F417096

General Info

Members Datasets Scaffolds Average Seq Length
347 191 322 295

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10150114|Ga0075362_101501141
Length 349
Sequence MSSAATRLSPHPKTTAVGFCASARLARCSIPWLGCSGSPATNRSLPSLSAFHAVTGLVLGMTDIVPQLLDWYRSAQRDLAWRRPGVSPWQILVSEFMLQQTPVARVEPIWLAWIERWPTPSATAAASAADVLRAWGKLGYPRRAKRLHECATVIATEHGDVVPSDVETLLTLPGVGAYTARAIACFAYRQRVPVVDTNVRRVVARVVHGRADSPASVRDLDDVAALLPDSADAPTFSVALMELGATVCTARSPRCGLCPLSACAWRSRGYPEAAAPVRRVQRYAGTDRQVRGRLLDVLRGNDSPVARAQLDVAWLTDTAQRDRALDSLLVDGLVEQTADGRFALAGEGD

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
5 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
6 2643221692 Nocardia sp. Root136 Isolate Unclassified
7 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
8 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
9 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
10 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
11 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
12 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
13 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
14 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
15 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
16 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
17 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
18 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
19 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
20 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
21 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
22 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
23 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
24 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
25 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
102 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.8
Metatranscriptomes 0
Isolates 7.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.73
Nodule 0.29
Rhizoplane 10.66
Rhizosphere 50.43
Stem 0
Stem Tuber 0
Unclassified 19.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10046879 3300003320 Bacteria 5376
2 Ga0055540_1000332 3300003792 Bacteria 41197
3 Ga0055540_1002529 3300003792 Bacteria 9551
4 Ga0070668_100005687 3300005347 Bacteria 9243
5 Ga0070669_100000974 3300005353 Bacteria 20904
6 Ga0070671_100000602 3300005355 Bacteria 25682
7 Ga0070667_100000054 3300005367 Bacteria 151864
8 Ga0070667_100001778 3300005367 Bacteria 19197
9 Ga0070667_100228046 3300005367 Bacteria 1660
10 Ga0070667_100348867 3300005367 Bacteria 1339
11 Ga0070709_10015661 3300005434 Bacteria 4318
12 Ga0070714_100005110 3300005435 Bacteria 9981
13 Ga0070714_100092064 3300005435 Bacteria 2657
14 Ga0070713_100045622 3300005436 Bacteria 3593
15 Ga0070713_100194501 3300005436 Bacteria 1829
16 Ga0070663_100049857 3300005455 Bacteria 2975
17 Ga0068853_100011949 3300005539 Bacteria 7063
18 Ga0070665_100022520 3300005548 Bacteria 6341
19 Ga0070702_100077061 3300005615 Bacteria 1986
20 Ga0068859_100097300 3300005617 Bacteria 2996
21 Ga0068859_100206370 3300005617 Bacteria 2050
22 Ga0068864_100049190 3300005618 Bacteria 3627
23 Ga0068863_100002719 3300005841 Bacteria 17470
24 Ga0068858_100046904 3300005842 Bacteria 4006
25 Ga0068860_100000150 3300005843 Bacteria 113021
26 Ga0068862_100000078 3300005844 Bacteria 114008
27 Ga0081455_10000037 3300005937 Bacteria 136059
28 Ga0081539_10000015 3300005985 Bacteria 395781
29 Ga0075365_10003851 3300006038 Bacteria 7835
30 Ga0075365_10019100 3300006038 Bacteria 4224
31 Ga0075365_10089935 3300006038 Bacteria 2090
32 Ga0075368_10043822 3300006042 Bacteria 1764
33 Ga0075363_100000566 3300006048 Bacteria 12112
34 Ga0075363_100000896 3300006048 Bacteria 10485
35 Ga0075363_100002428 3300006048 Bacteria 7610
36 Ga0075363_100003708 3300006048 Bacteria 6569
37 Ga0075364_10001623 3300006051 Bacteria 12322
38 Ga0075364_10002440 3300006051 Bacteria 10414
39 Ga0075364_10005134 3300006051 Bacteria 7591
40 Ga0075364_10008312 3300006051 Bacteria 6197
41 Ga0075364_10039683 3300006051 Bacteria 3052
42 Ga0075362_10109529 3300006177 Bacteria 1299
43 Ga0075362_10150114 3300006177 Bacteria 1118
44 Ga0075367_10058233 3300006178 Bacteria 2299
45 Ga0075369_10002512 3300006186 Bacteria 6556
46 Ga0075369_10015071 3300006186 Bacteria 3098
47 Ga0075369_10040263 3300006186 Bacteria 1997
48 Ga0075369_10189536 3300006186 Bacteria 947
49 Ga0075370_10001615 3300006353 Bacteria 9954
50 Ga0075370_10022218 3300006353 Bacteria 3482
51 Ga0075370_10025534 3300006353 Bacteria 3270
52 Ga0075370_10054948 3300006353 Bacteria 2262
53 Ga0075370_10059246 3300006353 Bacteria 2179
54 Ga0075370_10096531 3300006353 Bacteria 1708
55 Ga0097620_100097296 3300006931 Bacteria 2996
56 Ga0097620_100206384 3300006931 Bacteria 2050
57 Ga0105245_10001364 3300009098 Bacteria 22114
58 Ga0105247_10000074 3300009101 Bacteria 113207
59 Ga0105248_10000077 3300009177 Bacteria 113148
60 Ga0105237_10003350 3300009545 Bacteria 19075
61 Ga0105237_10049696 3300009545 Bacteria 4214
62 Ga0105237_10496204 3300009545 Bacteria 1227
63 Ga0105249_10000111 3300009553 Bacteria 109164
64 Ga0105239_10001924 3300010375 Bacteria 27070
65 Ga0105239_10009269 3300010375 Bacteria 11129
66 Ga0105239_10567385 3300010375 Bacteria 1293
67 Ga0163162_10122755 3300013306 Bacteria 2702
68 Ga0163163_10079974 3300014325 Bacteria 3268
69 Ga0163163_10206430 3300014325 Bacteria 2013
70 Ga0213873_10000128 3300021358 Bacteria 14438
71 Ga0213876_10000970 3300021384 Bacteria 18866
72 Ga0213876_10018879 3300021384 Bacteria 3641
73 Ga0213876_10019446 3300021384 Bacteria 3589
74 Ga0213876_10033260 3300021384 Bacteria 2718
