F416912

General Info

Members Datasets Scaffolds Average Seq Length
346 176 346 152

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0719067|Ga0496121_0719067_59_586
Length 175
Sequence MFKQPGEKPHFLASGWALNTKARRAFLLRGKRRNVMTAMKLADISEKMRDIDIAMLSTHTDGGAIAGRPMSNNREVDYDGSSYYFTWAESRMVADIERNPQVSLTFQGKKAFSIAVEGKAKVTRDKKAFKAHWTPDLDDWFKDGIETKGVAMIEVQATRLHYWDGEEDGEVKLRN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
120 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
126 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
161 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
162 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
163 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
164 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
165 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
166 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
167 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
168 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
169 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
170 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0.29
Rhizoplane 3.18
Rhizosphere 88.44
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10106973 3300001979 Bacteria 708
2 JGI24739J22299_10152960 3300001989 Bacteria 682
3 JGI24737J22298_10001946 3300001990 Bacteria 7388
4 JGI24737J22298_10106263 3300001990 Bacteria 831
5 JGI24735J21928_10003470 3300002067 Bacteria 5369
6 JGI24735J21928_10009309 3300002067 Bacteria 3158
7 JGI24738J21930_10002652 3300002075 Bacteria 4616
8 rootH2_10113643 3300003320 Bacteria 1226
9 rootL2_10100517 3300003322 Bacteria 1091
10 Ga0055531_10000094 3300003794 Bacteria 96266
11 Ga0065165_1002026 3300005262 Bacteria 18863
12 Ga0065712_10428532 3300005290 Bacteria 705
13 Ga0065715_10031571 3300005293 Bacteria 1760
14 Ga0065715_10210328 3300005293 Bacteria 1317
15 Ga0065715_11016424 3300005293 Bacteria 541
16 Ga0070658_10000066 3300005327 Bacteria 103408
17 Ga0070658_10059267 3300005327 Bacteria 3117
18 Ga0070658_10511358 3300005327 Bacteria 1038
19 Ga0070658_10541636 3300005327 Bacteria 1007
20 Ga0070676_10454865 3300005328 Unclassified 901
21 Ga0070676_10754138 3300005328 Bacteria 715
22 Ga0070670_100000566 3300005331 Bacteria 29318
23 Ga0070670_100019959 3300005331 Bacteria 5753
24 Ga0070670_100022216 3300005331 Bacteria 5460
25 Ga0070670_100122737 3300005331 Bacteria 2241
26 Ga0070670_100246964 3300005331 Bacteria 1554
27 Ga0070670_100440315 3300005331 Unclassified 1154
28 Ga0070670_100516196 3300005331 Bacteria 1064
29 Ga0070677_10002686 3300005333 Bacteria 5691
30 Ga0070660_100000713 3300005339 Bacteria 21991
31 Ga0070660_100240538 3300005339 Bacteria 1474
32 Ga0070661_100231650 3300005344 Bacteria 1420
33 Ga0070668_100279781 3300005347 Bacteria 1393
34 Ga0070668_100417924 3300005347 Bacteria 1148
35 Ga0070669_100030044 3300005353 Bacteria 3919
36 Ga0070669_100073424 3300005353 Plasmid 2534
37 Ga0070669_100450425 3300005353 Bacteria 1061
38 Ga0070669_100817409 3300005353 Bacteria 793
39 Ga0070669_100861802 3300005353 Bacteria 772
40 Ga0070675_100002994 3300005354 Bacteria 12765
41 Ga0070675_100339529 3300005354 Unclassified 1330
42 Ga0070675_100946410 3300005354 Bacteria 790
43 Ga0070675_101258615 3300005354 Bacteria 681
44 Ga0070671_100042531 3300005355 Bacteria 3777
45 Ga0070671_100112604 3300005355 Bacteria 2286
46 Ga0070671_100149507 3300005355 Bacteria 1972
47 Ga0070671_100185553 3300005355 Bacteria 1762
48 Ga0070671_101705144 3300005355 Bacteria 559
49 Ga0070674_101679332 3300005356 Bacteria 574
50 Ga0070673_100086415 3300005364 Unclassified 2555
51 Ga0070659_100206487 3300005366 Bacteria 1618
52 Ga0070659_101204046 3300005366 Unclassified 670
53 Ga0070714_100347311 3300005435 Bacteria 1393
54 Ga0070663_100023854 3300005455 Bacteria 4106
55 Ga0070663_100461391 3300005455 Bacteria 1049
56 Ga0070663_101032170 3300005455 Bacteria 716
57 Ga0070678_100148154 3300005456 Bacteria 1887
58 Ga0070678_100247430 3300005456 Bacteria 1494
59 Ga0070662_100001623 3300005457 Bacteria 13868
60 Ga0070662_100006709 3300005457 Bacteria 7437
61 Ga0070679_100664433 3300005530 Bacteria 985
62 Ga0070679_102093794 3300005530 Bacteria 515
63 Ga0070684_101135795 3300005535 Bacteria 734
64 Ga0068853_100253092 3300005539 Bacteria 1617
65 Ga0070672_100261786 3300005543 Bacteria 1459
66 Ga0070672_100262745 3300005543 Bacteria 1456
67 Ga0070672_102083180 3300005543 Bacteria 511
