Ga0114129_10029480
494 Ga0114129_10061238
495 Ga0114129_10164829
496 Ga0105242_10001388
497 Ga0105242_10019944
498 Ga0105248_10030068
499 Ga0105248_10058431
500 Ga0105248_10078857
501 Ga0105248_10207244
502 Ga0105249_10001334
503 Ga0105249_10043919
504 Ga0105249_10065938
505 Ga0105246_10021871
506 Ga0157375_10018181
507 Ga0163163_10015742
508 Ga0163163_10270488
509 Ga0157380_10003886
510 Ga0157380_10007439
511 Ga0157380_10058997
512 Ga0157380_10226727
513 Ga0157377_10015219
514 Ga0157379_10003739
515 Ga0157379_10013864
516 Ga0157379_10037352
517 Ga0157376_10009597
518 Ga0157376_10057545
519 Ga0207697_10001514
520 Ga0207682_10001841
521 Ga0207688_10001443
522 Ga0207680_10049789
523 Ga0207645_10002829
524 Ga0207643_10020319
525 Ga0207705_10090377
526 Ga0207662_10002054
527 Ga0207662_10002248
528 Ga0207657_10093963
529 Ga0207652_10018662
530 Ga0207646_10053917
531 Ga0207646_10064569
532 Ga0207646_10079753
533 Ga0207681_10023762
534 Ga0207681_10140167
535 Ga0207659_10005636
536 Ga0207687_10014295
537 Ga0207644_10037261
538 Ga0207690_10035132
539 Ga0207686_10014004
540 Ga0207670_10051307
541 Ga0207669_10001529
542 Ga0207704_10031756
543 Ga0207704_10066093
544 Ga0207691_10005705
545 Ga0207711_10022416
546 Ga0207711_10031445
547 Ga0207689_10000831
548 Ga0207679_10032912
549 Ga0207651_10001622
550 Ga0207712_10002418
551 Ga0207658_10022805
552 Ga0207677_10021249
553 Ga0207677_10056451
554 Ga0207703_10006046
555 Ga0207703_10167767
556 Ga0207708_10000690
557 Ga0207708_10002607
558 Ga0207702_10138797
559 Ga0207648_10001594
560 Ga0207676_10080485
561 Ga0207674_10043449
562 Ga0207675_100001401
563 Ga0207675_100004015
564 Ga0207675_100045021
565 Ga0207675_100070037
566 Ga0207683_10019861
567 Ga0207428_10002217
568 Ga0207428_10003096
569 Ga0207428_10008381
570 Ga0268266_10005725
571 Ga0268266_10051839
572 Ga0268265_10018031
573 Ga0268265_10049130
574 Ga0268265_10066118
575 Ga0268265_10094318
576 Ga0268265_10156747
577 Ga0265330_10000034
578 Ga0265332_10000236
579 Ga0265316_10000057
580 Ga0307408_100035547
581 Ga0316575_10021295
582 Ga0316579_10002456
583 Ga0265314_10000039
584 Ga0265342_10000475
585 Ga0316578_10002726
586 Ga0307405_10015488
587 Ga0316577_10003699
588 Ga0307406_10014542
589 Ga0307407_10004539
590 Ga0307416_100187770
591 Ga0307416_100273766
592 Ga0307416_100294025
593 Ga0307414_10156696
594 Ga0307411_10008301
595 Ga0307411_10047981
596 Ga0307411_10205608
597 Ga0307415_100009527
598 Ga0316583_10000796
599 Ga0316585_10001922
600 Ga0373948_0007332
601 Ga0373940_0002102
602 Ga0373949_0007478
603 Ga0373952_0014519
604 Ga0373932_0015582
605 Ga0373961_0006165
606 Ga0373931_0022676
607 Ga0373937_0095996
608 Ga0316582_0001195
609 Ga0395905_0040669
610 Ga0439450_000447
611 Ga0439460_0014685
612 Ga0453684_0088249
613 Ga0451576_0047449
614 Ga0451576_0253696
615 Ga0495629_0186616
616 Ga0495658_0127590
617 Ga0496100_0003996
618 Ga0496104_0031178
619 Ga0496105_0122966
620 Ga0496107_0099798
621 Ga0496108_0054911
622 Ga0496112_0014053
623 Ga0496112_0080596
624 Ga0496113_0090843
625 Ga0496114_0007297
626 Ga0501032_0075152
627 Ga0501034_0062838
628 Ga0501034_0089402
629 Ga0501036_0153024
630 Ga0501038_0010451
631 Ga0501041_0005261
632 Ga0501042_0015069
633 Ga0501046_0032638
634 Ga0501046_0184558
635 Ga0501047_0076323
636 Ga0501047_0100838
637 Ga0501048_0019441
638 Ga0501048_0046252
639 Ga0501048_0069226
640 Ga0501048_0082864
641 Ga0501071_0187571
642 Ga0501075_0006302
643 Ga0501075_0043267
644 Ga0501076_0030415
645 Ga0501076_0264585
646 Ga0501079_0071641
647 Ga0501080_0043835
648 Ga0501080_0127622
649 Ga0501081_0011827
650 Ga0501045_0028727
651 Ga0501045_0103943
652 nmdc:mga03683_28234_c1
653 nmdc:mga00v17_2954_c1
654 nmdc:mga00v17_77518_c1
655 nmdc:mga0k408_19012_c1
656 nmdc:mga05p37_181794_c1
657 nmdc:mga05p37_1909_c1
658 nmdc:mga05p37_20228_c1
659 nmdc:mga05p37_4985_c1
660 nmdc:mga05p37_50248_c1
661 nmdc:mga05p37_61833_c1
662 nmdc:mga05p37_8400_c1
663 nmdc:mga09592_11592_c1
664 nmdc:mga09592_127930_c1
665 nmdc:mga0qj67_22171_c1
666 nmdc:mga0qj67_42209_c1
667 nmdc:mga06r32_111270_c1
668 nmdc:mga06r32_78722_c1
669 nmdc:mga08y16_119311_c1
670 nmdc:mga08y16_12914_c1
671 nmdc:mga08y16_142330_c1
672 nmdc:mga08y16_2853_c1
673 nmdc:mga08y16_34682_c1
674 nmdc:mga08y16_99414_c1
675 nmdc:mga0n895_39130_c1
676 nmdc:mga0n895_81489_c1
677 nmdc:mga0n895_86419_c1
678 nmdc:mga0n895_98608_c1
679 nmdc:mga0rr50_21346_c1
680 nmdc:mga0rr50_99718_c1
681 nmdc:mga08x19_18998_c1
682 nmdc:mga08x19_2140_c1
683 nmdc:mga0a205_1497_c1
684 nmdc:mga0a205_229907_c1
685 nmdc:mga0a205_37160_c1
686 nmdc:mga0a205_42998_c1
687 nmdc:mga0a205_4601_c1
688 nmdc:mga0a205_57897_c1
689 nmdc:mga0a205_82700_c1
690 Ga0500568_0001345
691 Ga0501084_0130788
692 Ga0501082_0195545
693 Ga0530510_0029041
694 2787508844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02601