75 Ga0213876_10039682 3300021384 Bacteria 2487
76 Ga0213875_10000123 3300021388 Bacteria 86889
77 Ga0213875_10002412 3300021388 Bacteria 11234
78 Ga0213875_10002566 3300021388 Bacteria 10819
79 Ga0209673_1007450 3300025273 Bacteria 5041
80 Ga0209051_1000149 3300025303 Bacteria 132185
81 Ga0209051_1000728 3300025303 Bacteria 35703
82 Ga0209051_1002308 3300025303 Bacteria 13885
83 Ga0209051_1003470 3300025303 Bacteria 10324
84 Ga0209051_1072130 3300025303 Bacteria 1034
85 Ga0207710_10000086 3300025900 Bacteria 129918
86 Ga0207671_10007003 3300025914 Bacteria 9885
87 Ga0207671_10026474 3300025914 Bacteria 4344
88 Ga0207681_10000755 3300025923 Bacteria 21272
89 Ga0207700_10162278 3300025928 Bacteria 1857
90 Ga0207664_10002066 3300025929 Bacteria 13221
91 Ga0207664_10042033 3300025929 Bacteria 3565
92 Ga0207664_10047806 3300025929 Bacteria 3363
93 Ga0207711_10000391 3300025941 Bacteria 46492
94 Ga0207679_10131922 3300025945 Bacteria 2006
95 Ga0207712_10000162 3300025961 Bacteria 69049
96 Ga0207668_10003146 3300025972 Bacteria 9660
97 Ga0207658_10000290 3300025986 Bacteria 52606
98 Ga0207658_10004836 3300025986 Bacteria 9312
99 Ga0207703_10033812 3300026035 Bacteria 4055
100 Ga0207703_10630323 3300026035 Bacteria 1016
101 Ga0207639_10030008 3300026041 Bacteria 3985
102 Ga0207678_10018674 3300026067 Bacteria 6088
103 Ga0207641_10002143 3300026088 Bacteria 18645
104 Ga0207676_10101691 3300026095 Bacteria 2384
105 Ga0268265_10000012 3300028380 Bacteria 343132
106 Ga0268264_10000104 3300028381 Bacteria 217837
107 Ga0307511_10136200 3300030521 Bacteria 1461
108 Ga0265327_10001502 3300031251 Bacteria 28921
109 Ga0307413_10008952 3300031824 Bacteria 4761
110 Ga0307518_10000242 3300031838 Bacteria 41098
111 Ga0307518_10015446 3300031838 Bacteria 5473
112 Ga0307410_10076243 3300031852 Bacteria 2340
113 Ga0307411_10234467 3300032005 Bacteria 1433
114 Ga0316582_0053903 3300036647 Bacteria 2559
115 Ga0395898_0302399 3300037466 Bacteria 1526
116 Ga0436364_0088767 3300037853 Bacteria 6602
117 Ga0436364_0207977 3300037853 Bacteria 46460
118 Ga0436364_0369844 3300037853 Bacteria 8190
119 Ga0436364_0661798 3300037853 Bacteria 86818
120 Ga0436364_0997683 3300037853 Bacteria 6609
121 Ga0395901_0231959 3300038443 Bacteria 1927
122 Ga0436365_0123515 3300039437 Bacteria 51393
123 Ga0436365_0133945 3300039437 Bacteria 5853
124 Ga0436365_0351391 3300039437 Bacteria 6871
125 Ga0436365_1148961 3300039437 Bacteria 22755
126 Ga0436365_1215690 3300039437 Bacteria 17274
127 Ga0436365_1861291 3300039437 Bacteria 1413
128 Ga0436365_1875952 3300039437 Bacteria 53998
129 Ga0436363_0577177 3300039450 Bacteria 1191
130 Ga0436363_1274443 3300039450 Bacteria 3073
131 Ga0436362_0665629 3300039453 Bacteria 14531
132 Ga0439466_0004709 3300041411 Bacteria 5245
133 Ga0439466_0009574 3300041411 Bacteria 3621
134 Ga0439466_0026610 3300041411 Bacteria 2009
135 Ga0439465_0019176 3300041413 Bacteria 2138
136 Ga0451793_1711977 3300041452 Bacteria 2483
137 Ga0439431_0002878 3300041997 Bacteria 3787
138 Ga0439431_0007321 3300041997 Bacteria 2460
139 Ga0439449_0017106 3300042007 Bacteria 2721
140 Ga0466969_0035119 3300044656 Bacteria 2537
141 Ga0466972_0032470 3300044658 Bacteria 2563
142 Ga0466972_0034357 3300044658 Bacteria 2485
143 Ga0466972_0042270 3300044658 Bacteria 2217
144 Ga0466965_0009090 3300044683 Bacteria 4611
145 Ga0466965_0061851 3300044683 Bacteria 1872
146 Ga0466966_0000310 3300044684 Bacteria 31446
147 Ga0466966_0002005 3300044684 Bacteria 13211
148 Ga0466966_0029353 3300044684 Bacteria 3579
149 Ga0466966_0060663 3300044684 Bacteria 2387
150 Ga0466961_0010021 3300044693 Bacteria 6037
151 Ga0466961_0099867 3300044693 Bacteria 1829
152 Ga0466963_0011373 3300044694 Bacteria 5417
153 Ga0466963_0011748 3300044694 Bacteria 5339
154 Ga0466963_0023172 3300044694 Bacteria 3939
155 Ga0466971_0007687 3300044719 Bacteria 4700
156 Ga0466968_0002729 3300044735 Bacteria 6524
157 Ga0466968_0005319 3300044735 Bacteria 4817
158 Ga0466968_0040455 3300044735 Bacteria 1965
159 Ga0466968_0128431 3300044735 Bacteria 1152
160 Ga0466970_0021822 3300044765 Bacteria 3339
161 Ga0466970_0058013 3300044765 Bacteria 2071
162 Ga0466957_0004660 3300044842 Bacteria 7663
163 Ga0466957_0008138 3300044842 Bacteria 5952
164 Ga0466957_0015871 3300044842 Bacteria 4401
165 Ga0466957_0036495 3300044842 Bacteria 2955
166 Ga0466957_0105806 3300044842 Bacteria 1779
167 Ga0466960_0000399 3300044901 Bacteria 14825
168 Ga0466959_0012255 3300045049 Bacteria 6188
169 Ga0466959_0058494 3300045049 Bacteria 2807
170 Ga0466959_0090273 3300045049 Bacteria 2201
171 Ga0466958_0000081 3300045836 Bacteria 29136
172 Ga0466958_0019784 3300045836 Bacteria 3920
173 Ga0466958_0060382 3300045836 Bacteria 2308
174 Ga0466958_0285407 3300045836 Bacteria 1058
175 Ga0466967_0011280 3300045976 Bacteria 6756
176 Ga0466967_0019527 3300045976 Bacteria 5452
177 Ga0466967_0026697 3300045976 Bacteria 4788
178 Ga0466967_0268063 3300045976 Bacteria 1635
179 Ga0466967_0313665 3300045976 Bacteria 1511
180 Ga0466967_0339717 3300045976 Bacteria 1452
181 Ga0466967_0380991 3300045976 Bacteria 1369
182 Ga0466967_0809979 3300045976 Bacteria 930
183 Ga0495638_0001520 3300046460 Bacteria 20883
184 Ga0495639_0069883 3300046475 Bacteria 1620
185 Ga0495607_0053194 3300046501 Bacteria 2341
186 Ga0495583_0030226 3300046506 Bacteria 2641
187 Ga0495648_0005926 3300046524 Bacteria 10056
188 Ga0495665_0030253 3300046531 Bacteria 2898
189 Ga0495634_0179352 3300046642 Bacteria 1327
190 Ga0495624_0132691 3300046690 Bacteria 1527
191 Ga0495674_0046385 3300047319 Bacteria 3857
