F416912
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 176 | 346 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0719067|Ga0496121_0719067_59_586 |
| Length | 175 |
| Sequence | MFKQPGEKPHFLASGWALNTKARRAFLLRGKRRNVMTAMKLADISEKMRDIDIAMLSTHTDGGAIAGRPMSNNREVDYDGSSYYFTWAESRMVADIERNPQVSLTFQGKKAFSIAVEGKAKVTRDKKAFKAHWTPDLDDWFKDGIETKGVAMIEVQATRLHYWDGEEDGEVKLRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 104 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 105 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 106 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 116 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 117 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 118 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 119 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 120 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 124 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 125 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 126 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 127 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 128 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 129 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 130 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 131 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 132 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 133 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 134 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 135 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 136 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 139 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 140 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 154 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 155 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 156 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 157 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 161 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 162 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 163 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 164 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 166 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 167 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 168 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 169 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 170 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 171 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 172 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 173 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 174 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 175 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 176 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0.58 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.05 |
| Nodule | 0.29 |
| Rhizoplane | 3.18 |
| Rhizosphere | 88.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10106973 | 3300001979 | Bacteria | 708 |
| 2 | JGI24739J22299_10152960 | 3300001989 | Bacteria | 682 |
| 3 | JGI24737J22298_10001946 | 3300001990 | Bacteria | 7388 |
| 4 | JGI24737J22298_10106263 | 3300001990 | Bacteria | 831 |
| 5 | JGI24735J21928_10003470 | 3300002067 | Bacteria | 5369 |
| 6 | JGI24735J21928_10009309 | 3300002067 | Bacteria | 3158 |
| 7 | JGI24738J21930_10002652 | 3300002075 | Bacteria | 4616 |
| 8 | rootH2_10113643 | 3300003320 | Bacteria | 1226 |
| 9 | rootL2_10100517 | 3300003322 | Bacteria | 1091 |
| 10 | Ga0055531_10000094 | 3300003794 | Bacteria | 96266 |
| 11 | Ga0065165_1002026 | 3300005262 | Bacteria | 18863 |
| 12 | Ga0065712_10428532 | 3300005290 | Bacteria | 705 |
| 13 | Ga0065715_10031571 | 3300005293 | Bacteria | 1760 |
| 14 | Ga0065715_10210328 | 3300005293 | Bacteria | 1317 |
| 15 | Ga0065715_11016424 | 3300005293 | Bacteria | 541 |
| 16 | Ga0070658_10000066 | 3300005327 | Bacteria | 103408 |
| 17 | Ga0070658_10059267 | 3300005327 | Bacteria | 3117 |
| 18 | Ga0070658_10511358 | 3300005327 | Bacteria | 1038 |
| 19 | Ga0070658_10541636 | 3300005327 | Bacteria | 1007 |
| 20 | Ga0070676_10454865 | 3300005328 | Unclassified | 901 |
| 21 | Ga0070676_10754138 | 3300005328 | Bacteria | 715 |
| 22 | Ga0070670_100000566 | 3300005331 | Bacteria | 29318 |
| 23 | Ga0070670_100019959 | 3300005331 | Bacteria | 5753 |
| 24 | Ga0070670_100022216 | 3300005331 | Bacteria | 5460 |
| 25 | Ga0070670_100122737 | 3300005331 | Bacteria | 2241 |
| 26 | Ga0070670_100246964 | 3300005331 | Bacteria | 1554 |
| 27 | Ga0070670_100440315 | 3300005331 | Unclassified | 1154 |
| 28 | Ga0070670_100516196 | 3300005331 | Bacteria | 1064 |
| 29 | Ga0070677_10002686 | 3300005333 | Bacteria | 5691 |
| 30 | Ga0070660_100000713 | 3300005339 | Bacteria | 21991 |
| 31 | Ga0070660_100240538 | 3300005339 | Bacteria | 1474 |
| 32 | Ga0070661_100231650 | 3300005344 | Bacteria | 1420 |
| 33 | Ga0070668_100279781 | 3300005347 | Bacteria | 1393 |
| 34 | Ga0070668_100417924 | 3300005347 | Bacteria | 1148 |
| 35 | Ga0070669_100030044 | 3300005353 | Bacteria | 3919 |
| 36 | Ga0070669_100073424 | 3300005353 | Plasmid | 2534 |
| 37 | Ga0070669_100450425 | 3300005353 | Bacteria | 1061 |
| 38 | Ga0070669_100817409 | 3300005353 | Bacteria | 793 |
| 39 | Ga0070669_100861802 | 3300005353 | Bacteria | 772 |
| 40 | Ga0070675_100002994 | 3300005354 | Bacteria | 12765 |
| 41 | Ga0070675_100339529 | 3300005354 | Unclassified | 1330 |
| 42 | Ga0070675_100946410 | 3300005354 | Bacteria | 790 |
| 43 | Ga0070675_101258615 | 3300005354 | Bacteria | 681 |
| 44 | Ga0070671_100042531 | 3300005355 | Bacteria | 3777 |
| 45 | Ga0070671_100112604 | 3300005355 | Bacteria | 2286 |
| 46 | Ga0070671_100149507 | 3300005355 | Bacteria | 1972 |
| 47 | Ga0070671_100185553 | 3300005355 | Bacteria | 1762 |
| 48 | Ga0070671_101705144 | 3300005355 | Bacteria | 559 |
| 49 | Ga0070674_101679332 | 3300005356 | Bacteria | 574 |
| 50 | Ga0070673_100086415 | 3300005364 | Unclassified | 2555 |
| 51 | Ga0070659_100206487 | 3300005366 | Bacteria | 1618 |
| 52 | Ga0070659_101204046 | 3300005366 | Unclassified | 670 |
| 53 | Ga0070714_100347311 | 3300005435 | Bacteria | 1393 |
| 54 | Ga0070663_100023854 | 3300005455 | Bacteria | 4106 |