68 Ga0070665_100019344 3300005548 Bacteria 6833
69 Ga0070665_100343684 3300005548 Bacteria 1497
70 Ga0070665_100447768 3300005548 Bacteria 1301
71 Ga0070664_100080425 3300005564 Bacteria 2807
72 Ga0070664_100267669 3300005564 Bacteria 1539
73 Ga0070664_100612499 3300005564 Unclassified 1010
74 Ga0068857_100182778 3300005577 Bacteria 1908
75 Ga0068857_100750652 3300005577 Bacteria 929
76 Ga0068864_100109038 3300005618 Bacteria 2464
77 Ga0068864_102486751 3300005618 Bacteria 524
78 Ga0068861_100423431 3300005719 Bacteria 1187
79 Ga0068863_100576574 3300005841 Bacteria 1112
80 Ga0068862_100107754 3300005844 Bacteria 2443
81 Ga0068862_100619766 3300005844 Bacteria 1041
82 Ga0068862_101111629 3300005844 Bacteria 786
83 Ga0075364_10858777 3300006051 Bacteria 618
84 Ga0075364_11100933 3300006051 Bacteria 539
85 Ga0068871_100823738 3300006358 Bacteria 857
86 Ga0075430_100036851 3300006846 Bacteria 4145
87 Ga0068865_101140010 3300006881 Bacteria 688
88 Ga0079104_1120759 3300006946 Bacteria 514
89 Ga0105247_10525096 3300009101 Bacteria 866
90 Ga0105248_10057225 3300009177 Bacteria 4376
91 Ga0105237_10378941 3300009545 Bacteria 1419
92 Ga0105238_10353635 3300009551 Bacteria 1458
93 Ga0105239_10195765 3300010375 Bacteria 2263
94 Ga0157373_10314613 3300013100 Bacteria 1113
95 Ga0157371_10081180 3300013102 Bacteria 2296
96 Ga0157371_10112056 3300013102 Bacteria 1936
97 Ga0157370_10655020 3300013104 Bacteria 960
98 Ga0157369_10301040 3300013105 Bacteria 1668
99 Ga0157374_10468451 3300013296 Bacteria 1262
100 Ga0157372_10092823 3300013307 Bacteria 3434
101 Ga0157372_10102993 3300013307 Bacteria 3261
102 Ga0157380_10084239 3300014326 Plasmid 2606
103 Ga0157380_10513836 3300014326 Bacteria 1167
104 Ga0157380_10521042 3300014326 Bacteria 1159
105 Ga0157380_12002673 3300014326 Bacteria 641
106 Ga0182008_10331983 3300014497 Bacteria 802
107 Ga0182006_1068714 3300015261 Bacteria 1319
108 Ga0182007_10064747 3300015262 Bacteria 1198
109 Ga0182007_10290142 3300015262 Bacteria 598
110 Ga0163161_10669875 3300017792 Bacteria 861
111 Ga0206354_11156600 3300020081 Bacteria 737
112 Ga0206353_10386402 3300020082 Bacteria 1253
113 Ga0209673_1028138 3300025273 Bacteria 1816
114 Ga0209050_1000071 3300025298 Bacteria 295478
115 Ga0209050_1064503 3300025298 Bacteria 849
116 Ga0209257_1000027 3300025304 Bacteria 703541
117 Ga0209257_1016629 3300025304 Bacteria 2960
118 Ga0207682_10009828 3300025893 Bacteria 3763
119 Ga0207682_10269260 3300025893 Bacteria 795
120 Ga0207647_10003114 3300025904 Bacteria 12459
121 Ga0207647_10249783 3300025904 Bacteria 1018
122 Ga0207645_10048963 3300025907 Bacteria 2699
123 Ga0207645_10119474 3300025907 Bacteria 1710
124 Ga0207705_10000215 3300025909 Bacteria 57467
125 Ga0207705_10005626 3300025909 Bacteria 9359
126 Ga0207705_10072108 3300025909 Bacteria 2504
127 Ga0207695_10654980 3300025913 Bacteria 931
128 Ga0207671_10089516 3300025914 Bacteria 2316
129 Ga0207657_10001954 3300025919 Bacteria 22243
130 Ga0207657_10002049 3300025919 Bacteria 21807
131 Ga0207649_10087524 3300025920 Bacteria 2032
132 Ga0207649_11290170 3300025920 Unclassified 577
133 Ga0207652_10909620 3300025921 Bacteria 777
134 Ga0207652_11223249 3300025921 Bacteria 653
135 Ga0207681_10077658 3300025923 Bacteria 2335
136 Ga0207681_10178613 3300025923 Bacteria 1615
137 Ga0207694_10196438 3300025924 Bacteria 1640
138 Ga0207650_10006108 3300025925 Bacteria 8207
139 Ga0207650_10148394 3300025925 Bacteria 1849
140 Ga0207659_10295372 3300025926 Unclassified 1329
141 Ga0207659_10948346 3300025926 Bacteria 740
142 Ga0207664_10768004 3300025929 Bacteria 867
143 Ga0207644_10018894 3300025931 Bacteria 4671
144 Ga0207644_10072453 3300025931 Bacteria 2523
145 Ga0207644_10930580 3300025931 Bacteria 729
146 Ga0207690_10088815 3300025932 Bacteria 2178
147 Ga0207690_11013786 3300025932 Unclassified 691
148 Ga0207706_10024507 3300025933 Bacteria 5409
149 Ga0207706_10896875 3300025933 Bacteria 749
150 Ga0207706_11146953 3300025933 Bacteria 648
151 Ga0207711_10002660 3300025941 Bacteria 15795
152 Ga0207711_11964419 3300025941 Unclassified 528
153 Ga0207679_10293938 3300025945 Unclassified 1397
154 Ga0207679_11342984 3300025945 Bacteria 656
155 Ga0207667_11141542 3300025949 Bacteria 761
156 Ga0207651_10313317 3300025960 Unclassified 1309
157 Ga0207668_10063576 3300025972 Bacteria 2604
158 Ga0207668_10199641 3300025972 Bacteria 1592
159 Ga0207678_10016599 3300026067 Bacteria 6468
160 Ga0207678_10090310 3300026067 Bacteria 2618