192 Ga0495672_0086908 3300047320 Bacteria 1728
193 Ga0495683_0001563 3300047323 Bacteria 14824
194 Ga0495683_0056221 3300047323 Bacteria 1958
195 Ga0495673_0001676 3300047469 Bacteria 17037
196 Ga0495686_0001525 3300047472 Bacteria 24906
197 Ga0495593_0038707 3300047673 Bacteria 2574
198 Ga0496100_0000021 3300048903 Bacteria 140074
199 Ga0496100_0002331 3300048903 Bacteria 9603
200 Ga0496100_0002965 3300048903 Bacteria 8730
201 Ga0496101_0000037 3300048904 Bacteria 166198
202 Ga0496101_0000088 3300048904 Bacteria 101493
203 Ga0496101_0001048 3300048904 Bacteria 16336
204 Ga0496102_0000083 3300048905 Bacteria 138102
205 Ga0496102_0000214 3300048905 Bacteria 76691
206 Ga0496102_0016870 3300048905 Bacteria 6389
207 Ga0496102_0027991 3300048905 Bacteria 5035
208 Ga0496103_0000060 3300048906 Bacteria 138526
209 Ga0496103_0000962 3300048906 Bacteria 20448
210 Ga0496103_0002919 3300048906 Bacteria 10604
211 Ga0496103_0064064 3300048906 Bacteria 2291
212 Ga0496104_0024773 3300048907 Bacteria 5525
213 Ga0496105_0044103 3300048908 Bacteria 3677
214 Ga0496106_0004664 3300048909 Bacteria 10162
215 Ga0496106_0012285 3300048909 Bacteria 6319
216 Ga0496106_0474775 3300048909 Bacteria 1005
217 Ga0496107_0001058 3300048910 Bacteria 16477
218 Ga0496107_0019530 3300048910 Bacteria 4782
219 Ga0496107_0020430 3300048910 Bacteria 4678
220 Ga0496108_0000616 3300048911 Bacteria 27935
221 Ga0496108_0045302 3300048911 Bacteria 3674
222 Ga0496108_0389318 3300048911 Bacteria 1217
223 Ga0496109_0000042 3300048912 Bacteria 138654
224 Ga0496109_0050832 3300048912 Bacteria 3774
225 Ga0496109_0068282 3300048912 Bacteria 3259
226 Ga0496110_0275111 3300048913 Bacteria 1533
227 Ga0496111_0052919 3300048914 Bacteria 2932
228 Ga0496112_0245001 3300048915 Bacteria 1744
229 Ga0496113_0008730 3300048916 Bacteria 6617
230 Ga0496114_0000620 3300048917 Bacteria 26246
231 Ga0496114_0009610 3300048917 Bacteria 7681
232 Ga0496115_0006706 3300048918 Bacteria 8444
233 Ga0496115_0018760 3300048918 Bacteria 5317
234 Ga0496116_0000159 3300048919 Bacteria 138102
235 Ga0496116_0005139 3300048919 Bacteria 12285
236 Ga0496116_0014418 3300048919 Bacteria 6313
237 Ga0496117_0000167 3300048920 Bacteria 138102
238 Ga0496117_0001209 3300048920 Bacteria 38718
239 Ga0496117_0059758 3300048920 Bacteria 2630
240 Ga0496117_0080173 3300048920 Bacteria 2148
241 Ga0496118_0000121 3300048921 Bacteria 138102
242 Ga0496118_0000160 3300048921 Bacteria 120349
243 Ga0496118_0000331 3300048921 Bacteria 80747
244 Ga0496119_0003922 3300048922 Bacteria 15091
245 Ga0496119_0003977 3300048922 Bacteria 14954
246 Ga0496121_0000002 3300048924 Bacteria 1494588
247 Ga0496121_0000062 3300048924 Bacteria 274819
248 Ga0496121_0012304 3300048924 Bacteria 9360
249 Ga0496122_0000048 3300048925 Bacteria 269532
250 Ga0496123_0007636 3300048926 Bacteria 10122
251 Ga0496124_0000002 3300048927 Bacteria 1494588
252 Ga0496124_0051315 3300048927 Bacteria 3510
253 Ga0496125_0000002 3300048928 Bacteria 1480920
254 Ga0496125_0173603 3300048928 Bacteria 1445
255 Ga0496126_0000009 3300048929 Bacteria 750350
256 Ga0496126_0000368 3300048929 Bacteria 92918
257 Ga0496126_0020285 3300048929 Bacteria 6523
258 Ga0496126_0044873 3300048929 Bacteria 4067
259 Ga0496126_0101291 3300048929 Bacteria 2519
260 Ga0501032_0001469 3300049569 Bacteria 18772
261 Ga0501032_0011650 3300049569 Bacteria 6305
262 Ga0501032_0026564 3300049569 Bacteria 3980
263 Ga0501033_0013834 3300049570 Bacteria 6140
264 Ga0501033_0317821 3300049570 Bacteria 1094
265 Ga0501034_0001433 3300049571 Bacteria 31790
266 Ga0501034_0083987 3300049571 Bacteria 3186
267 Ga0501036_0088191 3300049572 Bacteria 2622
268 Ga0501037_0000252 3300049573 Bacteria 45847
269 Ga0501038_0001347 3300049574 Bacteria 22359
270 Ga0501039_0000433 3300049575 Bacteria 30193
271 Ga0501040_0388636 3300049576 Bacteria 1001
272 Ga0501043_0003819 3300049579 Bacteria 12392
273 Ga0501047_0043853 3300049581 Bacteria 4320
274 Ga0501047_0087804 3300049581 Bacteria 2987
275 Ga0501047_0272166 3300049581 Bacteria 1540
276 Ga0501067_0027881 3300049583 Bacteria 3130
277 Ga0501069_0075918 3300049585 Bacteria 1889
278 Ga0501070_0001055 3300049586 Bacteria 24784
279 Ga0501070_0098743 3300049586 Bacteria 2415
280 Ga0501073_0032963 3300049589 Bacteria 3691
281 Ga0501080_0162470 3300049742 Bacteria 2062
282 Ga0501035_0005367 3300049822 Bacteria 12119
283 Ga0501044_0000410 3300049823 Bacteria 52916
284 Ga0501044_0006749 3300049823 Bacteria 12655
285 Ga0501044_0018689 3300049823 Bacteria 7423
286 Ga0501044_0137598 3300049823 Bacteria 2433
287 Ga0501044_0211334 3300049823 Bacteria 1894
288 nmdc:mga03683_90480_c1 3300050489 Bacteria 1333
289 nmdc:mga03n38_144068_c1 3300050490 Bacteria 1193
290 nmdc:mga03n38_4719_c1 3300050490 Bacteria 4553
291 nmdc:mga03n38_48_c1 3300050490 Bacteria 25875
292 nmdc:mga03n38_98691_c1 3300050490 Bacteria 1405
293 nmdc:mga00v17_13603_c1 3300050491 Bacteria 4521
294 nmdc:mga00v17_18386_c1 3300050491 Bacteria 3969
295 nmdc:mga00v17_203105_c1 3300050491 Bacteria 1281
296 nmdc:mga00v17_2186_c1 3300050491 Bacteria 10044
297 nmdc:mga00v17_234921_c1 3300050491 Bacteria 1188
298 nmdc:mga00v17_66640_c1 3300050491 Bacteria 2223
299 nmdc:mga0yw44_104057_c1 3300050492 Bacteria 1811
300 nmdc:mga0yw44_13434_c1 3300050492 Bacteria 4312
301 nmdc:mga0yw44_31137_c1 3300050492 Bacteria 3099
302 nmdc:mga0yw44_54375_c1 3300050492 Bacteria 1761
303 nmdc:mga06z11_29319_c1 3300050494 Bacteria 2650
304 nmdc:mga04h51_11660_c1 3300050495 Bacteria 2446
305 nmdc:mga07m45_1405_c1 3300050496 Bacteria 11012
306 nmdc:mga07m45_51211_c1 3300050496 Bacteria 2328