| 55 | Ga0070663_100461391 | 3300005455 | Bacteria | 1049 |
| 56 | Ga0070663_101032170 | 3300005455 | Bacteria | 716 |
| 57 | Ga0070678_100148154 | 3300005456 | Bacteria | 1887 |
| 58 | Ga0070678_100247430 | 3300005456 | Bacteria | 1494 |
| 59 | Ga0070662_100001623 | 3300005457 | Bacteria | 13868 |
| 60 | Ga0070662_100006709 | 3300005457 | Bacteria | 7437 |
| 61 | Ga0070679_100664433 | 3300005530 | Bacteria | 985 |
| 62 | Ga0070679_102093794 | 3300005530 | Bacteria | 515 |
| 63 | Ga0070684_101135795 | 3300005535 | Bacteria | 734 |
| 64 | Ga0068853_100253092 | 3300005539 | Bacteria | 1617 |
| 65 | Ga0070672_100261786 | 3300005543 | Bacteria | 1459 |
| 66 | Ga0070672_100262745 | 3300005543 | Bacteria | 1456 |
| 67 | Ga0070672_102083180 | 3300005543 | Bacteria | 511 |
| 68 | Ga0070665_100019344 | 3300005548 | Bacteria | 6833 |
| 69 | Ga0070665_100343684 | 3300005548 | Bacteria | 1497 |
| 70 | Ga0070665_100447768 | 3300005548 | Bacteria | 1301 |
| 71 | Ga0070664_100080425 | 3300005564 | Bacteria | 2807 |
| 72 | Ga0070664_100267669 | 3300005564 | Bacteria | 1539 |
| 73 | Ga0070664_100612499 | 3300005564 | Unclassified | 1010 |
| 74 | Ga0068857_100182778 | 3300005577 | Bacteria | 1908 |
| 75 | Ga0068857_100750652 | 3300005577 | Bacteria | 929 |
| 76 | Ga0068864_100109038 | 3300005618 | Bacteria | 2464 |
| 77 | Ga0068864_102486751 | 3300005618 | Bacteria | 524 |
| 78 | Ga0068861_100423431 | 3300005719 | Bacteria | 1187 |
| 79 | Ga0068863_100576574 | 3300005841 | Bacteria | 1112 |
| 80 | Ga0068862_100107754 | 3300005844 | Bacteria | 2443 |
| 81 | Ga0068862_100619766 | 3300005844 | Bacteria | 1041 |
| 82 | Ga0068862_101111629 | 3300005844 | Bacteria | 786 |
| 83 | Ga0075364_10858777 | 3300006051 | Bacteria | 618 |
| 84 | Ga0075364_11100933 | 3300006051 | Bacteria | 539 |
| 85 | Ga0068871_100823738 | 3300006358 | Bacteria | 857 |
| 86 | Ga0075430_100036851 | 3300006846 | Bacteria | 4145 |
| 87 | Ga0068865_101140010 | 3300006881 | Bacteria | 688 |
| 88 | Ga0079104_1120759 | 3300006946 | Bacteria | 514 |
| 89 | Ga0105247_10525096 | 3300009101 | Bacteria | 866 |
| 90 | Ga0105248_10057225 | 3300009177 | Bacteria | 4376 |
| 91 | Ga0105237_10378941 | 3300009545 | Bacteria | 1419 |
| 92 | Ga0105238_10353635 | 3300009551 | Bacteria | 1458 |
| 93 | Ga0105239_10195765 | 3300010375 | Bacteria | 2263 |
| 94 | Ga0157373_10314613 | 3300013100 | Bacteria | 1113 |
| 95 | Ga0157371_10081180 | 3300013102 | Bacteria | 2296 |
| 96 | Ga0157371_10112056 | 3300013102 | Bacteria | 1936 |
| 97 | Ga0157370_10655020 | 3300013104 | Bacteria | 960 |
| 98 | Ga0157369_10301040 | 3300013105 | Bacteria | 1668 |
| 99 | Ga0157374_10468451 | 3300013296 | Bacteria | 1262 |
| 100 | Ga0157372_10092823 | 3300013307 | Bacteria | 3434 |
| 101 | Ga0157372_10102993 | 3300013307 | Bacteria | 3261 |
| 102 | Ga0157380_10084239 | 3300014326 | Plasmid | 2606 |
| 103 | Ga0157380_10513836 | 3300014326 | Bacteria | 1167 |
| 104 | Ga0157380_10521042 | 3300014326 | Bacteria | 1159 |
| 105 | Ga0157380_12002673 | 3300014326 | Bacteria | 641 |
| 106 | Ga0182008_10331983 | 3300014497 | Bacteria | 802 |
| 107 | Ga0182006_1068714 | 3300015261 | Bacteria | 1319 |
| 108 | Ga0182007_10064747 | 3300015262 | Bacteria | 1198 |
| 109 | Ga0182007_10290142 | 3300015262 | Bacteria | 598 |
| 110 | Ga0163161_10669875 | 3300017792 | Bacteria | 861 |
| 111 | Ga0206354_11156600 | 3300020081 | Bacteria | 737 |
| 112 | Ga0206353_10386402 | 3300020082 | Bacteria | 1253 |
| 113 | Ga0209673_1028138 | 3300025273 | Bacteria | 1816 |
| 114 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 115 | Ga0209050_1064503 | 3300025298 | Bacteria | 849 |
| 116 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 117 | Ga0209257_1016629 | 3300025304 | Bacteria | 2960 |
| 118 | Ga0207682_10009828 | 3300025893 | Bacteria | 3763 |
| 119 | Ga0207682_10269260 | 3300025893 | Bacteria | 795 |
| 120 | Ga0207647_10003114 | 3300025904 | Bacteria | 12459 |
| 121 | Ga0207647_10249783 | 3300025904 | Bacteria | 1018 |
| 122 | Ga0207645_10048963 | 3300025907 | Bacteria | 2699 |
| 123 | Ga0207645_10119474 | 3300025907 | Bacteria | 1710 |
| 124 | Ga0207705_10000215 | 3300025909 | Bacteria | 57467 |
| 125 | Ga0207705_10005626 | 3300025909 | Bacteria | 9359 |
| 126 | Ga0207705_10072108 | 3300025909 | Bacteria | 2504 |
| 127 | Ga0207695_10654980 | 3300025913 | Bacteria | 931 |
| 128 | Ga0207671_10089516 | 3300025914 | Bacteria | 2316 |
| 129 | Ga0207657_10001954 | 3300025919 | Bacteria | 22243 |
| 130 | Ga0207657_10002049 | 3300025919 | Bacteria | 21807 |
| 131 | Ga0207649_10087524 | 3300025920 | Bacteria | 2032 |
| 132 | Ga0207649_11290170 | 3300025920 | Unclassified | 577 |
| 133 | Ga0207652_10909620 | 3300025921 | Bacteria | 777 |
| 134 | Ga0207652_11223249 | 3300025921 | Bacteria | 653 |
| 135 | Ga0207681_10077658 | 3300025923 | Bacteria | 2335 |
| 136 | Ga0207681_10178613 | 3300025923 | Bacteria | 1615 |
| 137 | Ga0207694_10196438 | 3300025924 | Bacteria | 1640 |
| 138 | Ga0207650_10006108 | 3300025925 | Bacteria | 8207 |
| 139 | Ga0207650_10148394 | 3300025925 | Bacteria | 1849 |
| 140 | Ga0207659_10295372 | 3300025926 | Unclassified | 1329 |
| 141 | Ga0207659_10948346 | 3300025926 | Bacteria | 740 |
| 142 | Ga0207664_10768004 | 3300025929 | Bacteria | 867 |
| 143 | Ga0207644_10018894 | 3300025931 | Bacteria | 4671 |
| 144 | Ga0207644_10072453 | 3300025931 | Bacteria | 2523 |
| 145 | Ga0207644_10930580 | 3300025931 | Bacteria | 729 |
| 146 | Ga0207690_10088815 | 3300025932 | Bacteria | 2178 |
| 147 | Ga0207690_11013786 | 3300025932 | Unclassified | 691 |
| 148 | Ga0207706_10024507 | 3300025933 | Bacteria | 5409 |
| 149 | Ga0207706_10896875 | 3300025933 | Bacteria | 749 |
| 150 | Ga0207706_11146953 | 3300025933 | Bacteria | 648 |
| 151 | Ga0207711_10002660 | 3300025941 | Bacteria | 15795 |
| 152 | Ga0207711_11964419 | 3300025941 | Unclassified | 528 |
| 153 | Ga0207679_10293938 | 3300025945 | Unclassified | 1397 |
| 154 | Ga0207679_11342984 | 3300025945 | Bacteria | 656 |
| 155 | Ga0207667_11141542 | 3300025949 | Bacteria | 761 |
| 156 | Ga0207651_10313317 | 3300025960 | Unclassified | 1309 |
| 157 | Ga0207668_10063576 | 3300025972 | Bacteria | 2604 |
| 158 | Ga0207668_10199641 | 3300025972 | Bacteria | 1592 |
| 159 | Ga0207678_10016599 | 3300026067 | Bacteria | 6468 |
| 160 | Ga0207678_10090310 | 3300026067 | Bacteria | 2618 |