161 Ga0207678_10224982 3300026067 Bacteria 1606
162 Ga0207678_11522801 3300026067 Bacteria 590
163 Ga0207702_10059208 3300026078 Bacteria 3262
164 Ga0207641_10509824 3300026088 Bacteria 1169
165 Ga0207648_11378595 3300026089 Bacteria 663
166 Ga0207676_10062021 3300026095 Bacteria 2963
167 Ga0207676_11545711 3300026095 Bacteria 661
168 Ga0207674_10089726 3300026116 Bacteria 3066
169 Ga0207674_10509015 3300026116 Bacteria 1163
170 Ga0207683_10086565 3300026121 Bacteria 2786
171 Ga0209967_1037213 3300027364 Bacteria 736
172 Ga0268266_10031118 3300028379 Bacteria 4531
173 Ga0268266_10092532 3300028379 Bacteria 2653
174 Ga0268265_10602263 3300028380 Bacteria 1050
175 Ga0307515_10000420 3300028794 Bacteria 102216
176 Ga0314311_1107394 3300030733 Bacteria 2024
177 Ga0307513_10004196 3300031456 Bacteria 19276
178 Ga0307408_100103352 3300031548 Bacteria 2175
179 Ga0307408_100332618 3300031548 Bacteria 1283
180 Ga0307408_100341311 3300031548 Bacteria 1268
181 Ga0307408_100606779 3300031548 Bacteria 973
182 Ga0307408_101050171 3300031548 Bacteria 753
183 Ga0307408_101157676 3300031548 Bacteria 720
184 Ga0307405_10013055 3300031731 Bacteria 4421
185 Ga0307405_10056177 3300031731 Unclassified 2468
186 Ga0307405_10104322 3300031731 Bacteria 1908
187 Ga0307405_10318309 3300031731 Bacteria 1187
188 Ga0307405_10716299 3300031731 Bacteria 830
189 Ga0307413_10154681 3300031824 Bacteria 1602
190 Ga0307413_10238168 3300031824 Bacteria 1342
191 Ga0307413_10335372 3300031824 Bacteria 1161
192 Ga0307413_10380933 3300031824 Bacteria 1099
193 Ga0307413_10536590 3300031824 Bacteria 946
194 Ga0307410_10004024 3300031852 Bacteria 7507
195 Ga0307410_10008199 3300031852 Bacteria 5779
196 Ga0307410_10091084 3300031852 Bacteria 2164
197 Ga0307410_10153502 3300031852 Bacteria 1717
198 Ga0307410_10169466 3300031852 Bacteria 1644
199 Ga0307410_10255313 3300031852 Bacteria 1365
200 Ga0307410_10282905 3300031852 Bacteria 1302
201 Ga0307410_10673791 3300031852 Bacteria 869
202 Ga0307406_10005667 3300031901 Bacteria 6828
203 Ga0307406_10014615 3300031901 Bacteria 4520
204 Ga0307406_10182973 3300031901 Unclassified 1527
205 Ga0307406_10211996 3300031901 Bacteria 1433
206 Ga0307406_10745284 3300031901 Bacteria 822
207 Ga0307407_10020869 3300031903 Bacteria 3366
208 Ga0307407_10021626 3300031903 Bacteria 3322
209 Ga0307407_10023699 3300031903 Bacteria 3206
210 Ga0307407_10024224 3300031903 Bacteria 3179
211 Ga0307407_11088578 3300031903 Bacteria 621
212 Ga0307412_10092980 3300031911 Unclassified 2115
213 Ga0307412_10101892 3300031911 Bacteria 2032
214 Ga0307412_10395586 3300031911 Bacteria 1123
215 Ga0307412_10617355 3300031911 Bacteria 920
216 Ga0307412_10783044 3300031911 Bacteria 826
217 Ga0307412_10840398 3300031911 Bacteria 800
218 Ga0307412_11608757 3300031911 Bacteria 593
219 Ga0307409_100017905 3300031995 Bacteria 4739
220 Ga0307409_100057995 3300031995 Bacteria 3004
221 Ga0307409_100069537 3300031995 Bacteria 2790
222 Ga0307409_100122360 3300031995 Bacteria 2206
223 Ga0307409_100214295 3300031995 Bacteria 1733
224 Ga0307409_100333693 3300031995 Bacteria 1424
225 Ga0307409_100580884 3300031995 Bacteria 1104
226 Ga0307409_100603613 3300031995 Bacteria 1085
227 Ga0307409_101502229 3300031995 Bacteria 701
228 Ga0307416_100043109 3300032002 Bacteria 3530
229 Ga0307416_100055436 3300032002 Bacteria 3192
230 Ga0307416_100150862 3300032002 Bacteria 2131
231 Ga0307416_100171665 3300032002 Bacteria 2019
232 Ga0307416_100218742 3300032002 Unclassified 1825
233 Ga0307416_100311366 3300032002 Bacteria 1571
234 Ga0307416_100388269 3300032002 Bacteria 1429
235 Ga0307416_100407776 3300032002 Bacteria 1399
236 Ga0307416_101522935 3300032002 Bacteria 774
237 Ga0307416_101771755 3300032002 Bacteria 722
238 Ga0307416_102414576 3300032002 Bacteria 625
239 Ga0307414_10003139 3300032004 Bacteria 8773
240 Ga0307414_10006961 3300032004 Bacteria 6338
241 Ga0307414_10128007 3300032004 Bacteria 1966
242 Ga0307414_10129495 3300032004 Bacteria 1956
243 Ga0307414_10288715 3300032004 Bacteria 1382
244 Ga0307414_10349713 3300032004 Bacteria 1268
245 Ga0307414_10495298 3300032004 Bacteria 1080
246 Ga0307414_10741180 3300032004 Bacteria 892
247 Ga0307411_10012032 3300032005 Bacteria 4700
248 Ga0307411_10069599 3300032005 Bacteria 2377
249 Ga0307411_10077849 3300032005 Bacteria 2271
250 Ga0307411_10109249 3300032005 Bacteria 1975
251 Ga0307411_10140351 3300032005 Bacteria 1781
252 Ga0307411_10142255 3300032005 Bacteria 1770