307 nmdc:mga07m45_77299_c1 3300050496 Bacteria 1898
308 nmdc:mga06r32_105640_c1 3300050510 Bacteria 2766
309 nmdc:mga0sz30_10922_c1 3300050516 Bacteria 3492
310 nmdc:mga0sz30_3802_c1 3300050516 Bacteria 5437
311 nmdc:mga0sz30_44742_c1 3300050516 Bacteria 1866
312 Ga0500610_0001537 3300053079 Bacteria 7934
313 Ga0500643_004780 3300053087 Bacteria 6000
314 Ga0500643_011984 3300053087 Bacteria 3128
315 Ga0500562_008167 3300053108 Bacteria 2641
316 Ga0500652_093382 3300053131 Bacteria 1256
317 Ga0500559_0016062 3300053136 Bacteria 3161
318 Ga0500568_0002380 3300053139 Bacteria 11121
319 Ga0500645_000082 3300053730 Bacteria 76473
320 Ga0466962_0002860 3300061719 Bacteria 8228
321 Ga0466962_0021678 3300061719 Bacteria 3084
322 Ga0466962_0047664 3300061719 Bacteria 2048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0809979 Ga0466967_0809979_183_917 242
2 3300006186 Ga0075369_10002512 Ga0075369_100025126 253
3 3300044765 Ga0466970_0058013 Ga0466970_0058013_1289_2056 253
4 3300049823 Ga0501044_0211334 Ga0501044_0211334_710_1480 255
5 3300042007 Ga0439449_0017106 Ga0439449_0017106_1904_2689 259
6 3300045976 Ga0466967_0011280 Ga0466967_0011280_1430_2227 265
7 3300049571 Ga0501034_0083987 Ga0501034_0083987_156_953 265
8 3300049823 Ga0501044_0018689 Ga0501044_0018689_74_871 265
9 3300061719 Ga0466962_0047664 Ga0466962_0047664_830_1627 265
10 3300044694 Ga0466963_0011748 Ga0466963_0011748_2375_3337 266
11 3300045836 Ga0466958_0019784 Ga0466958_0019784_2772_3734 266
12 3300045976 Ga0466967_0313665 Ga0466967_0313665_47_916 266
13 3300061719 Ga0466962_0021678 Ga0466962_0021678_1235_2197 266
14 3300037466 Ga0395898_0302399 Ga0395898_0302399_83_1045 267
15 3300038443 Ga0395901_0231959 Ga0395901_0231959_598_1560 267
16 3300045976 Ga0466967_0380991 Ga0466967_0380991_464_1345 277
17 3300037853 Ga0436364_0088767 Ga0436364_0088767_3298_4164 280
18 3300039437 Ga0436365_0133945 Ga0436365_0133945_3503_4369 280
19 3300005985 Ga0081539_10000015 Ga0081539_10000015249 281
20 3300037853 Ga0436364_0369844 Ga0436364_0369844_3074_3922 281
21 3300048920 Ga0496117_0080173 Ga0496117_0080173_621_1520 282
22 3300048921 Ga0496118_0000160 Ga0496118_0000160_78910_79809 282
23 3300049586 Ga0501070_0098743 Ga0501070_0098743_1469_2335 282
24 3300049742 Ga0501080_0162470 Ga0501080_0162470_310_1176 282
25 3300006038 Ga0075365_10003851 Ga0075365_100038517 283
26 3300006038 Ga0075365_10019100 Ga0075365_100191002 283
27 3300006042 Ga0075368_10043822 Ga0075368_100438223 283
28 3300006048 Ga0075363_100000896 Ga0075363_1000008963 283
29 3300006048 Ga0075363_100002428 Ga0075363_1000024289 283
30 3300006048 Ga0075363_100003708 Ga0075363_1000037083 283
31 3300006051 Ga0075364_10001623 Ga0075364_100016235 283
32 3300006051 Ga0075364_10005134 Ga0075364_100051347 283
33 3300006177 Ga0075362_10109529 Ga0075362_101095291 283
34 3300006177 Ga0075362_10150114 Ga0075362_101501141 283
35 3300006178 Ga0075367_10058233 Ga0075367_100582332 283
36 3300006186 Ga0075369_10015071 Ga0075369_100150712 283
37 3300006353 Ga0075370_10001615 Ga0075370_100016157 283
38 3300006353 Ga0075370_10059246 Ga0075370_100592462 283
39 3300044658 Ga0466972_0034357 Ga0466972_0034357_1085_1954 283
40 3300044842 Ga0466957_0105806 Ga0466957_0105806_742_1611 283
41 3300045049 Ga0466959_0090273 Ga0466959_0090273_727_1596 283
42 3300050489 nmdc:mga03683_90480_c1 nmdc:mga03683_90480_c1_406_1275 283
43 3300050490 nmdc:mga03n38_4719_c1 nmdc:mga03n38_4719_c1_2610_3479 283
44 3300050490 nmdc:mga03n38_48_c1 nmdc:mga03n38_48_c1_16677_17546 283
45 3300050490 nmdc:mga03n38_98691_c1 nmdc:mga03n38_98691_c1_43_912 283
46 3300050491 nmdc:mga00v17_13603_c1 nmdc:mga00v17_13603_c1_1161_2030 283
47 3300050491 nmdc:mga00v17_18386_c1 nmdc:mga00v17_18386_c1_1129_1998 283
48 3300050492 nmdc:mga0yw44_13434_c1 nmdc:mga0yw44_13434_c1_1446_2315 283
49 3300050492 nmdc:mga0yw44_54375_c1 nmdc:mga0yw44_54375_c1_731_1600 283
50 3300050494 nmdc:mga06z11_29319_c1 nmdc:mga06z11_29319_c1_77_946 283
51 3300050495 nmdc:mga04h51_11660_c1 nmdc:mga04h51_11660_c1_753_1622 283
52 3300050496 nmdc:mga07m45_1405_c1 nmdc:mga07m45_1405_c1_5177_6046 283
53 3300050516 nmdc:mga0sz30_44742_c1 nmdc:mga0sz30_44742_c1_245_1114 283
54 3300044656 Ga0466969_0035119 Ga0466969_0035119_811_1683 284
55 3300044684 Ga0466966_0002005 Ga0466966_0002005_11380_12252 284
56 3300044842 Ga0466957_0015871 Ga0466957_0015871_3163_4035 284
57 iso_pu_bacteria 2547132424 2548692733 284
58 iso_pu_bacteria 2643221687 2644488678 284
59 iso_pu_bacteria 2643221692 2644515745 284
60 iso_pu_bacteria 2842134933 2842136466 284
61 3300031852 Ga0307410_10076243 Ga0307410_100762432 285
62 3300044693 Ga0466961_0099867 Ga0466961_0099867_913_1782 285
63 3300053139 Ga0500568_0002380 Ga0500568_0002380_9497_10387 285
64 iso_pu_bacteria 2585427649 2586065086 285
65 iso_pu_bacteria 2751185734 2753075816 285
66 iso_pu_bacteria 2808606522 2809593484 285
67 iso_pu_bacteria 2870721527 2870728581 285
68 iso_pu_bacteria 2915768154 2915769368 285
69 3300021388 Ga0213875_10002566 Ga0213875_100025663 286
70 3300044684 Ga0466966_0000310 Ga0466966_0000310_20076_20954 286
71 3300044694 Ga0466963_0011373 Ga0466963_0011373_101_979 286
72 3300044719 Ga0466971_0007687 Ga0466971_0007687_1589_2467 286
73 3300044842 Ga0466957_0008138 Ga0466957_0008138_4834_5712 286
74 3300044842 Ga0466957_0036495 Ga0466957_0036495_419_1285 286
75 3300045049 Ga0466959_0012255 Ga0466959_0012255_1513_2391 286
76 3300045836 Ga0466958_0000081 Ga0466958_0000081_26654_27532 286
77 3300045976 Ga0466967_0268063 Ga0466967_0268063_109_987 286
78 3300061719 Ga0466962_0002860 Ga0466962_0002860_3686_4564 286