| 161 | Ga0207678_10224982 | 3300026067 | Bacteria | 1606 |
| 162 | Ga0207678_11522801 | 3300026067 | Bacteria | 590 |
| 163 | Ga0207702_10059208 | 3300026078 | Bacteria | 3262 |
| 164 | Ga0207641_10509824 | 3300026088 | Bacteria | 1169 |
| 165 | Ga0207648_11378595 | 3300026089 | Bacteria | 663 |
| 166 | Ga0207676_10062021 | 3300026095 | Bacteria | 2963 |
| 167 | Ga0207676_11545711 | 3300026095 | Bacteria | 661 |
| 168 | Ga0207674_10089726 | 3300026116 | Bacteria | 3066 |
| 169 | Ga0207674_10509015 | 3300026116 | Bacteria | 1163 |
| 170 | Ga0207683_10086565 | 3300026121 | Bacteria | 2786 |
| 171 | Ga0209967_1037213 | 3300027364 | Bacteria | 736 |
| 172 | Ga0268266_10031118 | 3300028379 | Bacteria | 4531 |
| 173 | Ga0268266_10092532 | 3300028379 | Bacteria | 2653 |
| 174 | Ga0268265_10602263 | 3300028380 | Bacteria | 1050 |
| 175 | Ga0307515_10000420 | 3300028794 | Bacteria | 102216 |
| 176 | Ga0314311_1107394 | 3300030733 | Bacteria | 2024 |
| 177 | Ga0307513_10004196 | 3300031456 | Bacteria | 19276 |
| 178 | Ga0307408_100103352 | 3300031548 | Bacteria | 2175 |
| 179 | Ga0307408_100332618 | 3300031548 | Bacteria | 1283 |
| 180 | Ga0307408_100341311 | 3300031548 | Bacteria | 1268 |
| 181 | Ga0307408_100606779 | 3300031548 | Bacteria | 973 |
| 182 | Ga0307408_101050171 | 3300031548 | Bacteria | 753 |
| 183 | Ga0307408_101157676 | 3300031548 | Bacteria | 720 |
| 184 | Ga0307405_10013055 | 3300031731 | Bacteria | 4421 |
| 185 | Ga0307405_10056177 | 3300031731 | Unclassified | 2468 |
| 186 | Ga0307405_10104322 | 3300031731 | Bacteria | 1908 |
| 187 | Ga0307405_10318309 | 3300031731 | Bacteria | 1187 |
| 188 | Ga0307405_10716299 | 3300031731 | Bacteria | 830 |
| 189 | Ga0307413_10154681 | 3300031824 | Bacteria | 1602 |
| 190 | Ga0307413_10238168 | 3300031824 | Bacteria | 1342 |
| 191 | Ga0307413_10335372 | 3300031824 | Bacteria | 1161 |
| 192 | Ga0307413_10380933 | 3300031824 | Bacteria | 1099 |
| 193 | Ga0307413_10536590 | 3300031824 | Bacteria | 946 |
| 194 | Ga0307410_10004024 | 3300031852 | Bacteria | 7507 |
| 195 | Ga0307410_10008199 | 3300031852 | Bacteria | 5779 |
| 196 | Ga0307410_10091084 | 3300031852 | Bacteria | 2164 |
| 197 | Ga0307410_10153502 | 3300031852 | Bacteria | 1717 |
| 198 | Ga0307410_10169466 | 3300031852 | Bacteria | 1644 |
| 199 | Ga0307410_10255313 | 3300031852 | Bacteria | 1365 |
| 200 | Ga0307410_10282905 | 3300031852 | Bacteria | 1302 |
| 201 | Ga0307410_10673791 | 3300031852 | Bacteria | 869 |
| 202 | Ga0307406_10005667 | 3300031901 | Bacteria | 6828 |
| 203 | Ga0307406_10014615 | 3300031901 | Bacteria | 4520 |
| 204 | Ga0307406_10182973 | 3300031901 | Unclassified | 1527 |
| 205 | Ga0307406_10211996 | 3300031901 | Bacteria | 1433 |
| 206 | Ga0307406_10745284 | 3300031901 | Bacteria | 822 |
| 207 | Ga0307407_10020869 | 3300031903 | Bacteria | 3366 |
| 208 | Ga0307407_10021626 | 3300031903 | Bacteria | 3322 |
| 209 | Ga0307407_10023699 | 3300031903 | Bacteria | 3206 |
| 210 | Ga0307407_10024224 | 3300031903 | Bacteria | 3179 |
| 211 | Ga0307407_11088578 | 3300031903 | Bacteria | 621 |
| 212 | Ga0307412_10092980 | 3300031911 | Unclassified | 2115 |
| 213 | Ga0307412_10101892 | 3300031911 | Bacteria | 2032 |
| 214 | Ga0307412_10395586 | 3300031911 | Bacteria | 1123 |
| 215 | Ga0307412_10617355 | 3300031911 | Bacteria | 920 |
| 216 | Ga0307412_10783044 | 3300031911 | Bacteria | 826 |
| 217 | Ga0307412_10840398 | 3300031911 | Bacteria | 800 |
| 218 | Ga0307412_11608757 | 3300031911 | Bacteria | 593 |
| 219 | Ga0307409_100017905 | 3300031995 | Bacteria | 4739 |
| 220 | Ga0307409_100057995 | 3300031995 | Bacteria | 3004 |
| 221 | Ga0307409_100069537 | 3300031995 | Bacteria | 2790 |
| 222 | Ga0307409_100122360 | 3300031995 | Bacteria | 2206 |
| 223 | Ga0307409_100214295 | 3300031995 | Bacteria | 1733 |
| 224 | Ga0307409_100333693 | 3300031995 | Bacteria | 1424 |
| 225 | Ga0307409_100580884 | 3300031995 | Bacteria | 1104 |
| 226 | Ga0307409_100603613 | 3300031995 | Bacteria | 1085 |
| 227 | Ga0307409_101502229 | 3300031995 | Bacteria | 701 |
| 228 | Ga0307416_100043109 | 3300032002 | Bacteria | 3530 |
| 229 | Ga0307416_100055436 | 3300032002 | Bacteria | 3192 |
| 230 | Ga0307416_100150862 | 3300032002 | Bacteria | 2131 |
| 231 | Ga0307416_100171665 | 3300032002 | Bacteria | 2019 |
| 232 | Ga0307416_100218742 | 3300032002 | Unclassified | 1825 |
| 233 | Ga0307416_100311366 | 3300032002 | Bacteria | 1571 |
| 234 | Ga0307416_100388269 | 3300032002 | Bacteria | 1429 |
| 235 | Ga0307416_100407776 | 3300032002 | Bacteria | 1399 |
| 236 | Ga0307416_101522935 | 3300032002 | Bacteria | 774 |
| 237 | Ga0307416_101771755 | 3300032002 | Bacteria | 722 |
| 238 | Ga0307416_102414576 | 3300032002 | Bacteria | 625 |
| 239 | Ga0307414_10003139 | 3300032004 | Bacteria | 8773 |
| 240 | Ga0307414_10006961 | 3300032004 | Bacteria | 6338 |
| 241 | Ga0307414_10128007 | 3300032004 | Bacteria | 1966 |
| 242 | Ga0307414_10129495 | 3300032004 | Bacteria | 1956 |
| 243 | Ga0307414_10288715 | 3300032004 | Bacteria | 1382 |
| 244 | Ga0307414_10349713 | 3300032004 | Bacteria | 1268 |
| 245 | Ga0307414_10495298 | 3300032004 | Bacteria | 1080 |
| 246 | Ga0307414_10741180 | 3300032004 | Bacteria | 892 |
| 247 | Ga0307411_10012032 | 3300032005 | Bacteria | 4700 |
| 248 | Ga0307411_10069599 | 3300032005 | Bacteria | 2377 |
| 249 | Ga0307411_10077849 | 3300032005 | Bacteria | 2271 |
| 250 | Ga0307411_10109249 | 3300032005 | Bacteria | 1975 |
| 251 | Ga0307411_10140351 | 3300032005 | Bacteria | 1781 |
| 252 | Ga0307411_10142255 | 3300032005 | Bacteria | 1770 |
| 253 | Ga0307411_10196897 | 3300032005 | Bacteria | 1544 |
| 254 | Ga0307411_10231902 | 3300032005 | Bacteria | 1439 |
| 255 | Ga0307411_10237956 | 3300032005 | Bacteria | 1423 |
| 256 | Ga0307411_10358621 | 3300032005 | Bacteria | 1191 |
| 257 | Ga0307411_10365010 | 3300032005 | Unclassified | 1182 |
| 258 | Ga0307411_10417983 | 3300032005 | Bacteria | 1113 |
| 259 | Ga0307415_100035792 | 3300032126 | Bacteria | 3246 |
| 260 | Ga0307415_100054510 | 3300032126 | Bacteria | 2730 |
| 261 | Ga0307415_100062131 | 3300032126 | Bacteria | 2589 |
| 262 | Ga0307415_100067422 | 3300032126 | Bacteria | 2500 |
| 263 | Ga0307415_100076332 | 3300032126 | Bacteria | 2375 |
| 264 | Ga0307415_100107441 | 3300032126 | Bacteria | 2062 |