253 Ga0307411_10196897 3300032005 Bacteria 1544
254 Ga0307411_10231902 3300032005 Bacteria 1439
255 Ga0307411_10237956 3300032005 Bacteria 1423
256 Ga0307411_10358621 3300032005 Bacteria 1191
257 Ga0307411_10365010 3300032005 Unclassified 1182
258 Ga0307411_10417983 3300032005 Bacteria 1113
259 Ga0307415_100035792 3300032126 Bacteria 3246
260 Ga0307415_100054510 3300032126 Bacteria 2730
261 Ga0307415_100062131 3300032126 Bacteria 2589
262 Ga0307415_100067422 3300032126 Bacteria 2500
263 Ga0307415_100076332 3300032126 Bacteria 2375
264 Ga0307415_100107441 3300032126 Bacteria 2062
265 Ga0307415_100116975 3300032126 Bacteria 1990
266 Ga0307415_100173808 3300032126 Bacteria 1683
267 Ga0307415_100209825 3300032126 Bacteria 1553
268 Ga0307415_100229456 3300032126 Bacteria 1494
269 Ga0307415_100534704 3300032126 Bacteria 1031
270 Ga0373952_0236667 3300035092 Bacteria 548
271 Ga0395900_1209891 3300037418 Bacteria 671
272 Ga0395905_0493007 3300037471 Bacteria 1125
273 Ga0439436_0120795 3300041404 Bacteria 733
274 Ga0439461_0040943 3300041410 Bacteria 1001
275 Ga0439465_0116659 3300041413 Unclassified 933
276 Ga0451797_1567653 3300041453 Bacteria 819
277 Ga0451804_0561690 3300041463 Bacteria 825
278 Ga0451807_1154016 3300041486 Bacteria 1504
279 Ga0451853_0590617 3300041512 Bacteria 1320
280 Ga0439432_030812 3300042006 Bacteria 1738
281 Ga0439432_184341 3300042006 Bacteria 607
282 Ga0439449_0021701 3300042007 Bacteria 2404
283 Ga0439449_0043180 3300042007 Bacteria 1674
284 Ga0450912_010568 3300042116 Bacteria 793
285 Ga0450890_023009 3300042127 Bacteria 855
286 Ga0451577_0507764 3300042876 Bacteria 1095
287 Ga0466969_0165245 3300044656 Bacteria 1016
288 Ga0466972_0019608 3300044658 Bacteria 3381
289 Ga0466965_0314660 3300044683 Bacteria 852
290 Ga0466966_0257994 3300044684 Bacteria 1050
291 Ga0466966_0443874 3300044684 Bacteria 780
292 Ga0466961_0125579 3300044693 Bacteria 1610
293 Ga0466961_0140384 3300044693 Bacteria 1513
294 Ga0466963_0035196 3300044694 Bacteria 3261
295 Ga0466964_0090431 3300044706 Bacteria 1331
296 Ga0466964_0428022 3300044706 Bacteria 697
297 Ga0466968_0032708 3300044735 Bacteria 2164
298 Ga0466970_0057587 3300044765 Bacteria 2078
299 Ga0466957_0040367 3300044842 Bacteria 2819
300 Ga0466960_0024273 3300044901 Bacteria 2734
301 Ga0466960_0365128 3300044901 Bacteria 826
302 Ga0466959_0030097 3300045049 Bacteria 4020
303 Ga0466959_0424209 3300045049 Bacteria 903
304 Ga0466958_0015065 3300045836 Bacteria 4424
305 Ga0466958_0752175 3300045836 Bacteria 635
306 Ga0495638_0187425 3300046460 Bacteria 1176
307 Ga0495607_0005118 3300046501 Bacteria 9480
308 Ga0495606_0150878 3300046507 Bacteria 1364
309 Ga0495663_0133665 3300046525 Bacteria 838
310 Ga0495668_0048011 3300046616 Bacteria 2369
311 Ga0495686_0270367 3300047472 Bacteria 948
312 Ga0496107_0807484 3300048910 Bacteria 687
313 Ga0496109_1265758 3300048912 Bacteria 674
314 Ga0496110_0110014 3300048913 Bacteria 2475
315 Ga0496110_0799866 3300048913 Bacteria 847
316 Ga0496112_0382963 3300048915 Bacteria 1347
317 Ga0496112_0525786 3300048915 Bacteria 1117
318 Ga0496113_0027262 3300048916 Bacteria 4094
319 Ga0496114_0690330 3300048917 Bacteria 896
320 Ga0496117_0482323 3300048920 Bacteria 605
321 Ga0496118_0047508 3300048921 Bacteria 3325
322 Ga0496121_0059801 3300048924 Bacteria 3139
323 Ga0496121_0612716 3300048924 Bacteria 669
324 Ga0496121_0719067 3300048924 Bacteria 598
325 Ga0496122_0042878 3300048925 Bacteria 3553
326 Ga0496123_0175901 3300048926 Bacteria 1123
327 Ga0496126_0096244 3300048929 Bacteria 2596
328 Ga0496126_0258685 3300048929 Bacteria 1448
329 Ga0501076_1529596 3300049592 Bacteria 548
330 Ga0501209_057535 3300049656 Bacteria 1077
331 Ga0501223_011297 3300049663 Bacteria 1792
332 Ga0501230_034783 3300049667 Bacteria 954
333 Ga0501235_070875 3300049669 Bacteria 825
334 Ga0501236_034387 3300049670 Bacteria 816
335 Ga0501247_021443 3300049677 Bacteria 841
336 Ga0501261_125070 3300049690 Bacteria 513
337 Ga0501241_007813 3300049758 Bacteria 1958
338 Ga0501262_003194 3300049759 Bacteria 1872
339 Ga0501268_063813 3300049765 Bacteria 734
340 Ga0501283_027574 3300049779 Bacteria 939
341 nmdc:mga03n38_684006_c1 3300050490 Bacteria 590
342 nmdc:mga00v17_1004267_c1 3300050491 Bacteria 525
343 Ga0500566_0000089 3300053094 Bacteria 45622
344 Ga0500568_0321340 3300053139 Bacteria 561
345 Ga0500573_0020970 3300053140 Bacteria 3742
346 Ga0466962_0020435 3300061719 Bacteria 3181