79 iso_pu_bacteria 2866612099 2866612543 286
80 iso_pu_bacteria 2899359706 2899366155 286
81 3300021358 Ga0213873_10000128 Ga0213873_1000012812 287
82 3300021384 Ga0213876_10019446 Ga0213876_100194464 287
83 3300021384 Ga0213876_10033260 Ga0213876_100332602 287
84 3300021388 Ga0213875_10000123 Ga0213875_1000012363 287
85 3300037853 Ga0436364_0661798 Ga0436364_0661798_36577_37458 287
86 3300039437 Ga0436365_0351391 Ga0436365_0351391_885_1766 287
87 3300039437 Ga0436365_1148961 Ga0436365_1148961_4756_5637 287
88 3300039453 Ga0436362_0665629 Ga0436362_0665629_1271_2152 287
89 3300041411 Ga0439466_0026610 Ga0439466_0026610_71_934 287
90 3300044735 Ga0466968_0002729 Ga0466968_0002729_4322_5197 287
91 3300044735 Ga0466968_0128431 Ga0466968_0128431_136_1026 287
92 3300044765 Ga0466970_0021822 Ga0466970_0021822_212_1123 287
93 3300045836 Ga0466958_0285407 Ga0466958_0285407_57_947 287
94 3300048929 Ga0496126_0101291 Ga0496126_0101291_1389_2348 287
95 iso_pu_bacteria 2738541264 2738668959 287
96 iso_pu_bacteria 2738541356 2739148251 287
97 iso_pu_bacteria 2902799365 2902800857 287
98 3300003792 Ga0055540_1002529 Ga0055540_10025293 288
99 3300005347 Ga0070668_100005687 Ga0070668_1000056872 288
100 3300005355 Ga0070671_100000602 Ga0070671_10000060222 288
101 3300005367 Ga0070667_100348867 Ga0070667_1003488672 288
102 3300005435 Ga0070714_100005110 Ga0070714_1000051109 288
103 3300005436 Ga0070713_100194501 Ga0070713_1001945011 288
104 3300006051 Ga0075364_10008312 Ga0075364_100083126 288
105 3300006186 Ga0075369_10189536 Ga0075369_101895361 288
106 3300009545 Ga0105237_10003350 Ga0105237_1000335011 288
107 3300010375 Ga0105239_10001924 Ga0105239_100019247 288
108 3300025303 Ga0209051_1002308 Ga0209051_100230811 288
109 3300025303 Ga0209051_1003470 Ga0209051_100347011 288
110 3300025303 Ga0209051_1072130 Ga0209051_10721301 288
111 3300025914 Ga0207671_10007003 Ga0207671_100070035 288
112 3300025928 Ga0207700_10162278 Ga0207700_101622783 288
113 3300025929 Ga0207664_10002066 Ga0207664_100020663 288
114 3300025972 Ga0207668_10003146 Ga0207668_1000314617 288
115 3300031838 Ga0307518_10015446 Ga0307518_100154465 288
116 3300032005 Ga0307411_10234467 Ga0307411_102344672 288
117 3300044658 Ga0466972_0032470 Ga0466972_0032470_1192_2061 288
118 3300044683 Ga0466965_0061851 Ga0466965_0061851_139_1005 288
119 3300044901 Ga0466960_0000399 Ga0466960_0000399_13379_14248 288
120 3300046506 Ga0495583_0030226 Ga0495583_0030226_539_1405 288
121 3300046524 Ga0495648_0005926 Ga0495648_0005926_2735_3601 288
122 3300047320 Ga0495672_0086908 Ga0495672_0086908_503_1396 288
123 3300047469 Ga0495673_0001676 Ga0495673_0001676_2318_3184 288
124 3300048903 Ga0496100_0002331 Ga0496100_0002331_7785_8651 288
125 3300048904 Ga0496101_0000037 Ga0496101_0000037_87945_88811 288
126 3300048905 Ga0496102_0000083 Ga0496102_0000083_102485_103351 288
127 3300048906 Ga0496103_0000060 Ga0496103_0000060_102909_103775 288
128 3300048919 Ga0496116_0000159 Ga0496116_0000159_34752_35618 288
129 3300048920 Ga0496117_0000167 Ga0496117_0000167_102485_103351 288
130 3300048921 Ga0496118_0000121 Ga0496118_0000121_34752_35618 288
131 3300048924 Ga0496121_0000062 Ga0496121_0000062_230253_231119 288
132 3300048929 Ga0496126_0000368 Ga0496126_0000368_50572_51438 288
133 3300049569 Ga0501032_0011650 Ga0501032_0011650_3712_4599 288
134 3300050491 nmdc:mga00v17_234921_c1 nmdc:mga00v17_234921_c1_233_1171 288
135 3300053136 Ga0500559_0016062 Ga0500559_0016062_525_1418 288
136 3300003792 Ga0055540_1000332 Ga0055540_100033211 289
137 3300005367 Ga0070667_100228046 Ga0070667_1002280462 289
138 3300005435 Ga0070714_100092064 Ga0070714_1000920642 289
139 3300005455 Ga0070663_100049857 Ga0070663_1000498572 289
140 3300005539 Ga0068853_100011949 Ga0068853_1000119495 289
141 3300005615 Ga0070702_100077061 Ga0070702_1000770613 289
142 3300005618 Ga0068864_100049190 Ga0068864_1000491902 289
143 3300006038 Ga0075365_10089935 Ga0075365_100899352 289
144 3300006051 Ga0075364_10039683 Ga0075364_100396833 289
145 3300006186 Ga0075369_10040263 Ga0075369_100402633 289
146 3300006353 Ga0075370_10022218 Ga0075370_100222182 289
147 3300006353 Ga0075370_10054948 Ga0075370_100549482 289
148 3300014325 Ga0163163_10206430 Ga0163163_102064302 289
149 3300021388 Ga0213875_10002412 Ga0213875_100024125 289
150 3300025273 Ga0209673_1007450 Ga0209673_10074505 289
151 3300025303 Ga0209051_1000728 Ga0209051_100072824 289
152 3300025929 Ga0207664_10047806 Ga0207664_100478064 289
153 3300025945 Ga0207679_10131922 Ga0207679_101319223 289
154 3300026035 Ga0207703_10630323 Ga0207703_106303231 289
155 3300026041 Ga0207639_10030008 Ga0207639_100300083 289
156 3300026067 Ga0207678_10018674 Ga0207678_100186743 289
157 3300026095 Ga0207676_10101691 Ga0207676_101016912 289
158 3300030521 Ga0307511_10136200 Ga0307511_101362002 289
159 3300031824 Ga0307413_10008952 Ga0307413_100089522 289
160 3300031838 Ga0307518_10000242 Ga0307518_1000024213 289
161 3300037853 Ga0436364_0207977 Ga0436364_0207977_37858_38730 289
162 3300039450 Ga0436363_1274443 Ga0436363_1274443_1084_2007 289
163 3300041411 Ga0439466_0004709 Ga0439466_0004709_1412_2308 289
164 3300041411 Ga0439466_0009574 Ga0439466_0009574_1233_2129 289
165 3300041413 Ga0439465_0019176 Ga0439465_0019176_551_1450 289
166 3300041452 Ga0451793_1711977 Ga0451793_1711977_553_1479 289
167 3300041997 Ga0439431_0002878 Ga0439431_0002878_440_1336 289
168 3300041997 Ga0439431_0007321 Ga0439431_0007321_979_1875 289
169 3300046460 Ga0495638_0001520 Ga0495638_0001520_17641_18558 289
170 3300046501 Ga0495607_0053194 Ga0495607_0053194_374_1249 289