| 265 | Ga0307415_100116975 | 3300032126 | Bacteria | 1990 |
| 266 | Ga0307415_100173808 | 3300032126 | Bacteria | 1683 |
| 267 | Ga0307415_100209825 | 3300032126 | Bacteria | 1553 |
| 268 | Ga0307415_100229456 | 3300032126 | Bacteria | 1494 |
| 269 | Ga0307415_100534704 | 3300032126 | Bacteria | 1031 |
| 270 | Ga0373952_0236667 | 3300035092 | Bacteria | 548 |
| 271 | Ga0395900_1209891 | 3300037418 | Bacteria | 671 |
| 272 | Ga0395905_0493007 | 3300037471 | Bacteria | 1125 |
| 273 | Ga0439436_0120795 | 3300041404 | Bacteria | 733 |
| 274 | Ga0439461_0040943 | 3300041410 | Bacteria | 1001 |
| 275 | Ga0439465_0116659 | 3300041413 | Unclassified | 933 |
| 276 | Ga0451797_1567653 | 3300041453 | Bacteria | 819 |
| 277 | Ga0451804_0561690 | 3300041463 | Bacteria | 825 |
| 278 | Ga0451807_1154016 | 3300041486 | Bacteria | 1504 |
| 279 | Ga0451853_0590617 | 3300041512 | Bacteria | 1320 |
| 280 | Ga0439432_030812 | 3300042006 | Bacteria | 1738 |
| 281 | Ga0439432_184341 | 3300042006 | Bacteria | 607 |
| 282 | Ga0439449_0021701 | 3300042007 | Bacteria | 2404 |
| 283 | Ga0439449_0043180 | 3300042007 | Bacteria | 1674 |
| 284 | Ga0450912_010568 | 3300042116 | Bacteria | 793 |
| 285 | Ga0450890_023009 | 3300042127 | Bacteria | 855 |
| 286 | Ga0451577_0507764 | 3300042876 | Bacteria | 1095 |
| 287 | Ga0466969_0165245 | 3300044656 | Bacteria | 1016 |
| 288 | Ga0466972_0019608 | 3300044658 | Bacteria | 3381 |
| 289 | Ga0466965_0314660 | 3300044683 | Bacteria | 852 |
| 290 | Ga0466966_0257994 | 3300044684 | Bacteria | 1050 |
| 291 | Ga0466966_0443874 | 3300044684 | Bacteria | 780 |
| 292 | Ga0466961_0125579 | 3300044693 | Bacteria | 1610 |
| 293 | Ga0466961_0140384 | 3300044693 | Bacteria | 1513 |
| 294 | Ga0466963_0035196 | 3300044694 | Bacteria | 3261 |
| 295 | Ga0466964_0090431 | 3300044706 | Bacteria | 1331 |
| 296 | Ga0466964_0428022 | 3300044706 | Bacteria | 697 |
| 297 | Ga0466968_0032708 | 3300044735 | Bacteria | 2164 |
| 298 | Ga0466970_0057587 | 3300044765 | Bacteria | 2078 |
| 299 | Ga0466957_0040367 | 3300044842 | Bacteria | 2819 |
| 300 | Ga0466960_0024273 | 3300044901 | Bacteria | 2734 |
| 301 | Ga0466960_0365128 | 3300044901 | Bacteria | 826 |
| 302 | Ga0466959_0030097 | 3300045049 | Bacteria | 4020 |
| 303 | Ga0466959_0424209 | 3300045049 | Bacteria | 903 |
| 304 | Ga0466958_0015065 | 3300045836 | Bacteria | 4424 |
| 305 | Ga0466958_0752175 | 3300045836 | Bacteria | 635 |
| 306 | Ga0495638_0187425 | 3300046460 | Bacteria | 1176 |
| 307 | Ga0495607_0005118 | 3300046501 | Bacteria | 9480 |
| 308 | Ga0495606_0150878 | 3300046507 | Bacteria | 1364 |
| 309 | Ga0495663_0133665 | 3300046525 | Bacteria | 838 |
| 310 | Ga0495668_0048011 | 3300046616 | Bacteria | 2369 |
| 311 | Ga0495686_0270367 | 3300047472 | Bacteria | 948 |
| 312 | Ga0496107_0807484 | 3300048910 | Bacteria | 687 |
| 313 | Ga0496109_1265758 | 3300048912 | Bacteria | 674 |
| 314 | Ga0496110_0110014 | 3300048913 | Bacteria | 2475 |
| 315 | Ga0496110_0799866 | 3300048913 | Bacteria | 847 |
| 316 | Ga0496112_0382963 | 3300048915 | Bacteria | 1347 |
| 317 | Ga0496112_0525786 | 3300048915 | Bacteria | 1117 |
| 318 | Ga0496113_0027262 | 3300048916 | Bacteria | 4094 |
| 319 | Ga0496114_0690330 | 3300048917 | Bacteria | 896 |
| 320 | Ga0496117_0482323 | 3300048920 | Bacteria | 605 |
| 321 | Ga0496118_0047508 | 3300048921 | Bacteria | 3325 |
| 322 | Ga0496121_0059801 | 3300048924 | Bacteria | 3139 |
| 323 | Ga0496121_0612716 | 3300048924 | Bacteria | 669 |
| 324 | Ga0496121_0719067 | 3300048924 | Bacteria | 598 |
| 325 | Ga0496122_0042878 | 3300048925 | Bacteria | 3553 |
| 326 | Ga0496123_0175901 | 3300048926 | Bacteria | 1123 |
| 327 | Ga0496126_0096244 | 3300048929 | Bacteria | 2596 |
| 328 | Ga0496126_0258685 | 3300048929 | Bacteria | 1448 |
| 329 | Ga0501076_1529596 | 3300049592 | Bacteria | 548 |
| 330 | Ga0501209_057535 | 3300049656 | Bacteria | 1077 |
| 331 | Ga0501223_011297 | 3300049663 | Bacteria | 1792 |
| 332 | Ga0501230_034783 | 3300049667 | Bacteria | 954 |
| 333 | Ga0501235_070875 | 3300049669 | Bacteria | 825 |
| 334 | Ga0501236_034387 | 3300049670 | Bacteria | 816 |
| 335 | Ga0501247_021443 | 3300049677 | Bacteria | 841 |
| 336 | Ga0501261_125070 | 3300049690 | Bacteria | 513 |
| 337 | Ga0501241_007813 | 3300049758 | Bacteria | 1958 |
| 338 | Ga0501262_003194 | 3300049759 | Bacteria | 1872 |
| 339 | Ga0501268_063813 | 3300049765 | Bacteria | 734 |
| 340 | Ga0501283_027574 | 3300049779 | Bacteria | 939 |
| 341 | nmdc:mga03n38_684006_c1 | 3300050490 | Bacteria | 590 |
| 342 | nmdc:mga00v17_1004267_c1 | 3300050491 | Bacteria | 525 |
| 343 | Ga0500566_0000089 | 3300053094 | Bacteria | 45622 |
| 344 | Ga0500568_0321340 | 3300053139 | Bacteria | 561 |
| 345 | Ga0500573_0020970 | 3300053140 | Bacteria | 3742 |
| 346 | Ga0466962_0020435 | 3300061719 | Bacteria | 3181 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100000566 | Ga0070670_10000056623 | 140 |
| 2 | 3300005353 | Ga0070669_100861802 | Ga0070669_1008618021 | 140 |
| 3 | 3300006051 | Ga0075364_11100933 | Ga0075364_111009331 | 140 |
| 4 | 3300009101 | Ga0105247_10525096 | Ga0105247_105250961 | 140 |
| 5 | 3300009551 | Ga0105238_10353635 | Ga0105238_103536352 | 140 |
| 6 | 3300010375 | Ga0105239_10195765 | Ga0105239_101957655 | 140 |
| 7 | 3300013104 | Ga0157370_10655020 | Ga0157370_106550202 | 140 |
| 8 | 3300014497 | Ga0182008_10331983 | Ga0182008_103319831 | 140 |
| 9 | 3300015261 | Ga0182006_1068714 | Ga0182006_10687141 | 140 |
| 10 | 3300015262 | Ga0182007_10064747 | Ga0182007_100647472 | 140 |
| 11 | 3300025273 | Ga0209673_1028138 | Ga0209673_10281381 | 140 |
| 12 | 3300025913 | Ga0207695_10654980 | Ga0207695_106549802 | 140 |
| 13 | 3300025924 | Ga0207694_10196438 | Ga0207694_101964382 | 140 |
| 14 | 3300025925 | Ga0207650_10006108 | Ga0207650_100061087 | 140 |
| 15 | 3300025949 | Ga0207667_11141542 | Ga0207667_111415421 | 140 |
| 16 | 3300037418 | Ga0395900_1209891 | Ga0395900_1209891_89_511 | 140 |
| 17 | 3300048910 | Ga0496107_0807484 | Ga0496107_0807484_127_549 | 140 |
| 18 | 3300048915 | Ga0496112_0382963 | Ga0496112_0382963_850_1272 | 140 |
| 19 | 3300048924 | Ga0496121_0059801 | Ga0496121_0059801_574_1011 | 140 |
| 20 | 3300048924 | Ga0496121_0612716 | Ga0496121_0612716_27_464 | 140 |