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100000566 Ga0070670_10000056623 140
2 3300005353 Ga0070669_100861802 Ga0070669_1008618021 140
3 3300006051 Ga0075364_11100933 Ga0075364_111009331 140
4 3300009101 Ga0105247_10525096 Ga0105247_105250961 140
5 3300009551 Ga0105238_10353635 Ga0105238_103536352 140
6 3300010375 Ga0105239_10195765 Ga0105239_101957655 140
7 3300013104 Ga0157370_10655020 Ga0157370_106550202 140
8 3300014497 Ga0182008_10331983 Ga0182008_103319831 140
9 3300015261 Ga0182006_1068714 Ga0182006_10687141 140
10 3300015262 Ga0182007_10064747 Ga0182007_100647472 140
11 3300025273 Ga0209673_1028138 Ga0209673_10281381 140
12 3300025913 Ga0207695_10654980 Ga0207695_106549802 140
13 3300025924 Ga0207694_10196438 Ga0207694_101964382 140
14 3300025925 Ga0207650_10006108 Ga0207650_100061087 140
15 3300025949 Ga0207667_11141542 Ga0207667_111415421 140
16 3300037418 Ga0395900_1209891 Ga0395900_1209891_89_511 140
17 3300048910 Ga0496107_0807484 Ga0496107_0807484_127_549 140
18 3300048915 Ga0496112_0382963 Ga0496112_0382963_850_1272 140
19 3300048924 Ga0496121_0059801 Ga0496121_0059801_574_1011 140
20 3300048924 Ga0496121_0612716 Ga0496121_0612716_27_464 140
21 3300048924 Ga0496121_0719067 Ga0496121_0719067_59_586 140
22 3300048925 Ga0496122_0042878 Ga0496122_0042878_2484_2921 140
23 3300048926 Ga0496123_0175901 Ga0496123_0175901_138_575 140
24 3300048929 Ga0496126_0096244 Ga0496126_0096244_346_768 140
25 3300050490 nmdc:mga03n38_684006_c1 nmdc:mga03n38_684006_c1_58_495 140
26 3300050491 nmdc:mga00v17_1004267_c1 nmdc:mga00v17_1004267_c1_42_479 140
27 3300053139 Ga0500568_0321340 Ga0500568_0321340_33_455 140
28 3300028794 Ga0307515_10000420 Ga0307515_1000042018 141
29 3300031456 Ga0307513_10004196 Ga0307513_100041963 141
30 3300053140 Ga0500573_0020970 Ga0500573_0020970_2661_3095 142
31 3300031995 Ga0307409_101502229 Ga0307409_1015022291 146
32 3300046501 Ga0495607_0005118 Ga0495607_0005118_7218_7661 147
33 3300001990 JGI24737J22298_10001946 JGI24737J22298_100019464 148
34 3300002067 JGI24735J21928_10003470 JGI24735J21928_100034705 148
35 3300002067 JGI24735J21928_10009309 JGI24735J21928_100093093 148
36 3300002075 JGI24738J21930_10002652 JGI24738J21930_100026523 148
37 3300003320 rootH2_10113643 rootH2_101136432 148
38 3300003322 rootL2_10100517 rootL2_101005172 148
39 3300005327 Ga0070658_10000066 Ga0070658_1000006614 148
40 3300005339 Ga0070660_100000713 Ga0070660_10000071317 148
41 3300005457 Ga0070662_100001623 Ga0070662_10000162312 148
42 3300005530 Ga0070679_102093794 Ga0070679_1020937941 148
43 3300009545 Ga0105237_10378941 Ga0105237_103789412 148
44 3300013102 Ga0157371_10112056 Ga0157371_101120562 148
45 3300013307 Ga0157372_10092823 Ga0157372_100928232 148
46 3300013307 Ga0157372_10102993 Ga0157372_101029933 148
47 3300025304 Ga0209257_1016629 Ga0209257_10166293 148
48 3300025904 Ga0207647_10003114 Ga0207647_100031144 148
49 3300025909 Ga0207705_10000215 Ga0207705_1000021536 148
50 3300025914 Ga0207671_10089516 Ga0207671_100895164 148
51 3300025919 Ga0207657_10002049 Ga0207657_1000204913 148
52 3300025933 Ga0207706_10024507 Ga0207706_100245077 148
53 3300026078 Ga0207702_10059208 Ga0207702_100592084 148
54 3300026116 Ga0207674_10509015 Ga0207674_105090152 148
55 3300041463 Ga0451804_0561690 Ga0451804_0561690_292_738 148
56 3300041486 Ga0451807_1154016 Ga0451807_1154016_963_1409 148
57 3300041512 Ga0451853_0590617 Ga0451853_0590617_652_1098 148
58 3300044656 Ga0466969_0165245 Ga0466969_0165245_26_511 148
59 3300044658 Ga0466972_0019608 Ga0466972_0019608_1567_2052 148
60 3300044706 Ga0466964_0090431 Ga0466964_0090431_727_1212 148
61 3300044735 Ga0466968_0032708 Ga0466968_0032708_136_621 148
62 3300044765 Ga0466970_0057587 Ga0466970_0057587_1091_1594 148
63 3300044901 Ga0466960_0024273 Ga0466960_0024273_229_714 148
64 3300045049 Ga0466959_0030097 Ga0466959_0030097_1675_2160 148
65 3300045836 Ga0466958_0752175 Ga0466958_0752175_82_567 148
66 3300046507 Ga0495606_0150878 Ga0495606_0150878_883_1329 148
67 3300048920 Ga0496117_0482323 Ga0496117_0482323_69_515 148
68 3300048921 Ga0496118_0047508 Ga0496118_0047508_445_891 148
69 3300005577 Ga0068857_100750652 Ga0068857_1007506522 149
70 3300048929 Ga0496126_0258685 Ga0496126_0258685_272_727 149
71 3300005293 Ga0065715_10210328 Ga0065715_102103281 150
72 3300005328 Ga0070676_10454865 Ga0070676_104548651 150
73 3300005331 Ga0070670_100022216 Ga0070670_1000222161 150
74 3300005331 Ga0070670_100516196 Ga0070670_1005161962 150
75 3300005333 Ga0070677_10002686 Ga0070677_100026863 150
76 3300005353 Ga0070669_100030044 Ga0070669_1000300442 150
77 3300005353 Ga0070669_100817409 Ga0070669_1008174091 150
78 3300005355 Ga0070671_100149507 Ga0070671_1001495072 150
79 3300005355 Ga0070671_100185553 Ga0070671_1001855532 150
80 3300005356 Ga0070674_101679332 Ga0070674_1016793321 150
81 3300005455 Ga0070663_100461391 Ga0070663_1004613911 150
82 3300005456 Ga0070678_100148154 Ga0070678_1001481541 150
83 3300005457 Ga0070662_100006709 Ga0070662_1000067097 150
84 3300005548 Ga0070665_100019344 Ga0070665_1000193445 150
85 3300005564 Ga0070664_100080425 Ga0070664_1000804252 150
86 3300005564 Ga0070664_100267669 Ga0070664_1002676692 150
87 3300005577 Ga0068857_100182778 Ga0068857_1001827781 150
88 3300005618 Ga0068864_102486751 Ga0068864_1024867511 150
89 3300006881 Ga0068865_101140010 Ga0068865_1011400101 150
90 3300013100 Ga0157373_10314613 Ga0157373_103146132 150
91 3300014326 Ga0157380_10513836 Ga0157380_105138362 150
92 3300014326 Ga0157380_12002673 Ga0157380_120026731 150
93 3300020081 Ga0206354_11156600 Ga0206354_111566001 150