171 3300047323 Ga0495683_0001563 Ga0495683_0001563_217_1092 289
172 3300047472 Ga0495686_0001525 Ga0495686_0001525_12573_13484 289
173 3300048903 Ga0496100_0002965 Ga0496100_0002965_2345_3262 289
174 3300048904 Ga0496101_0001048 Ga0496101_0001048_7549_8466 289
175 3300048905 Ga0496102_0016870 Ga0496102_0016870_4757_5653 289
176 3300048906 Ga0496103_0064064 Ga0496103_0064064_17_901 289
177 3300048907 Ga0496104_0024773 Ga0496104_0024773_3581_4498 289
178 3300048908 Ga0496105_0044103 Ga0496105_0044103_792_1688 289
179 3300048909 Ga0496106_0004664 Ga0496106_0004664_1772_2689 289
180 3300048909 Ga0496106_0474775 Ga0496106_0474775_50_952 289
181 3300048910 Ga0496107_0020430 Ga0496107_0020430_970_1887 289
182 3300048911 Ga0496108_0045302 Ga0496108_0045302_1413_2315 289
183 3300048912 Ga0496109_0050832 Ga0496109_0050832_1597_2499 289
184 3300048912 Ga0496109_0068282 Ga0496109_0068282_2090_2974 289
185 3300048913 Ga0496110_0275111 Ga0496110_0275111_512_1414 289
186 3300048915 Ga0496112_0245001 Ga0496112_0245001_608_1510 289
187 3300048916 Ga0496113_0008730 Ga0496113_0008730_3160_4062 289
188 3300048917 Ga0496114_0009610 Ga0496114_0009610_4521_5438 289
189 3300048918 Ga0496115_0018760 Ga0496115_0018760_2245_3162 289
190 3300049569 Ga0501032_0001469 Ga0501032_0001469_11259_12173 289
191 3300049570 Ga0501033_0317821 Ga0501033_0317821_12_926 289
192 3300049571 Ga0501034_0001433 Ga0501034_0001433_3396_4310 289
193 3300049573 Ga0501037_0000252 Ga0501037_0000252_9535_10449 289
194 3300049574 Ga0501038_0001347 Ga0501038_0001347_8770_9684 289
195 3300049575 Ga0501039_0000433 Ga0501039_0000433_1526_2440 289
196 3300049576 Ga0501040_0388636 Ga0501040_0388636_20_973 289
197 3300049579 Ga0501043_0003819 Ga0501043_0003819_5846_6760 289
198 3300049581 Ga0501047_0272166 Ga0501047_0272166_512_1426 289
199 3300049583 Ga0501067_0027881 Ga0501067_0027881_755_1669 289
200 3300049586 Ga0501070_0001055 Ga0501070_0001055_7493_8407 289
201 3300049589 Ga0501073_0032963 Ga0501073_0032963_1460_2374 289
202 3300049823 Ga0501044_0006749 Ga0501044_0006749_10397_11311 289
203 3300049823 Ga0501044_0137598 Ga0501044_0137598_517_1467 289
204 3300050490 nmdc:mga03n38_144068_c1 nmdc:mga03n38_144068_c1_36_938 289
205 3300050491 nmdc:mga00v17_66640_c1 nmdc:mga00v17_66640_c1_677_1585 289
206 3300050496 nmdc:mga07m45_51211_c1 nmdc:mga07m45_51211_c1_705_1613 289
207 3300050510 nmdc:mga06r32_105640_c1 nmdc:mga06r32_105640_c1_657_1553 289
208 3300050516 nmdc:mga0sz30_10922_c1 nmdc:mga0sz30_10922_c1_1398_2312 289
209 3300053079 Ga0500610_0001537 Ga0500610_0001537_4759_5676 289
210 3300053087 Ga0500643_004780 Ga0500643_004780_3947_4843 289
211 3300053108 Ga0500562_008167 Ga0500562_008167_864_1781 289
212 iso_pu_bacteria 2551306166 2552105299 289
213 iso_pu_bacteria 2643221715 2644639623 289
214 iso_pu_bacteria 2863067949 2863069453 289
215 iso_pu_bacteria 2866552031 2866557429 289
216 iso_pu_bacteria 2902792274 2902795637 289
217 iso_pu_bacteria 2902810491 2902814261 289
218 iso_pu_bacteria 2902837492 2902842614 289
219 iso_pu_bacteria 2919713450 2919718039 289
220 iso_pu_bacteria 2929212328 2929218129 289
221 iso_pu_bacteria 2939582691 2939584022 289
222 3300005937 Ga0081455_10000037 Ga0081455_1000003713 290
223 3300006048 Ga0075363_100000566 Ga0075363_1000005666 290
224 3300006051 Ga0075364_10002440 Ga0075364_100024404 290
225 3300006353 Ga0075370_10025534 Ga0075370_100255343 290
226 3300009098 Ga0105245_10001364 Ga0105245_1000136422 290
227 3300010375 Ga0105239_10009269 Ga0105239_100092695 290
228 3300013306 Ga0163162_10122755 Ga0163162_101227553 290
229 3300021384 Ga0213876_10018879 Ga0213876_100188791 290
230 3300039437 Ga0436365_1875952 Ga0436365_1875952_42789_43688 290
231 3300044658 Ga0466972_0042270 Ga0466972_0042270_284_1195 290
232 3300045976 Ga0466967_0026697 Ga0466967_0026697_2372_3271 290
233 3300045976 Ga0466967_0339717 Ga0466967_0339717_165_1064 290
234 3300046475 Ga0495639_0069883 Ga0495639_0069883_133_1032 290
235 3300046531 Ga0495665_0030253 Ga0495665_0030253_1545_2444 290
236 3300046642 Ga0495634_0179352 Ga0495634_0179352_367_1266 290
237 3300046690 Ga0495624_0132691 Ga0495624_0132691_267_1166 290
238 3300047319 Ga0495674_0046385 Ga0495674_0046385_1618_2517 290
239 3300047323 Ga0495683_0056221 Ga0495683_0056221_954_1853 290
240 3300047673 Ga0495593_0038707 Ga0495593_0038707_1641_2540 290
241 3300048911 Ga0496108_0389318 Ga0496108_0389318_200_1138 290
242 3300050491 nmdc:mga00v17_2186_c1 nmdc:mga00v17_2186_c1_5315_6196 290
243 3300050492 nmdc:mga0yw44_104057_c1 nmdc:mga0yw44_104057_c1_474_1355 290
244 3300050496 nmdc:mga07m45_77299_c1 nmdc:mga07m45_77299_c1_901_1800 290
245 3300005353 Ga0070669_100000974 Ga0070669_10000097420 291
246 3300005367 Ga0070667_100000054 Ga0070667_100000054136 291
247 3300005367 Ga0070667_100001778 Ga0070667_1000017783 291
248 3300005548 Ga0070665_100022520 Ga0070665_1000225205 291
249 3300005617 Ga0068859_100097300 Ga0068859_1000973002 291
250 3300005617 Ga0068859_100206370 Ga0068859_1002063703 291
251 3300005841 Ga0068863_100002719 Ga0068863_10000271914 291
252 3300005842 Ga0068858_100046904 Ga0068858_1000469042 291
253 3300005843 Ga0068860_100000150 Ga0068860_10000015081 291
254 3300005844 Ga0068862_100000078 Ga0068862_10000007839 291
255 3300006353 Ga0075370_10096531 Ga0075370_100965312 291
256 3300006931 Ga0097620_100097296 Ga0097620_1000972964 291
257 3300006931 Ga0097620_100206384 Ga0097620_1002063843 291
258 3300009101 Ga0105247_10000074 Ga0105247_1000007436 291
259 3300009177 Ga0105248_10000077 Ga0105248_1000007779 291
260 3300009545 Ga0105237_10049696 Ga0105237_100496965 291