| 21 | 3300048924 | Ga0496121_0719067 | Ga0496121_0719067_59_586 | 140 |
| 22 | 3300048925 | Ga0496122_0042878 | Ga0496122_0042878_2484_2921 | 140 |
| 23 | 3300048926 | Ga0496123_0175901 | Ga0496123_0175901_138_575 | 140 |
| 24 | 3300048929 | Ga0496126_0096244 | Ga0496126_0096244_346_768 | 140 |
| 25 | 3300050490 | nmdc:mga03n38_684006_c1 | nmdc:mga03n38_684006_c1_58_495 | 140 |
| 26 | 3300050491 | nmdc:mga00v17_1004267_c1 | nmdc:mga00v17_1004267_c1_42_479 | 140 |
| 27 | 3300053139 | Ga0500568_0321340 | Ga0500568_0321340_33_455 | 140 |
| 28 | 3300028794 | Ga0307515_10000420 | Ga0307515_1000042018 | 141 |
| 29 | 3300031456 | Ga0307513_10004196 | Ga0307513_100041963 | 141 |
| 30 | 3300053140 | Ga0500573_0020970 | Ga0500573_0020970_2661_3095 | 142 |
| 31 | 3300031995 | Ga0307409_101502229 | Ga0307409_1015022291 | 146 |
| 32 | 3300046501 | Ga0495607_0005118 | Ga0495607_0005118_7218_7661 | 147 |
| 33 | 3300001990 | JGI24737J22298_10001946 | JGI24737J22298_100019464 | 148 |
| 34 | 3300002067 | JGI24735J21928_10003470 | JGI24735J21928_100034705 | 148 |
| 35 | 3300002067 | JGI24735J21928_10009309 | JGI24735J21928_100093093 | 148 |
| 36 | 3300002075 | JGI24738J21930_10002652 | JGI24738J21930_100026523 | 148 |
| 37 | 3300003320 | rootH2_10113643 | rootH2_101136432 | 148 |
| 38 | 3300003322 | rootL2_10100517 | rootL2_101005172 | 148 |
| 39 | 3300005327 | Ga0070658_10000066 | Ga0070658_1000006614 | 148 |
| 40 | 3300005339 | Ga0070660_100000713 | Ga0070660_10000071317 | 148 |
| 41 | 3300005457 | Ga0070662_100001623 | Ga0070662_10000162312 | 148 |
| 42 | 3300005530 | Ga0070679_102093794 | Ga0070679_1020937941 | 148 |
| 43 | 3300009545 | Ga0105237_10378941 | Ga0105237_103789412 | 148 |
| 44 | 3300013102 | Ga0157371_10112056 | Ga0157371_101120562 | 148 |
| 45 | 3300013307 | Ga0157372_10092823 | Ga0157372_100928232 | 148 |
| 46 | 3300013307 | Ga0157372_10102993 | Ga0157372_101029933 | 148 |
| 47 | 3300025304 | Ga0209257_1016629 | Ga0209257_10166293 | 148 |
| 48 | 3300025904 | Ga0207647_10003114 | Ga0207647_100031144 | 148 |
| 49 | 3300025909 | Ga0207705_10000215 | Ga0207705_1000021536 | 148 |
| 50 | 3300025914 | Ga0207671_10089516 | Ga0207671_100895164 | 148 |
| 51 | 3300025919 | Ga0207657_10002049 | Ga0207657_1000204913 | 148 |
| 52 | 3300025933 | Ga0207706_10024507 | Ga0207706_100245077 | 148 |
| 53 | 3300026078 | Ga0207702_10059208 | Ga0207702_100592084 | 148 |
| 54 | 3300026116 | Ga0207674_10509015 | Ga0207674_105090152 | 148 |
| 55 | 3300041463 | Ga0451804_0561690 | Ga0451804_0561690_292_738 | 148 |
| 56 | 3300041486 | Ga0451807_1154016 | Ga0451807_1154016_963_1409 | 148 |
| 57 | 3300041512 | Ga0451853_0590617 | Ga0451853_0590617_652_1098 | 148 |
| 58 | 3300044656 | Ga0466969_0165245 | Ga0466969_0165245_26_511 | 148 |
| 59 | 3300044658 | Ga0466972_0019608 | Ga0466972_0019608_1567_2052 | 148 |
| 60 | 3300044706 | Ga0466964_0090431 | Ga0466964_0090431_727_1212 | 148 |
| 61 | 3300044735 | Ga0466968_0032708 | Ga0466968_0032708_136_621 | 148 |
| 62 | 3300044765 | Ga0466970_0057587 | Ga0466970_0057587_1091_1594 | 148 |
| 63 | 3300044901 | Ga0466960_0024273 | Ga0466960_0024273_229_714 | 148 |
| 64 | 3300045049 | Ga0466959_0030097 | Ga0466959_0030097_1675_2160 | 148 |
| 65 | 3300045836 | Ga0466958_0752175 | Ga0466958_0752175_82_567 | 148 |
| 66 | 3300046507 | Ga0495606_0150878 | Ga0495606_0150878_883_1329 | 148 |
| 67 | 3300048920 | Ga0496117_0482323 | Ga0496117_0482323_69_515 | 148 |
| 68 | 3300048921 | Ga0496118_0047508 | Ga0496118_0047508_445_891 | 148 |
| 69 | 3300005577 | Ga0068857_100750652 | Ga0068857_1007506522 | 149 |
| 70 | 3300048929 | Ga0496126_0258685 | Ga0496126_0258685_272_727 | 149 |
| 71 | 3300005293 | Ga0065715_10210328 | Ga0065715_102103281 | 150 |
| 72 | 3300005328 | Ga0070676_10454865 | Ga0070676_104548651 | 150 |
| 73 | 3300005331 | Ga0070670_100022216 | Ga0070670_1000222161 | 150 |
| 74 | 3300005331 | Ga0070670_100516196 | Ga0070670_1005161962 | 150 |
| 75 | 3300005333 | Ga0070677_10002686 | Ga0070677_100026863 | 150 |
| 76 | 3300005353 | Ga0070669_100030044 | Ga0070669_1000300442 | 150 |
| 77 | 3300005353 | Ga0070669_100817409 | Ga0070669_1008174091 | 150 |
| 78 | 3300005355 | Ga0070671_100149507 | Ga0070671_1001495072 | 150 |
| 79 | 3300005355 | Ga0070671_100185553 | Ga0070671_1001855532 | 150 |
| 80 | 3300005356 | Ga0070674_101679332 | Ga0070674_1016793321 | 150 |
| 81 | 3300005455 | Ga0070663_100461391 | Ga0070663_1004613911 | 150 |
| 82 | 3300005456 | Ga0070678_100148154 | Ga0070678_1001481541 | 150 |
| 83 | 3300005457 | Ga0070662_100006709 | Ga0070662_1000067097 | 150 |
| 84 | 3300005548 | Ga0070665_100019344 | Ga0070665_1000193445 | 150 |
| 85 | 3300005564 | Ga0070664_100080425 | Ga0070664_1000804252 | 150 |
| 86 | 3300005564 | Ga0070664_100267669 | Ga0070664_1002676692 | 150 |
| 87 | 3300005577 | Ga0068857_100182778 | Ga0068857_1001827781 | 150 |
| 88 | 3300005618 | Ga0068864_102486751 | Ga0068864_1024867511 | 150 |
| 89 | 3300006881 | Ga0068865_101140010 | Ga0068865_1011400101 | 150 |
| 90 | 3300013100 | Ga0157373_10314613 | Ga0157373_103146132 | 150 |
| 91 | 3300014326 | Ga0157380_10513836 | Ga0157380_105138362 | 150 |
| 92 | 3300014326 | Ga0157380_12002673 | Ga0157380_120026731 | 150 |
| 93 | 3300020081 | Ga0206354_11156600 | Ga0206354_111566001 | 150 |
| 94 | 3300020082 | Ga0206353_10386402 | Ga0206353_103864022 | 150 |
| 95 | 3300025893 | Ga0207682_10009828 | Ga0207682_100098284 | 150 |
| 96 | 3300025907 | Ga0207645_10048963 | Ga0207645_100489633 | 150 |
| 97 | 3300025920 | Ga0207649_11290170 | Ga0207649_112901701 | 150 |
| 98 | 3300025933 | Ga0207706_10896875 | Ga0207706_108968751 | 150 |
| 99 | 3300025972 | Ga0207668_10199641 | Ga0207668_101996412 | 150 |
| 100 | 3300026067 | Ga0207678_10224982 | Ga0207678_102249822 | 150 |
| 101 | 3300026067 | Ga0207678_11522801 | Ga0207678_115228011 | 150 |
| 102 | 3300026095 | Ga0207676_11545711 | Ga0207676_115457111 | 150 |
| 103 | 3300026116 | Ga0207674_10089726 | Ga0207674_100897263 | 150 |
| 104 | 3300026121 | Ga0207683_10086565 | Ga0207683_100865652 | 150 |
| 105 | 3300027364 | Ga0209967_1037213 | Ga0209967_10372131 | 150 |
| 106 | 3300028379 | Ga0268266_10031118 | Ga0268266_100311182 | 150 |
| 107 | 3300031548 | Ga0307408_100341311 | Ga0307408_1003413112 | 150 |
| 108 | 3300031548 | Ga0307408_100606779 | Ga0307408_1006067792 | 150 |