94 3300020082 Ga0206353_10386402 Ga0206353_103864022 150
95 3300025893 Ga0207682_10009828 Ga0207682_100098284 150
96 3300025907 Ga0207645_10048963 Ga0207645_100489633 150
97 3300025920 Ga0207649_11290170 Ga0207649_112901701 150
98 3300025933 Ga0207706_10896875 Ga0207706_108968751 150
99 3300025972 Ga0207668_10199641 Ga0207668_101996412 150
100 3300026067 Ga0207678_10224982 Ga0207678_102249822 150
101 3300026067 Ga0207678_11522801 Ga0207678_115228011 150
102 3300026095 Ga0207676_11545711 Ga0207676_115457111 150
103 3300026116 Ga0207674_10089726 Ga0207674_100897263 150
104 3300026121 Ga0207683_10086565 Ga0207683_100865652 150
105 3300027364 Ga0209967_1037213 Ga0209967_10372131 150
106 3300028379 Ga0268266_10031118 Ga0268266_100311182 150
107 3300031548 Ga0307408_100341311 Ga0307408_1003413112 150
108 3300031548 Ga0307408_100606779 Ga0307408_1006067792 150
109 3300031548 Ga0307408_101157676 Ga0307408_1011576761 150
110 3300031731 Ga0307405_10056177 Ga0307405_100561775 150
111 3300031731 Ga0307405_10104322 Ga0307405_101043222 150
112 3300031731 Ga0307405_10318309 Ga0307405_103183092 150
113 3300031824 Ga0307413_10335372 Ga0307413_103353721 150
114 3300031824 Ga0307413_10536590 Ga0307413_105365902 150
115 3300031852 Ga0307410_10008199 Ga0307410_100081992 150
116 3300031852 Ga0307410_10153502 Ga0307410_101535022 150
117 3300031852 Ga0307410_10169466 Ga0307410_101694662 150
118 3300031852 Ga0307410_10255313 Ga0307410_102553131 150
119 3300031852 Ga0307410_10282905 Ga0307410_102829051 150
120 3300031901 Ga0307406_10182973 Ga0307406_101829732 150
121 3300031911 Ga0307412_10092980 Ga0307412_100929802 150
122 3300031911 Ga0307412_10783044 Ga0307412_107830441 150
123 3300031911 Ga0307412_10840398 Ga0307412_108403981 150
124 3300031995 Ga0307409_100069537 Ga0307409_1000695373 150
125 3300031995 Ga0307409_100603613 Ga0307409_1006036131 150
126 3300032002 Ga0307416_100043109 Ga0307416_1000431094 150
127 3300032002 Ga0307416_100150862 Ga0307416_1001508621 150
128 3300032002 Ga0307416_100218742 Ga0307416_1002187422 150
129 3300032002 Ga0307416_100311366 Ga0307416_1003113662 150
130 3300032002 Ga0307416_101771755 Ga0307416_1017717551 150
131 3300032004 Ga0307414_10006961 Ga0307414_100069615 150
132 3300032004 Ga0307414_10128007 Ga0307414_101280071 150
133 3300032004 Ga0307414_10288715 Ga0307414_102887152 150
134 3300032005 Ga0307411_10109249 Ga0307411_101092493 150
135 3300032005 Ga0307411_10140351 Ga0307411_101403512 150
136 3300032005 Ga0307411_10231902 Ga0307411_102319021 150
137 3300032005 Ga0307411_10237956 Ga0307411_102379562 150
138 3300032005 Ga0307411_10365010 Ga0307411_103650101 150
139 3300032126 Ga0307415_100035792 Ga0307415_1000357922 150
140 3300032126 Ga0307415_100107441 Ga0307415_1001074413 150
141 3300032126 Ga0307415_100173808 Ga0307415_1001738081 150
142 3300032126 Ga0307415_100209825 Ga0307415_1002098253 150
143 3300042876 Ga0451577_0507764 Ga0451577_0507764_598_1056 150
144 3300044684 Ga0466966_0443874 Ga0466966_0443874_113_565 150
145 3300044693 Ga0466961_0125579 Ga0466961_0125579_692_1144 150
146 3300044694 Ga0466963_0035196 Ga0466963_0035196_1455_1907 150
147 3300044706 Ga0466964_0428022 Ga0466964_0428022_30_482 150
148 3300044842 Ga0466957_0040367 Ga0466957_0040367_1504_1956 150
149 3300045836 Ga0466958_0015065 Ga0466958_0015065_818_1270 150
150 3300048912 Ga0496109_1265758 Ga0496109_1265758_133_591 150
151 3300049690 Ga0501261_125070 Ga0501261_125070_26_481 150
152 3300061719 Ga0466962_0020435 Ga0466962_0020435_836_1288 150
153 3300005347 Ga0070668_100417924 Ga0070668_1004179243 151
154 3300005548 Ga0070665_100343684 Ga0070665_1003436843 151
155 3300025972 Ga0207668_10063576 Ga0207668_100635762 151
156 3300026089 Ga0207648_11378595 Ga0207648_113785952 151
157 3300003794 Ga0055531_10000094 Ga0055531_1000009440 152
158 3300005262 Ga0065165_1002026 Ga0065165_100202614 152
159 3300005331 Ga0070670_100440315 Ga0070670_1004403152 152
160 3300005353 Ga0070669_100450425 Ga0070669_1004504252 152
161 3300005354 Ga0070675_100339529 Ga0070675_1003395292 152
162 3300005354 Ga0070675_101258615 Ga0070675_1012586151 152
163 3300005355 Ga0070671_100112604 Ga0070671_1001126043 152
164 3300005364 Ga0070673_100086415 Ga0070673_1000864152 152
165 3300005366 Ga0070659_101204046 Ga0070659_1012040461 152
166 3300005543 Ga0070672_100261786 Ga0070672_1002617861 152
167 3300005543 Ga0070672_102083180 Ga0070672_1020831801 152
168 3300005719 Ga0068861_100423431 Ga0068861_1004234311 152
169 3300005844 Ga0068862_100619766 Ga0068862_1006197662 152
170 3300005844 Ga0068862_101111629 Ga0068862_1011116291 152
171 3300006946 Ga0079104_1120759 Ga0079104_11207591 152
172 3300014326 Ga0157380_10521042 Ga0157380_105210421 152
173 3300025298 Ga0209050_1000071 Ga0209050_1000071232 152
174 3300025298 Ga0209050_1064503 Ga0209050_10645031 152
175 3300025304 Ga0209257_1000027 Ga0209257_100002771 152
176 3300025907 Ga0207645_10119474 Ga0207645_101194743 152
177 3300025923 Ga0207681_10077658 Ga0207681_100776581 152
178 3300025925 Ga0207650_10148394 Ga0207650_101483942 152
179 3300025926 Ga0207659_10295372 Ga0207659_102953722 152
180 3300025926 Ga0207659_10948346 Ga0207659_109483461 152
181 3300025931 Ga0207644_10072453 Ga0207644_100724532 152
182 3300025932 Ga0207690_11013786 Ga0207690_110137861 152
183 3300025933 Ga0207706_11146953 Ga0207706_111469531 152
184 3300025941 Ga0207711_11964419 Ga0207711_119644191 152
185 3300025945 Ga0207679_10293938 Ga0207679_102939382 152
186 3300025945 Ga0207679_11342984 Ga0207679_113429841 152
187 3300025960 Ga0207651_10313317 Ga0207651_103133172 152
188 3300028380 Ga0268265_10602263 Ga0268265_106022632 152