261 3300009553 Ga0105249_10000111 Ga0105249_1000011178 291
262 3300010375 Ga0105239_10567385 Ga0105239_105673851 291
263 3300014325 Ga0163163_10079974 Ga0163163_100799744 291
264 3300021384 Ga0213876_10000970 Ga0213876_1000097015 291
265 3300025303 Ga0209051_1000149 Ga0209051_100014984 291
266 3300025900 Ga0207710_10000086 Ga0207710_1000008637 291
267 3300025914 Ga0207671_10026474 Ga0207671_100264743 291
268 3300025923 Ga0207681_10000755 Ga0207681_1000075521 291
269 3300025941 Ga0207711_10000391 Ga0207711_1000039110 291
270 3300025961 Ga0207712_10000162 Ga0207712_1000016233 291
271 3300025986 Ga0207658_10000290 Ga0207658_1000029037 291
272 3300025986 Ga0207658_10004836 Ga0207658_100048363 291
273 3300026035 Ga0207703_10033812 Ga0207703_100338122 291
274 3300026088 Ga0207641_10002143 Ga0207641_100021439 291
275 3300028380 Ga0268265_10000012 Ga0268265_1000001279 291
276 3300028381 Ga0268264_10000104 Ga0268264_10000104138 291
277 3300031251 Ga0265327_10001502 Ga0265327_1000150215 291
278 3300036647 Ga0316582_0053903 Ga0316582_0053903_990_1907 291
279 3300037853 Ga0436364_0997683 Ga0436364_0997683_178_1080 291
280 3300039437 Ga0436365_0123515 Ga0436365_0123515_40030_40932 291
281 3300039437 Ga0436365_1861291 Ga0436365_1861291_63_965 291
282 3300039450 Ga0436363_0577177 Ga0436363_0577177_62_964 291
283 3300044683 Ga0466965_0009090 Ga0466965_0009090_1899_2786 291
284 3300044693 Ga0466961_0010021 Ga0466961_0010021_2842_3744 291
285 3300044694 Ga0466963_0023172 Ga0466963_0023172_85_987 291
286 3300044735 Ga0466968_0005319 Ga0466968_0005319_797_1699 291
287 3300044842 Ga0466957_0004660 Ga0466957_0004660_4246_5148 291
288 3300045049 Ga0466959_0058494 Ga0466959_0058494_1810_2712 291
289 3300048903 Ga0496100_0000021 Ga0496100_0000021_38786_39673 291
290 3300048904 Ga0496101_0000088 Ga0496101_0000088_19286_20173 291
291 3300048905 Ga0496102_0000214 Ga0496102_0000214_36854_37759 291
292 3300048905 Ga0496102_0027991 Ga0496102_0027991_3077_3964 291
293 3300048906 Ga0496103_0000962 Ga0496103_0000962_8652_9557 291
294 3300048906 Ga0496103_0002919 Ga0496103_0002919_1776_2663 291
295 3300048909 Ga0496106_0012285 Ga0496106_0012285_1283_2170 291
296 3300048910 Ga0496107_0001058 Ga0496107_0001058_9181_10068 291
297 3300048910 Ga0496107_0019530 Ga0496107_0019530_921_1826 291
298 3300048911 Ga0496108_0000616 Ga0496108_0000616_5845_6732 291
299 3300048912 Ga0496109_0000042 Ga0496109_0000042_80646_81533 291
300 3300048914 Ga0496111_0052919 Ga0496111_0052919_738_1625 291
301 3300048917 Ga0496114_0000620 Ga0496114_0000620_14705_15592 291
302 3300048918 Ga0496115_0006706 Ga0496115_0006706_1028_1915 291
303 3300048919 Ga0496116_0005139 Ga0496116_0005139_4433_5320 291
304 3300048919 Ga0496116_0014418 Ga0496116_0014418_1875_2780 291
305 3300048920 Ga0496117_0001209 Ga0496117_0001209_26409_27314 291
306 3300048920 Ga0496117_0059758 Ga0496117_0059758_672_1559 291
307 3300048921 Ga0496118_0000331 Ga0496118_0000331_50471_51376 291
308 3300048922 Ga0496119_0003922 Ga0496119_0003922_12983_13888 291
309 3300048922 Ga0496119_0003977 Ga0496119_0003977_6645_7532 291
310 3300048924 Ga0496121_0000002 Ga0496121_0000002_253230_254117 291
311 3300048924 Ga0496121_0012304 Ga0496121_0012304_3313_4218 291
312 3300048925 Ga0496122_0000048 Ga0496122_0000048_211676_212563 291
313 3300048926 Ga0496123_0007636 Ga0496123_0007636_3376_4263 291
314 3300048927 Ga0496124_0000002 Ga0496124_0000002_1240472_1241359 291
315 3300048927 Ga0496124_0051315 Ga0496124_0051315_858_1763 291
316 3300048928 Ga0496125_0000002 Ga0496125_0000002_253230_254117 291
317 3300048928 Ga0496125_0173603 Ga0496125_0173603_514_1419 291
318 3300048929 Ga0496126_0000009 Ga0496126_0000009_496234_497121 291
319 3300048929 Ga0496126_0044873 Ga0496126_0044873_2165_3070 291
320 3300049581 Ga0501047_0087804 Ga0501047_0087804_1604_2500 291
321 3300049585 Ga0501069_0075918 Ga0501069_0075918_836_1798 291
322 3300050491 nmdc:mga00v17_203105_c1 nmdc:mga00v17_203105_c1_163_1107 291
323 3300050492 nmdc:mga0yw44_31137_c1 nmdc:mga0yw44_31137_c1_42_956 291
324 3300050516 nmdc:mga0sz30_3802_c1 nmdc:mga0sz30_3802_c1_746_1639 291
325 3300053087 Ga0500643_011984 Ga0500643_011984_673_1548 291
326 3300053131 Ga0500652_093382 Ga0500652_093382_12_887 291
327 3300053730 Ga0500645_000082 Ga0500645_000082_59110_59985 291
328 3300005434 Ga0070709_10015661 Ga0070709_100156614 292
329 3300005436 Ga0070713_100045622 Ga0070713_1000456223 292
330 3300009545 Ga0105237_10496204 Ga0105237_104962042 292
331 3300021384 Ga0213876_10039682 Ga0213876_100396822 292
332 3300025929 Ga0207664_10042033 Ga0207664_100420334 292
333 3300039437 Ga0436365_1215690 Ga0436365_1215690_3117_4001 292
334 3300045976 Ga0466967_0019527 Ga0466967_0019527_2509_3420 292
335 3300049569 Ga0501032_0026564 Ga0501032_0026564_1714_2622 292
336 3300049570 Ga0501033_0013834 Ga0501033_0013834_3392_4300 292
337 3300049572 Ga0501036_0088191 Ga0501036_0088191_1344_2252 292
338 3300049581 Ga0501047_0043853 Ga0501047_0043853_2863_3771 292
339 3300049822 Ga0501035_0005367 Ga0501035_0005367_9611_10519 292
340 3300049823 Ga0501044_0000410 Ga0501044_0000410_36123_37031 292
341 iso_pu_bacteria 2523231044 2523384968 292
342 3300003320 rootH2_10046879 rootH2_100468792 293
343 3300044684 Ga0466966_0029353 Ga0466966_0029353_1535_2416 293
344 3300044684 Ga0466966_0060663 Ga0466966_0060663_980_1888 293
345 3300044735 Ga0466968_0040455 Ga0466968_0040455_548_1456 293
346 3300045836 Ga0466958_0060382 Ga0466958_0060382_614_1522 293
347 3300048929 Ga0496126_0020285 Ga0496126_0020285_5125_6012 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10576