| 109 | 3300031548 | Ga0307408_101157676 | Ga0307408_1011576761 | 150 |
| 110 | 3300031731 | Ga0307405_10056177 | Ga0307405_100561775 | 150 |
| 111 | 3300031731 | Ga0307405_10104322 | Ga0307405_101043222 | 150 |
| 112 | 3300031731 | Ga0307405_10318309 | Ga0307405_103183092 | 150 |
| 113 | 3300031824 | Ga0307413_10335372 | Ga0307413_103353721 | 150 |
| 114 | 3300031824 | Ga0307413_10536590 | Ga0307413_105365902 | 150 |
| 115 | 3300031852 | Ga0307410_10008199 | Ga0307410_100081992 | 150 |
| 116 | 3300031852 | Ga0307410_10153502 | Ga0307410_101535022 | 150 |
| 117 | 3300031852 | Ga0307410_10169466 | Ga0307410_101694662 | 150 |
| 118 | 3300031852 | Ga0307410_10255313 | Ga0307410_102553131 | 150 |
| 119 | 3300031852 | Ga0307410_10282905 | Ga0307410_102829051 | 150 |
| 120 | 3300031901 | Ga0307406_10182973 | Ga0307406_101829732 | 150 |
| 121 | 3300031911 | Ga0307412_10092980 | Ga0307412_100929802 | 150 |
| 122 | 3300031911 | Ga0307412_10783044 | Ga0307412_107830441 | 150 |
| 123 | 3300031911 | Ga0307412_10840398 | Ga0307412_108403981 | 150 |
| 124 | 3300031995 | Ga0307409_100069537 | Ga0307409_1000695373 | 150 |
| 125 | 3300031995 | Ga0307409_100603613 | Ga0307409_1006036131 | 150 |
| 126 | 3300032002 | Ga0307416_100043109 | Ga0307416_1000431094 | 150 |
| 127 | 3300032002 | Ga0307416_100150862 | Ga0307416_1001508621 | 150 |
| 128 | 3300032002 | Ga0307416_100218742 | Ga0307416_1002187422 | 150 |
| 129 | 3300032002 | Ga0307416_100311366 | Ga0307416_1003113662 | 150 |
| 130 | 3300032002 | Ga0307416_101771755 | Ga0307416_1017717551 | 150 |
| 131 | 3300032004 | Ga0307414_10006961 | Ga0307414_100069615 | 150 |
| 132 | 3300032004 | Ga0307414_10128007 | Ga0307414_101280071 | 150 |
| 133 | 3300032004 | Ga0307414_10288715 | Ga0307414_102887152 | 150 |
| 134 | 3300032005 | Ga0307411_10109249 | Ga0307411_101092493 | 150 |
| 135 | 3300032005 | Ga0307411_10140351 | Ga0307411_101403512 | 150 |
| 136 | 3300032005 | Ga0307411_10231902 | Ga0307411_102319021 | 150 |
| 137 | 3300032005 | Ga0307411_10237956 | Ga0307411_102379562 | 150 |
| 138 | 3300032005 | Ga0307411_10365010 | Ga0307411_103650101 | 150 |
| 139 | 3300032126 | Ga0307415_100035792 | Ga0307415_1000357922 | 150 |
| 140 | 3300032126 | Ga0307415_100107441 | Ga0307415_1001074413 | 150 |
| 141 | 3300032126 | Ga0307415_100173808 | Ga0307415_1001738081 | 150 |
| 142 | 3300032126 | Ga0307415_100209825 | Ga0307415_1002098253 | 150 |
| 143 | 3300042876 | Ga0451577_0507764 | Ga0451577_0507764_598_1056 | 150 |
| 144 | 3300044684 | Ga0466966_0443874 | Ga0466966_0443874_113_565 | 150 |
| 145 | 3300044693 | Ga0466961_0125579 | Ga0466961_0125579_692_1144 | 150 |
| 146 | 3300044694 | Ga0466963_0035196 | Ga0466963_0035196_1455_1907 | 150 |
| 147 | 3300044706 | Ga0466964_0428022 | Ga0466964_0428022_30_482 | 150 |
| 148 | 3300044842 | Ga0466957_0040367 | Ga0466957_0040367_1504_1956 | 150 |
| 149 | 3300045836 | Ga0466958_0015065 | Ga0466958_0015065_818_1270 | 150 |
| 150 | 3300048912 | Ga0496109_1265758 | Ga0496109_1265758_133_591 | 150 |
| 151 | 3300049690 | Ga0501261_125070 | Ga0501261_125070_26_481 | 150 |
| 152 | 3300061719 | Ga0466962_0020435 | Ga0466962_0020435_836_1288 | 150 |
| 153 | 3300005347 | Ga0070668_100417924 | Ga0070668_1004179243 | 151 |
| 154 | 3300005548 | Ga0070665_100343684 | Ga0070665_1003436843 | 151 |
| 155 | 3300025972 | Ga0207668_10063576 | Ga0207668_100635762 | 151 |
| 156 | 3300026089 | Ga0207648_11378595 | Ga0207648_113785952 | 151 |
| 157 | 3300003794 | Ga0055531_10000094 | Ga0055531_1000009440 | 152 |
| 158 | 3300005262 | Ga0065165_1002026 | Ga0065165_100202614 | 152 |
| 159 | 3300005331 | Ga0070670_100440315 | Ga0070670_1004403152 | 152 |
| 160 | 3300005353 | Ga0070669_100450425 | Ga0070669_1004504252 | 152 |
| 161 | 3300005354 | Ga0070675_100339529 | Ga0070675_1003395292 | 152 |
| 162 | 3300005354 | Ga0070675_101258615 | Ga0070675_1012586151 | 152 |
| 163 | 3300005355 | Ga0070671_100112604 | Ga0070671_1001126043 | 152 |
| 164 | 3300005364 | Ga0070673_100086415 | Ga0070673_1000864152 | 152 |
| 165 | 3300005366 | Ga0070659_101204046 | Ga0070659_1012040461 | 152 |
| 166 | 3300005543 | Ga0070672_100261786 | Ga0070672_1002617861 | 152 |
| 167 | 3300005543 | Ga0070672_102083180 | Ga0070672_1020831801 | 152 |
| 168 | 3300005719 | Ga0068861_100423431 | Ga0068861_1004234311 | 152 |
| 169 | 3300005844 | Ga0068862_100619766 | Ga0068862_1006197662 | 152 |
| 170 | 3300005844 | Ga0068862_101111629 | Ga0068862_1011116291 | 152 |
| 171 | 3300006946 | Ga0079104_1120759 | Ga0079104_11207591 | 152 |
| 172 | 3300014326 | Ga0157380_10521042 | Ga0157380_105210421 | 152 |
| 173 | 3300025298 | Ga0209050_1000071 | Ga0209050_1000071232 | 152 |
| 174 | 3300025298 | Ga0209050_1064503 | Ga0209050_10645031 | 152 |
| 175 | 3300025304 | Ga0209257_1000027 | Ga0209257_100002771 | 152 |
| 176 | 3300025907 | Ga0207645_10119474 | Ga0207645_101194743 | 152 |
| 177 | 3300025923 | Ga0207681_10077658 | Ga0207681_100776581 | 152 |
| 178 | 3300025925 | Ga0207650_10148394 | Ga0207650_101483942 | 152 |
| 179 | 3300025926 | Ga0207659_10295372 | Ga0207659_102953722 | 152 |
| 180 | 3300025926 | Ga0207659_10948346 | Ga0207659_109483461 | 152 |
| 181 | 3300025931 | Ga0207644_10072453 | Ga0207644_100724532 | 152 |
| 182 | 3300025932 | Ga0207690_11013786 | Ga0207690_110137861 | 152 |
| 183 | 3300025933 | Ga0207706_11146953 | Ga0207706_111469531 | 152 |
| 184 | 3300025941 | Ga0207711_11964419 | Ga0207711_119644191 | 152 |
| 185 | 3300025945 | Ga0207679_10293938 | Ga0207679_102939382 | 152 |
| 186 | 3300025945 | Ga0207679_11342984 | Ga0207679_113429841 | 152 |
| 187 | 3300025960 | Ga0207651_10313317 | Ga0207651_103133172 | 152 |
| 188 | 3300028380 | Ga0268265_10602263 | Ga0268265_106022632 | 152 |
| 189 | 3300030733 | Ga0314311_1107394 | Ga0314311_11073943 | 152 |
| 190 | 3300031901 | Ga0307406_10211996 | Ga0307406_102119961 | 152 |
| 191 | 3300031903 | Ga0307407_10024224 | Ga0307407_100242241 | 152 |
| 192 | 3300031911 | Ga0307412_11608757 | Ga0307412_116087572 | 152 |
| 193 | 3300031995 | Ga0307409_100580884 | Ga0307409_1005808842 | 152 |
| 194 | 3300032002 | Ga0307416_100171665 | Ga0307416_1001716651 | 152 |
| 195 | 3300032002 | Ga0307416_100407776 | Ga0307416_1004077763 | 152 |
| 196 | 3300032004 | Ga0307414_10129495 | Ga0307414_101294952 | 152 |