189 3300030733 Ga0314311_1107394 Ga0314311_11073943 152
190 3300031901 Ga0307406_10211996 Ga0307406_102119961 152
191 3300031903 Ga0307407_10024224 Ga0307407_100242241 152
192 3300031911 Ga0307412_11608757 Ga0307412_116087572 152
193 3300031995 Ga0307409_100580884 Ga0307409_1005808842 152
194 3300032002 Ga0307416_100171665 Ga0307416_1001716651 152
195 3300032002 Ga0307416_100407776 Ga0307416_1004077763 152
196 3300032004 Ga0307414_10129495 Ga0307414_101294952 152
197 3300032005 Ga0307411_10142255 Ga0307411_101422554 152
198 3300032126 Ga0307415_100067422 Ga0307415_1000674222 152
199 3300032126 Ga0307415_100076332 Ga0307415_1000763321 152
200 3300032126 Ga0307415_100116975 Ga0307415_1001169756 152
201 3300037471 Ga0395905_0493007 Ga0395905_0493007_124_582 152
202 3300041413 Ga0439465_0116659 Ga0439465_0116659_454_912 152
203 3300042006 Ga0439432_030812 Ga0439432_030812_808_1266 152
204 3300042006 Ga0439432_184341 Ga0439432_184341_50_520 152
205 3300042007 Ga0439449_0021701 Ga0439449_0021701_395_853 152
206 3300044684 Ga0466966_0257994 Ga0466966_0257994_128_586 152
207 3300045049 Ga0466959_0424209 Ga0466959_0424209_23_481 152
208 3300046460 Ga0495638_0187425 Ga0495638_0187425_92_565 152
209 3300047472 Ga0495686_0270367 Ga0495686_0270367_35_508 152
210 3300049656 Ga0501209_057535 Ga0501209_057535_563_1021 152
211 3300049663 Ga0501223_011297 Ga0501223_011297_1057_1515 152
212 3300049667 Ga0501230_034783 Ga0501230_034783_79_537 152
213 3300049669 Ga0501235_070875 Ga0501235_070875_329_787 152
214 3300049670 Ga0501236_034387 Ga0501236_034387_331_789 152
215 3300049677 Ga0501247_021443 Ga0501247_021443_321_779 152
216 3300049758 Ga0501241_007813 Ga0501241_007813_747_1217 152
217 3300049759 Ga0501262_003194 Ga0501262_003194_1280_1738 152
218 3300049765 Ga0501268_063813 Ga0501268_063813_24_482 152
219 3300049779 Ga0501283_027574 Ga0501283_027574_314_772 152
220 3300053094 Ga0500566_0000089 Ga0500566_0000089_44274_44744 152
221 3300005290 Ga0065712_10428532 Ga0065712_104285321 153
222 3300005293 Ga0065715_10031571 Ga0065715_100315713 153
223 3300005293 Ga0065715_11016424 Ga0065715_110164241 153
224 3300005327 Ga0070658_10541636 Ga0070658_105416361 153
225 3300005347 Ga0070668_100279781 Ga0070668_1002797811 153
226 3300005353 Ga0070669_100073424 Ga0070669_1000734243 153
227 3300005354 Ga0070675_100946410 Ga0070675_1009464102 153
228 3300005355 Ga0070671_100042531 Ga0070671_1000425316 153
229 3300005355 Ga0070671_101705144 Ga0070671_1017051441 153
230 3300005456 Ga0070678_100247430 Ga0070678_1002474302 153
231 3300005543 Ga0070672_100262745 Ga0070672_1002627453 153
232 3300005618 Ga0068864_100109038 Ga0068864_1001090386 153
233 3300005841 Ga0068863_100576574 Ga0068863_1005765741 153
234 3300005844 Ga0068862_100107754 Ga0068862_1001077543 153
235 3300006051 Ga0075364_10858777 Ga0075364_108587771 153
236 3300006358 Ga0068871_100823738 Ga0068871_1008237381 153
237 3300006846 Ga0075430_100036851 Ga0075430_1000368514 153
238 3300009177 Ga0105248_10057225 Ga0105248_100572254 153
239 3300014326 Ga0157380_10084239 Ga0157380_100842391 153
240 3300017792 Ga0163161_10669875 Ga0163161_106698751 153
241 3300025893 Ga0207682_10269260 Ga0207682_102692601 153
242 3300025921 Ga0207652_10909620 Ga0207652_109096201 153
243 3300025923 Ga0207681_10178613 Ga0207681_101786132 153
244 3300025931 Ga0207644_10018894 Ga0207644_100188944 153
245 3300025931 Ga0207644_10930580 Ga0207644_109305801 153
246 3300025941 Ga0207711_10002660 Ga0207711_100026603 153
247 3300026067 Ga0207678_10090310 Ga0207678_100903103 153
248 3300026088 Ga0207641_10509824 Ga0207641_105098243 153
249 3300026095 Ga0207676_10062021 Ga0207676_100620213 153
250 3300028379 Ga0268266_10092532 Ga0268266_100925323 153
251 3300031548 Ga0307408_100103352 Ga0307408_1001033523 153
252 3300031548 Ga0307408_100332618 Ga0307408_1003326182 153
253 3300031548 Ga0307408_101050171 Ga0307408_1010501711 153
254 3300031731 Ga0307405_10013055 Ga0307405_100130552 153
255 3300031824 Ga0307413_10154681 Ga0307413_101546812 153
256 3300031824 Ga0307413_10238168 Ga0307413_102381682 153
257 3300031824 Ga0307413_10380933 Ga0307413_103809332 153
258 3300031852 Ga0307410_10004024 Ga0307410_100040243 153
259 3300031852 Ga0307410_10673791 Ga0307410_106737911 153
260 3300031901 Ga0307406_10005667 Ga0307406_100056673 153
261 3300031901 Ga0307406_10014615 Ga0307406_100146153 153
262 3300031901 Ga0307406_10745284 Ga0307406_107452842 153
263 3300031903 Ga0307407_10020869 Ga0307407_100208694 153
264 3300031903 Ga0307407_10021626 Ga0307407_100216262 153
265 3300031903 Ga0307407_10023699 Ga0307407_100236996 153
266 3300031903 Ga0307407_11088578 Ga0307407_110885781 153
267 3300031911 Ga0307412_10101892 Ga0307412_101018923 153
268 3300031911 Ga0307412_10395586 Ga0307412_103955861 153
269 3300031911 Ga0307412_10617355 Ga0307412_106173551 153
270 3300031995 Ga0307409_100017905 Ga0307409_1000179054 153
271 3300031995 Ga0307409_100122360 Ga0307409_1001223604 153
272 3300031995 Ga0307409_100214295 Ga0307409_1002142951 153
273 3300031995 Ga0307409_100333693 Ga0307409_1003336932 153
274 3300032002 Ga0307416_100055436 Ga0307416_1000554361 153
275 3300032002 Ga0307416_100388269 Ga0307416_1003882691 153
276 3300032002 Ga0307416_101522935 Ga0307416_1015229351 153
277 3300032002 Ga0307416_102414576 Ga0307416_1024145761 153
278 3300032004 Ga0307414_10003139 Ga0307414_100031395 153
279 3300032004 Ga0307414_10495298 Ga0307414_104952982 153
280 3300032004 Ga0307414_10741180 Ga0307414_107411802 153
281 3300032005 Ga0307411_10012032 Ga0307411_100120321 153
282 3300032005 Ga0307411_10077849 Ga0307411_100778491 153