EndIII_4Fe-2S

Iron-sulfur binding domain of endonuclease III

248

262

0.95

PF00633

HHH

Helix-hairpin-helix motif

157

186

0.94

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

93

220

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yph-assembly1.cif.gz_A crystal structure of muty bound to its anti-substrate with the disulfide cross-linker reduced 0.9266 3 213
1rrq-assembly1.cif.gz_A muty adenine glycosylase in complex with dna containing an a:oxog pair 0.9194 3 219
1rrs-assembly1.cif.gz_A muty adenine glycosylase in complex with dna containing an abasic site 0.9175 3 219
5kn9-assembly1.cif.gz_A muty n-terminal domain in complex with dna containing an intrahelical oxog:a base-pair 0.9095 1 218
8dvy-assembly1.cif.gz_A dna glycosylase muty variant n146s in complex with dna containing d(8-oxo-g) paired with an enzyme-generated abasic site product (ap) and crystalized with calcium acetate 0.9069 3 225
ID Description Score Start End Superfamily
af_P9WQ09_31_141_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9947 20 130 1.10.340.30
af_P9WQ09_31_141_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9859 20 130 1.10.340.30
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9642 20 132 1.10.340.30
af_A0A1D6IX31_1_95_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9632 39 135 1.10.1670.10
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9588 20 132 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A2S8N6M2-F1-model_v4 deleted 0.9968 35 117
AF-A0A7V9PF85-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9867 39 140 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A7X8VL02-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9842 1 144 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A1Q9TKW9-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.983 7 290 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-Q0S8A2-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9827 1 293 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
94.36 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map