Exonuc_VII_L

Exonuclease VII, large subunit

193

509

0.97

PF01336

tRNA_anti-codon

OB-fold nucleic acid binding domain

97

171

0.96

PF13742

tRNA_anti_2

OB-fold nucleic acid binding domain

77

170

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z6k-assembly1.cif.gz_A crystal structure of full-length human rpa14/32 heterodimer 0.8574 66 143
1l1o-assembly1.cif.gz_E structure of the human replication protein a (rpa) trimerization core 0.8513 66 142
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.8409 66 142
2pqa-assembly1.cif.gz_A crystal structure of full-length human rpa 14/32 heterodimer 0.8406 64 142
4h02-assembly4.cif.gz_G crystal structure of p. falciparum lysyl-trna synthetase 0.8266 66 141
ID Description Score Start End Superfamily
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9904 47 140 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9801 47 140 2.40.50.140
af_Q2FY46_5_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9762 47 140 2.40.50.140
af_Q2FY46_5_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9465 47 140 2.40.50.140
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8757 47 140 2.40.50.140
ID Description Score Start End GO Terms
AF-T1AAC6-F1-model_v4 Exonuclease VII, large subunit (EC 3.1.11.6) 0.9863 148 300 GO:0006308
GO:0008855
GO:0009318
AF-A0A2X1KF80-F1-model_v4 Exodeoxyribonuclease 7 large subunit (EC 3.1.11.6) 0.9773 66 143 GO:0003676
GO:0006308
GO:0008855
GO:0009318
AF-Q71IW7-F1-model_v4 Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) 0.9727 161 300 GO:0006308
GO:0008855
GO:0009318
AF-A0A6L5EKV6-F1-model_v4 Exodeoxyribonuclease VII large subunit 0.9671 193 293 GO:0006308
GO:0008855
GO:0009318
AF-A0A656K7M2-F1-model_v4 deleted 0.9661 164 327

Map