283 3300032005 Ga0307411_10196897 Ga0307411_101968973 153
284 3300032005 Ga0307411_10358621 Ga0307411_103586212 153
285 3300032126 Ga0307415_100054510 Ga0307415_1000545102 153
286 3300032126 Ga0307415_100229456 Ga0307415_1002294562 153
287 3300032126 Ga0307415_100534704 Ga0307415_1005347042 153
288 3300035092 Ga0373952_0236667 Ga0373952_0236667_51_524 153
289 3300041404 Ga0439436_0120795 Ga0439436_0120795_166_627 153
290 3300041410 Ga0439461_0040943 Ga0439461_0040943_485_946 153
291 3300042007 Ga0439449_0043180 Ga0439449_0043180_1027_1488 153
292 3300042116 Ga0450912_010568 Ga0450912_010568_35_496 153
293 3300042127 Ga0450890_023009 Ga0450890_023009_38_499 153
294 3300044683 Ga0466965_0314660 Ga0466965_0314660_308_769 153
295 3300044901 Ga0466960_0365128 Ga0466960_0365128_324_785 153
296 3300046525 Ga0495663_0133665 Ga0495663_0133665_11_475 153
297 3300046616 Ga0495668_0048011 Ga0495668_0048011_1659_2132 153
298 3300048913 Ga0496110_0110014 Ga0496110_0110014_1691_2179 153
299 3300048913 Ga0496110_0799866 Ga0496110_0799866_240_701 153
300 3300048915 Ga0496112_0525786 Ga0496112_0525786_607_1068 153
301 3300048916 Ga0496113_0027262 Ga0496113_0027262_597_1058 153
302 3300048917 Ga0496114_0690330 Ga0496114_0690330_195_656 153
303 3300049592 Ga0501076_1529596 Ga0501076_1529596_27_488 153
304 3300001979 JGI24740J21852_10106973 JGI24740J21852_101069732 154
305 3300001989 JGI24739J22299_10152960 JGI24739J22299_101529602 154
306 3300001990 JGI24737J22298_10106263 JGI24737J22298_101062632 154
307 3300005327 Ga0070658_10059267 Ga0070658_100592672 154
308 3300005327 Ga0070658_10511358 Ga0070658_105113581 154
309 3300005328 Ga0070676_10754138 Ga0070676_107541381 154
310 3300005331 Ga0070670_100019959 Ga0070670_1000199591 154
311 3300005331 Ga0070670_100122737 Ga0070670_1001227372 154
312 3300005331 Ga0070670_100246964 Ga0070670_1002469642 154
313 3300005339 Ga0070660_100240538 Ga0070660_1002405382 154
314 3300005344 Ga0070661_100231650 Ga0070661_1002316502 154
315 3300005354 Ga0070675_100002994 Ga0070675_1000029944 154
316 3300005366 Ga0070659_100206487 Ga0070659_1002064872 154
317 3300005435 Ga0070714_100347311 Ga0070714_1003473112 154
318 3300005455 Ga0070663_100023854 Ga0070663_1000238542 154
319 3300005455 Ga0070663_101032170 Ga0070663_1010321701 154
320 3300005530 Ga0070679_100664433 Ga0070679_1006644331 154
321 3300005535 Ga0070684_101135795 Ga0070684_1011357951 154
322 3300005539 Ga0068853_100253092 Ga0068853_1002530922 154
323 3300005548 Ga0070665_100447768 Ga0070665_1004477682 154
324 3300005564 Ga0070664_100612499 Ga0070664_1006124992 154
325 3300013102 Ga0157371_10081180 Ga0157371_100811803 154
326 3300013105 Ga0157369_10301040 Ga0157369_103010402 154
327 3300013296 Ga0157374_10468451 Ga0157374_104684512 154
328 3300015262 Ga0182007_10290142 Ga0182007_102901421 154
329 3300025904 Ga0207647_10249783 Ga0207647_102497831 154
330 3300025909 Ga0207705_10005626 Ga0207705_100056265 154
331 3300025909 Ga0207705_10072108 Ga0207705_100721084 154
332 3300025919 Ga0207657_10001954 Ga0207657_100019544 154
333 3300025920 Ga0207649_10087524 Ga0207649_100875243 154
334 3300025921 Ga0207652_11223249 Ga0207652_112232491 154
335 3300025929 Ga0207664_10768004 Ga0207664_107680042 154
336 3300025932 Ga0207690_10088815 Ga0207690_100888152 154
337 3300026067 Ga0207678_10016599 Ga0207678_100165994 154
338 3300031731 Ga0307405_10716299 Ga0307405_107162991 154
339 3300031852 Ga0307410_10091084 Ga0307410_100910843 154
340 3300031995 Ga0307409_100057995 Ga0307409_1000579952 154
341 3300032004 Ga0307414_10349713 Ga0307414_103497132 154
342 3300032005 Ga0307411_10069599 Ga0307411_100695992 154
343 3300032005 Ga0307411_10417983 Ga0307411_104179832 154
344 3300032126 Ga0307415_100062131 Ga0307415_1000621312 154
345 3300041453 Ga0451797_1567653 Ga0451797_1567653_136_600 154
346 3300044693 Ga0466961_0140384 Ga0466961_0140384_796_1272 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16242

Pyrid_ox_like

Pyridoxamine 5'-phosphate oxidase like

39

174

0.92

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

41

127

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i02-assembly1.cif.gz_B crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8984 6 144
2hq7-assembly1.cif.gz_B crystal structure of protein related to general stress protein 26(gs26) of b.subtilis (pyridoxinephosphate oxidase family) (np_350077.1) from clostridium acetobutylicum at 2.00 a resolution 0.8717 6 146
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.8696 1 134
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8685 6 144
2i02-assembly1.cif.gz_B crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8566 6 144
ID Description Score Start End Superfamily
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8952 6 144 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8668 1 134 2.30.110.10
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8527 6 144 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.842 1 134 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8235 4 137 2.30.110.10
ID Description Score Start End GO Terms
AF-C3KNN9-F1-model_v4 General stress protein FMN-binding split barrel domain-containing protein 0.9782 1 144
AF-A0A1I5TA05-F1-model_v4 General stress protein 26 0.9771 1 144
AF-A0A838T902-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9753 1 144
AF-A0A656QPX3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9737 1 143
AF-A0A2J0YTS4-F1-model_v4 General stress protein FMN-binding split barrel domain-containing protein 0.9732 1 144

Feature Viewer

pLDDT pTM Quality
88.03 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map