| 197 | 3300032005 | Ga0307411_10142255 | Ga0307411_101422554 | 152 |
| 198 | 3300032126 | Ga0307415_100067422 | Ga0307415_1000674222 | 152 |
| 199 | 3300032126 | Ga0307415_100076332 | Ga0307415_1000763321 | 152 |
| 200 | 3300032126 | Ga0307415_100116975 | Ga0307415_1001169756 | 152 |
| 201 | 3300037471 | Ga0395905_0493007 | Ga0395905_0493007_124_582 | 152 |
| 202 | 3300041413 | Ga0439465_0116659 | Ga0439465_0116659_454_912 | 152 |
| 203 | 3300042006 | Ga0439432_030812 | Ga0439432_030812_808_1266 | 152 |
| 204 | 3300042006 | Ga0439432_184341 | Ga0439432_184341_50_520 | 152 |
| 205 | 3300042007 | Ga0439449_0021701 | Ga0439449_0021701_395_853 | 152 |
| 206 | 3300044684 | Ga0466966_0257994 | Ga0466966_0257994_128_586 | 152 |
| 207 | 3300045049 | Ga0466959_0424209 | Ga0466959_0424209_23_481 | 152 |
| 208 | 3300046460 | Ga0495638_0187425 | Ga0495638_0187425_92_565 | 152 |
| 209 | 3300047472 | Ga0495686_0270367 | Ga0495686_0270367_35_508 | 152 |
| 210 | 3300049656 | Ga0501209_057535 | Ga0501209_057535_563_1021 | 152 |
| 211 | 3300049663 | Ga0501223_011297 | Ga0501223_011297_1057_1515 | 152 |
| 212 | 3300049667 | Ga0501230_034783 | Ga0501230_034783_79_537 | 152 |
| 213 | 3300049669 | Ga0501235_070875 | Ga0501235_070875_329_787 | 152 |
| 214 | 3300049670 | Ga0501236_034387 | Ga0501236_034387_331_789 | 152 |
| 215 | 3300049677 | Ga0501247_021443 | Ga0501247_021443_321_779 | 152 |
| 216 | 3300049758 | Ga0501241_007813 | Ga0501241_007813_747_1217 | 152 |
| 217 | 3300049759 | Ga0501262_003194 | Ga0501262_003194_1280_1738 | 152 |
| 218 | 3300049765 | Ga0501268_063813 | Ga0501268_063813_24_482 | 152 |
| 219 | 3300049779 | Ga0501283_027574 | Ga0501283_027574_314_772 | 152 |
| 220 | 3300053094 | Ga0500566_0000089 | Ga0500566_0000089_44274_44744 | 152 |
| 221 | 3300005290 | Ga0065712_10428532 | Ga0065712_104285321 | 153 |
| 222 | 3300005293 | Ga0065715_10031571 | Ga0065715_100315713 | 153 |
| 223 | 3300005293 | Ga0065715_11016424 | Ga0065715_110164241 | 153 |
| 224 | 3300005327 | Ga0070658_10541636 | Ga0070658_105416361 | 153 |
| 225 | 3300005347 | Ga0070668_100279781 | Ga0070668_1002797811 | 153 |
| 226 | 3300005353 | Ga0070669_100073424 | Ga0070669_1000734243 | 153 |
| 227 | 3300005354 | Ga0070675_100946410 | Ga0070675_1009464102 | 153 |
| 228 | 3300005355 | Ga0070671_100042531 | Ga0070671_1000425316 | 153 |
| 229 | 3300005355 | Ga0070671_101705144 | Ga0070671_1017051441 | 153 |
| 230 | 3300005456 | Ga0070678_100247430 | Ga0070678_1002474302 | 153 |
| 231 | 3300005543 | Ga0070672_100262745 | Ga0070672_1002627453 | 153 |
| 232 | 3300005618 | Ga0068864_100109038 | Ga0068864_1001090386 | 153 |
| 233 | 3300005841 | Ga0068863_100576574 | Ga0068863_1005765741 | 153 |
| 234 | 3300005844 | Ga0068862_100107754 | Ga0068862_1001077543 | 153 |
| 235 | 3300006051 | Ga0075364_10858777 | Ga0075364_108587771 | 153 |
| 236 | 3300006358 | Ga0068871_100823738 | Ga0068871_1008237381 | 153 |
| 237 | 3300006846 | Ga0075430_100036851 | Ga0075430_1000368514 | 153 |
| 238 | 3300009177 | Ga0105248_10057225 | Ga0105248_100572254 | 153 |
| 239 | 3300014326 | Ga0157380_10084239 | Ga0157380_100842391 | 153 |
| 240 | 3300017792 | Ga0163161_10669875 | Ga0163161_106698751 | 153 |
| 241 | 3300025893 | Ga0207682_10269260 | Ga0207682_102692601 | 153 |
| 242 | 3300025921 | Ga0207652_10909620 | Ga0207652_109096201 | 153 |
| 243 | 3300025923 | Ga0207681_10178613 | Ga0207681_101786132 | 153 |
| 244 | 3300025931 | Ga0207644_10018894 | Ga0207644_100188944 | 153 |
| 245 | 3300025931 | Ga0207644_10930580 | Ga0207644_109305801 | 153 |
| 246 | 3300025941 | Ga0207711_10002660 | Ga0207711_100026603 | 153 |
| 247 | 3300026067 | Ga0207678_10090310 | Ga0207678_100903103 | 153 |
| 248 | 3300026088 | Ga0207641_10509824 | Ga0207641_105098243 | 153 |
| 249 | 3300026095 | Ga0207676_10062021 | Ga0207676_100620213 | 153 |
| 250 | 3300028379 | Ga0268266_10092532 | Ga0268266_100925323 | 153 |
| 251 | 3300031548 | Ga0307408_100103352 | Ga0307408_1001033523 | 153 |
| 252 | 3300031548 | Ga0307408_100332618 | Ga0307408_1003326182 | 153 |
| 253 | 3300031548 | Ga0307408_101050171 | Ga0307408_1010501711 | 153 |
| 254 | 3300031731 | Ga0307405_10013055 | Ga0307405_100130552 | 153 |
| 255 | 3300031824 | Ga0307413_10154681 | Ga0307413_101546812 | 153 |
| 256 | 3300031824 | Ga0307413_10238168 | Ga0307413_102381682 | 153 |
| 257 | 3300031824 | Ga0307413_10380933 | Ga0307413_103809332 | 153 |
| 258 | 3300031852 | Ga0307410_10004024 | Ga0307410_100040243 | 153 |
| 259 | 3300031852 | Ga0307410_10673791 | Ga0307410_106737911 | 153 |
| 260 | 3300031901 | Ga0307406_10005667 | Ga0307406_100056673 | 153 |
| 261 | 3300031901 | Ga0307406_10014615 | Ga0307406_100146153 | 153 |
| 262 | 3300031901 | Ga0307406_10745284 | Ga0307406_107452842 | 153 |
| 263 | 3300031903 | Ga0307407_10020869 | Ga0307407_100208694 | 153 |
| 264 | 3300031903 | Ga0307407_10021626 | Ga0307407_100216262 | 153 |
| 265 | 3300031903 | Ga0307407_10023699 | Ga0307407_100236996 | 153 |
| 266 | 3300031903 | Ga0307407_11088578 | Ga0307407_110885781 | 153 |
| 267 | 3300031911 | Ga0307412_10101892 | Ga0307412_101018923 | 153 |
| 268 | 3300031911 | Ga0307412_10395586 | Ga0307412_103955861 | 153 |
| 269 | 3300031911 | Ga0307412_10617355 | Ga0307412_106173551 | 153 |
| 270 | 3300031995 | Ga0307409_100017905 | Ga0307409_1000179054 | 153 |
| 271 | 3300031995 | Ga0307409_100122360 | Ga0307409_1001223604 | 153 |
| 272 | 3300031995 | Ga0307409_100214295 | Ga0307409_1002142951 | 153 |
| 273 | 3300031995 | Ga0307409_100333693 | Ga0307409_1003336932 | 153 |
| 274 | 3300032002 | Ga0307416_100055436 | Ga0307416_1000554361 | 153 |
| 275 | 3300032002 | Ga0307416_100388269 | Ga0307416_1003882691 | 153 |
| 276 | 3300032002 | Ga0307416_101522935 | Ga0307416_1015229351 | 153 |
| 277 | 3300032002 | Ga0307416_102414576 | Ga0307416_1024145761 | 153 |
| 278 | 3300032004 | Ga0307414_10003139 | Ga0307414_100031395 | 153 |
| 279 | 3300032004 | Ga0307414_10495298 | Ga0307414_104952982 | 153 |
| 280 | 3300032004 | Ga0307414_10741180 | Ga0307414_107411802 | 153 |
| 281 | 3300032005 | Ga0307411_10012032 | Ga0307411_100120321 | 153 |
| 282 | 3300032005 | Ga0307411_10077849 | Ga0307411_100778491 | 153 |
| 283 | 3300032005 | Ga0307411_10196897 | Ga0307411_101968973 | 153 |
| 284 | 3300032005 | Ga0307411_10358621 | Ga0307411_103586212 | 153 |
| 285 | 3300032126 | Ga0307415_100054510 | Ga0307415_1000545102 | 153 |
| 286 | 3300032126 | Ga0307415_100229456 | Ga0307415_1002294562 | 153 |
| 287 | 3300032126 | Ga0307415_100534704 | Ga0307415_1005347042 | 153 |
| 288 | 3300035092 | Ga0373952_0236667 | Ga0373952_0236667_51_524 | 153 |
| 289 | 3300041404 | Ga0439436_0120795 | Ga0439436_0120795_166_627 | 153 |
| 290 | 3300041410 | Ga0439461_0040943 | Ga0439461_0040943_485_946 | 153 |
| 291 | 3300042007 | Ga0439449_0043180 | Ga0439449_0043180_1027_1488 | 153 |
| 292 | 3300042116 | Ga0450912_010568 | Ga0450912_010568_35_496 | 153 |
| 293 | 3300042127 | Ga0450890_023009 | Ga0450890_023009_38_499 | 153 |
| 294 | 3300044683 | Ga0466965_0314660 | Ga0466965_0314660_308_769 | 153 |
| 295 | 3300044901 | Ga0466960_0365128 | Ga0466960_0365128_324_785 | 153 |
| 296 | 3300046525 | Ga0495663_0133665 | Ga0495663_0133665_11_475 | 153 |
| 297 | 3300046616 | Ga0495668_0048011 | Ga0495668_0048011_1659_2132 | 153 |
| 298 | 3300048913 | Ga0496110_0110014 | Ga0496110_0110014_1691_2179 | 153 |
| 299 | 3300048913 | Ga0496110_0799866 | Ga0496110_0799866_240_701 | 153 |
| 300 | 3300048915 | Ga0496112_0525786 | Ga0496112_0525786_607_1068 | 153 |
| 301 | 3300048916 | Ga0496113_0027262 | Ga0496113_0027262_597_1058 | 153 |
| 302 | 3300048917 | Ga0496114_0690330 | Ga0496114_0690330_195_656 | 153 |
| 303 | 3300049592 | Ga0501076_1529596 | Ga0501076_1529596_27_488 | 153 |
| 304 | 3300001979 | JGI24740J21852_10106973 | JGI24740J21852_101069732 | 154 |
| 305 | 3300001989 | JGI24739J22299_10152960 | JGI24739J22299_101529602 | 154 |
| 306 | 3300001990 | JGI24737J22298_10106263 | JGI24737J22298_101062632 | 154 |
| 307 | 3300005327 | Ga0070658_10059267 | Ga0070658_100592672 | 154 |
| 308 | 3300005327 | Ga0070658_10511358 | Ga0070658_105113581 | 154 |
| 309 | 3300005328 | Ga0070676_10754138 | Ga0070676_107541381 | 154 |
| 310 | 3300005331 | Ga0070670_100019959 | Ga0070670_1000199591 | 154 |
| 311 | 3300005331 | Ga0070670_100122737 | Ga0070670_1001227372 | 154 |
| 312 | 3300005331 | Ga0070670_100246964 | Ga0070670_1002469642 | 154 |
| 313 | 3300005339 | Ga0070660_100240538 | Ga0070660_1002405382 | 154 |
| 314 | 3300005344 | Ga0070661_100231650 | Ga0070661_1002316502 | 154 |
| 315 | 3300005354 | Ga0070675_100002994 | Ga0070675_1000029944 | 154 |
| 316 | 3300005366 | Ga0070659_100206487 | Ga0070659_1002064872 | 154 |
| 317 | 3300005435 | Ga0070714_100347311 | Ga0070714_1003473112 | 154 |
| 318 | 3300005455 | Ga0070663_100023854 | Ga0070663_1000238542 | 154 |
| 319 | 3300005455 | Ga0070663_101032170 | Ga0070663_1010321701 | 154 |
| 320 | 3300005530 | Ga0070679_100664433 | Ga0070679_1006644331 | 154 |
| 321 | 3300005535 | Ga0070684_101135795 | Ga0070684_1011357951 | 154 |
| 322 | 3300005539 | Ga0068853_100253092 | Ga0068853_1002530922 | 154 |
| 323 | 3300005548 | Ga0070665_100447768 | Ga0070665_1004477682 | 154 |
| 324 | 3300005564 | Ga0070664_100612499 | Ga0070664_1006124992 | 154 |
| 325 | 3300013102 | Ga0157371_10081180 | Ga0157371_100811803 | 154 |
| 326 | 3300013105 | Ga0157369_10301040 | Ga0157369_103010402 | 154 |
| 327 | 3300013296 | Ga0157374_10468451 | Ga0157374_104684512 | 154 |
| 328 | 3300015262 | Ga0182007_10290142 | Ga0182007_102901421 | 154 |
| 329 | 3300025904 | Ga0207647_10249783 | Ga0207647_102497831 | 154 |
| 330 | 3300025909 | Ga0207705_10005626 | Ga0207705_100056265 | 154 |
| 331 | 3300025909 | Ga0207705_10072108 | Ga0207705_100721084 | 154 |
| 332 | 3300025919 | Ga0207657_10001954 | Ga0207657_100019544 | 154 |
| 333 | 3300025920 | Ga0207649_10087524 | Ga0207649_100875243 | 154 |
| 334 | 3300025921 | Ga0207652_11223249 | Ga0207652_112232491 | 154 |
| 335 | 3300025929 | Ga0207664_10768004 | Ga0207664_107680042 | 154 |
| 336 | 3300025932 | Ga0207690_10088815 | Ga0207690_100888152 | 154 |
| 337 | 3300026067 | Ga0207678_10016599 | Ga0207678_100165994 | 154 |
| 338 | 3300031731 | Ga0307405_10716299 | Ga0307405_107162991 | 154 |
| 339 | 3300031852 | Ga0307410_10091084 | Ga0307410_100910843 | 154 |
| 340 | 3300031995 | Ga0307409_100057995 | Ga0307409_1000579952 | 154 |
| 341 | 3300032004 | Ga0307414_10349713 | Ga0307414_103497132 | 154 |
| 342 | 3300032005 | Ga0307411_10069599 | Ga0307411_100695992 | 154 |
| 343 | 3300032005 | Ga0307411_10417983 | Ga0307411_104179832 | 154 |
| 344 | 3300032126 | Ga0307415_100062131 | Ga0307415_1000621312 | 154 |
| 345 | 3300041453 | Ga0451797_1567653 | Ga0451797_1567653_136_600 | 154 |
| 346 | 3300044693 | Ga0466961_0140384 | Ga0466961_0140384_796_1272 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i02-assembly1.cif.gz_B | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.8984 | 6 | 144 |
| 2hq7-assembly1.cif.gz_B | crystal structure of protein related to general stress protein 26(gs26) of b.subtilis (pyridoxinephosphate oxidase family) (np_350077.1) from clostridium acetobutylicum at 2.00 a resolution | 0.8717 | 6 | 146 |
| 2re7-assembly1.cif.gz_A-2 | crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution | 0.8696 | 1 | 134 |
| 2i02-assembly1.cif.gz_A | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.8685 | 6 | 144 |
| 2i02-assembly1.cif.gz_B | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.8566 | 6 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2i02B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8952 | 6 | 144 | 2.30.110.10 |
| 2re7A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8668 | 1 | 134 | 2.30.110.10 |
| 2i02B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8527 | 6 | 144 | 2.30.110.10 |
| 2re7A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.842 | 1 | 134 | 2.30.110.10 |
| 1rfeA01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8235 | 4 | 137 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C3KNN9-F1-model_v4 | General stress protein FMN-binding split barrel domain-containing protein | 0.9782 | 1 | 144 |
|
| AF-A0A1I5TA05-F1-model_v4 | General stress protein 26 | 0.9771 | 1 | 144 |
|
| AF-A0A838T902-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase family protein | 0.9753 | 1 | 144 |
|
| AF-A0A656QPX3-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9737 | 1 | 143 |
|
| AF-A0A2J0YTS4-F1-model_v4 | General stress protein FMN-binding split barrel domain-containing protein | 0.9732 | 1 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar