F416891

General Info

Members Datasets Scaffolds Average Seq Length
346 224 692 209

Family's Representative Sequence

Representative Sequence 3300046678|Ga0495599_0165929|Ga0495599_0165929_136_855
Length 239
Sequence VLGARRCLGPGLRRGDDVKRLVILISGRGSNMAALIDAVRAGEIDAAIGTVISNRPDAAGLGIAAAAGVATSVVDHRAFADRGEFERSLIAAIDAKAPDLVVLAGFMRILSPAFVARYAGRLLNIHPSLLPAYPGVDTHRRALADGVRLHGCTVHFVTSDVDCGPIVAQAAVTVEQDDDEVALAARVLAAEHRLLVAAVRWFCSDRLSIEGSRVRVRGEIADPAVLQAPSDKATNSPPF

Samples

Sample ID Description Type Environment
1 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
118 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
119 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
120 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2902330777 Methylobacterium sp. 2A Isolate Unclassified
224 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0.29
Rhizoplane 0
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495599_0165929 3300046678 Bacteria 1364
2 Ga0070676_10010158 3300005328 Bacteria 5102
3 Ga0070690_100514989 3300005330 Bacteria 897
4 Ga0070670_100012641 3300005331 Bacteria 7226
5 Ga0070677_10000770 3300005333 Bacteria 10662
6 Ga0068869_100006931 3300005334 Bacteria 7213
7 Ga0068869_100882161 3300005334 Bacteria 773
8 Ga0070666_10036367 3300005335 Bacteria 3268
9 Ga0070680_100076567 3300005336 Bacteria 2754
10 Ga0070680_100313558 3300005336 Bacteria 1331
11 Ga0068868_100013809 3300005338 Bacteria 5935
12 Ga0070689_100000981 3300005340 Bacteria 17837
13 Ga0070689_100114983 3300005340 Bacteria 2144
14 Ga0070689_100483332 3300005340 Bacteria 1058
15 Ga0070691_10000802 3300005341 Bacteria 12542
16 Ga0070692_10566818 3300005345 Bacteria 746
17 Ga0070668_100014707 3300005347 Bacteria 5849
18 Ga0070675_100003807 3300005354 Bacteria 11454
19 Ga0070671_100489490 3300005355 Bacteria 1057
20 Ga0070674_100010476 3300005356 Bacteria 5608
21 Ga0070673_100001943 3300005364 Bacteria 12451
22 Ga0070673_100379761 3300005364 Bacteria 1260
23 Ga0070688_100104385 3300005365 Bacteria 1874
24 Ga0070667_100078248 3300005367 Bacteria 2825
25 Ga0070714_100026726 3300005435 Bacteria 4772
26 Ga0070701_10006434 3300005438 Bacteria 4943
27 Ga0070701_10449702 3300005438 Bacteria 827
28 Ga0070700_100000274 3300005441 Bacteria 27452
29 Ga0070694_100183069 3300005444 Bacteria 1551
30 Ga0070663_100210126 3300005455 Bacteria 1523
31 Ga0070678_100008505 3300005456 Bacteria 6148
32 Ga0070681_10000246 3300005458 Bacteria 43076
33 Ga0068867_100014242 3300005459 Bacteria 5634
34 Ga0070706_100077315 3300005467 Bacteria 3080
35 Ga0070707_100214984 3300005468 Bacteria 1873
36 Ga0070707_100934386 3300005468 Bacteria 832
37 Ga0070698_100123482 3300005471 Bacteria 2547
38 Ga0070698_100259811 3300005471 Bacteria 1669
39 Ga0070699_100084704 3300005518 Bacteria 2766
40 Ga0070699_100772754 3300005518 Bacteria 879
41 Ga0070679_100008427 3300005530 Bacteria 9704
42 Ga0070697_100191154 3300005536 Bacteria 1737
43 Ga0070686_100000893 3300005544 Bacteria 17324
44 Ga0070686_100535209 3300005544 Bacteria 914
45 Ga0070695_100020761 3300005545 Bacteria 4013
46 Ga0070695_100052893 3300005545 Bacteria 2611
47 Ga0070695_100175454 3300005545 Bacteria 1515
48 Ga0070695_100232453 3300005545 Bacteria 1333
49 Ga0070665_100078527 3300005548 Bacteria 3307
50 Ga0070665_100755121 3300005548 Bacteria 986
51 Ga0068856_100116711 3300005614 Bacteria 2670
52 Ga0070702_100001785 3300005615 Bacteria 8938
53 Ga0070702_100185139 3300005615 Bacteria 1366
54 Ga0070702_100300550 3300005615 Bacteria 1110
55 Ga0070702_100459225 3300005615 Bacteria 926
56 Ga0068852_100070018 3300005616 Bacteria 3076
57 Ga0068859_100010953 3300005617 Bacteria 9127
58 Ga0068859_100252062 3300005617 Bacteria 1856
59 Ga0068859_100482687 3300005617 Bacteria 1335
60 Ga0068859_100708604 3300005617 Bacteria 1097
61 Ga0068859_100755694 3300005617 Bacteria 1061
62 Ga0068859_101009800 3300005617 Bacteria 914
63 Ga0068864_100020676 3300005618 Bacteria 5508
64 Ga0068866_10033844 3300005718 Bacteria 2483
65 Ga0068861_100000767 3300005719 Bacteria 19266
66 Ga0068870_10004451 3300005840 Bacteria 6031
67 Ga0068863_100025153 3300005841 Bacteria 5677
68 Ga0068858_100029687 3300005842 Bacteria 5078
69 Ga0068858_100032536 3300005842 Bacteria 4842
70 Ga0068860_100320769 3300005843 Bacteria 1521
71 Ga0068862_100001828 3300005844 Bacteria 19287
72 Ga0070716_100296178 3300006173 Bacteria 1123
73 Ga0075362_10152581 3300006177 Bacteria 1109
74 Ga0075369_10030074 3300006186 Bacteria 2286
75 Ga0097621_100222643 3300006237 Bacteria 1645
76 Ga0075428_100000107 3300006844 Bacteria 70381
77 Ga0075433_10002934 3300006852 Bacteria 13090
78 Ga0075433_10029305 3300006852 Bacteria 4688
79 Ga0075433_10148730 3300006852 Bacteria 2083
80 Ga0075434_100001090 3300006871 Bacteria 22240
81 Ga0075434_100027592 3300006871 Bacteria 5575
82 Ga0075429_100000317 3300006880 Bacteria 34568
83 Ga0075429_100034735 3300006880 Bacteria 4382
84 Ga0068865_100020477 3300006881 Bacteria 4290
85 Ga0075436_100001604 3300006914 Bacteria 15447
86 Ga0075436_100057886 3300006914 Bacteria 2677
87 Ga0075436_100159573 3300006914 Bacteria 1589
88 Ga0097620_100010954 3300006931 Bacteria 9127
89 Ga0097620_100252089 3300006931 Bacteria 1856
90 Ga0097620_100482718 3300006931 Bacteria 1335
91 Ga0097620_100708614 3300006931 Bacteria 1097
92 Ga0097620_100755633 3300006931 Bacteria 1061
93 Ga0075435_100000229 3300007076 Bacteria 34254
94 Ga0075435_100015973 3300007076 Bacteria 5653
95 Ga0075435_100199775 3300007076 Bacteria 1694
96 Ga0099794_10113478 3300007265 Bacteria 1359
97 Ga0111539_10018067 3300009094 Bacteria 8735
98 Ga0111539_10021992 3300009094 Bacteria 7838
99 Ga0111539_10102449 3300009094 Bacteria 3360
100 Ga0105245_10000612 3300009098 Bacteria 32295
101 Ga0114129_10001717 3300009147 Bacteria 29906
102 Ga0105243_10001989 3300009148 Bacteria 17390
103 Ga0105242_10001251 3300009176 Bacteria 20029
104 Ga0105248_10071172 3300009177 Bacteria 3906
105 Ga0105249_10020387 3300009553 Bacteria 5927
106 Ga0105239_10197350 3300010375 Bacteria 2254
107 Ga0157374_10077880 3300013296 Bacteria 3139
108 Ga0157378_10000682 3300013297 Bacteria 31905
109 Ga0163162_10099873 3300013306 Bacteria 2993
110 Ga0163162_10195597 3300013306 Bacteria 2151
111 Ga0157375_10014172 3300013308 Bacteria 7107
112 Ga0163163_10372495 3300014325 Bacteria 1485
113 Ga0157380_10000298 3300014326 Bacteria 29889
114 Ga0157380_10335084 3300014326 Bacteria 1409
115 Ga0157376_10164625 3300014969 Bacteria 2014
116 Ga0207697_10013657 3300025315 Bacteria 3385
117 Ga0207656_10020984 3300025321 Bacteria 2603
118 Ga0207642_10003475 3300025899 Bacteria 4973
119 Ga0207680_10058699 3300025903 Bacteria 2333
120 Ga0207685_10058324 3300025905 Bacteria 1518
121 Ga0207645_10005558 3300025907 Bacteria 9126
122 Ga0207645_10195395 3300025907 Bacteria 1330
123 Ga0207643_10001922 3300025908 Bacteria 11479
124 Ga0207643_10012496 3300025908 Bacteria 4588
125 Ga0207660_10100768 3300025917 Bacteria 2157
126 Ga0207660_10706134 3300025917 Bacteria 823
127 Ga0207646_10019514 3300025922 Bacteria 6299
128 Ga0207646_10757979 3300025922 Bacteria 866
129 Ga0207681_10107097 3300025923 Bacteria 2027
130 Ga0207650_10239687 3300025925 Bacteria 1465
131 Ga0207659_10014778 3300025926 Bacteria 5044
132 Ga0207687_10010200 3300025927 Bacteria 6138
133 Ga0207644_10017859 3300025931 Bacteria 4797
134 Ga0207670_10032935 3300025936 Bacteria 3336
135 Ga0207670_10063129 3300025936 Bacteria 2533
136 Ga0207670_10131436 3300025936 Bacteria 1835
137 Ga0207670_10530323 3300025936 Bacteria 960
138 Ga0207669_10027274 3300025937 Bacteria 3123
139 Ga0207669_10704670 3300025937 Unclassified 830
140 Ga0207704_10310974 3300025938 Bacteria 1211
141 Ga0207691_10000030 3300025940 Bacteria 119013
142 Ga0207711_10044207 3300025941 Bacteria 3802
143 Ga0207689_10000527 3300025942 Bacteria 36304
144 Ga0207689_10752618 3300025942 Bacteria 822
145 Ga0207651_10033543 3300025960 Bacteria 3312
146 Ga0207651_10508631 3300025960 Bacteria 1042
147 Ga0207677_10034308 3300026023 Bacteria 3284
148 Ga0207703_10042579 3300026035 Bacteria 3642
149 Ga0207703_10617828 3300026035 Bacteria 1026
150 Ga0207639_10016373 3300026041 Bacteria 5245
151 Ga0207708_10000314 3300026075 Bacteria 38228
152 Ga0207702_10157498 3300026078 Bacteria 2071
153 Ga0207641_10157737 3300026088 Bacteria 2060
154 Ga0207641_10405515 3300026088 Bacteria 1310
155 Ga0207648_10000437 3300026089 Bacteria 46093
156 Ga0207648_10009533 3300026089 Bacteria 9290
157 Ga0207676_10030973 3300026095 Bacteria 4020
158 Ga0207675_100000118 3300026118 Bacteria 64796
159 Ga0207683_10000019 3300026121 Bacteria 119524
160 Ga0207683_10012860 3300026121 Bacteria 7143
161 Ga0209981_1016823 3300027378 Bacteria 1030
162 Ga0210000_1000758 3300027462 Bacteria 4465
163 Ga0209588_1006348 3300027671 Bacteria 3432
164 Ga0207428_10000179 3300027907 Bacteria 88854
165 Ga0268266_10604917 3300028379 Bacteria 1053
166 Ga0265314_10030896 3300031711 Bacteria 3961
167 Ga0307416_100448988 3300032002 Bacteria 1341
168 Ga0307411_10399369 3300032005 Bacteria 1136
169 Ga0373930_0011429 3300034816 Bacteria 1602
170 Ga0373948_0004699 3300034817 Bacteria 2176
171 Ga0373958_0004214 3300034819 Bacteria 2118
172 Ga0373928_0015143 3300035084 Bacteria 1566
173 Ga0373929_0013878 3300035085 Bacteria 1550
174 Ga0373934_0000091 3300035086 Bacteria 31467
175 Ga0373949_0006042 3300035090 Bacteria 2680
176 Ga0373951_0038315 3300035091 Bacteria 1149
177 Ga0373952_0019068 3300035092 Bacteria 1424
178 Ga0373932_0007642 3300035112 Bacteria 2577
179 Ga0373941_0013049 3300035115 Bacteria 2188
180 Ga0373953_0014053 3300035117 Bacteria 2872
181 Ga0373954_0000036 3300035118 Bacteria 50537
182 Ga0373960_0013869 3300035121 Bacteria 2030
183 Ga0373955_0008340 3300035172 Bacteria 4809
184 Ga0373955_0035013 3300035172 Bacteria 2656
185 Ga0373942_0005366 3300035207 Bacteria 2975
186 Ga0373961_0010507 3300035241 Bacteria 2282
187 Ga0373962_0065552 3300035242 Bacteria 1075
188 Ga0316574_0125855 3300035398 Bacteria 1647
189 Ga0373931_0010935 3300035691 Bacteria 4372
190 Ga0373931_0099613 3300035691 Bacteria 1632
191 Ga0373927_0096272 3300035695 Bacteria 1924
192 Ga0373933_0001319 3300035724 Bacteria 14586
193 Ga0373933_0616025 3300035724 Bacteria 713
194 Ga0373937_0001593 3300036401 Bacteria 19081
195 Ga0373937_0002261 3300036401 Bacteria 16073
196 Ga0373937_0004489 3300036401 Bacteria 11856
197 Ga0373937_0112710 3300036401 Bacteria 2530
198 Ga0373925_0150675 3300037068 Bacteria 1826
199 Ga0395900_0170269 3300037418 Bacteria 2218
200 Ga0436365_1160466 3300039437 Bacteria 817
201 Ga0439441_004943 3300042001 Bacteria 2045
202 Ga0439446_0044506 3300042156 Bacteria 1314
203 Ga0439434_0049311 3300042435 Bacteria 1303
204 Ga0451577_0104895 3300042876 Bacteria 2526
205 Ga0453684_0041584 3300044712 Bacteria 6213
206 Ga0466968_0043194 3300044735 Bacteria 1907
207 Ga0451576_0045855 3300045051 Bacteria 4602
208 Ga0451576_0050037 3300045051 Bacteria 4385
209 Ga0451576_0141202 3300045051 Bacteria 2511
210 Ga0495592_0001147 3300046454 Bacteria 18407
211 Ga0495592_0001600 3300046454 Bacteria 15847
212 Ga0495629_0454401 3300046459 Bacteria 867
213 Ga0495641_0041864 3300046461 Bacteria 2126
214 Ga0495651_0001982 3300046462 Bacteria 15869
215 Ga0495651_0333082 3300046462 Bacteria 1008
216 Ga0495653_0046568 3300046463 Bacteria 3358
217 Ga0495582_0270044 3300046473 Bacteria 976
218 Ga0495639_0341584 3300046475 Bacteria 751
219 Ga0495662_0005281 3300046476 Bacteria 6470
220 Ga0495608_0000167 3300046511 Bacteria 46550
221 Ga0495608_0115860 3300046511 Archaea 1720
222 Ga0495618_0022903 3300046514 Bacteria 3859
223 Ga0495628_0001379 3300046516 Bacteria 22286
224 Ga0495628_0003674 3300046516 Bacteria 13697
225 Ga0495630_0001186 3300046517 Bacteria 17967
226 Ga0495630_0013349 3300046517 Bacteria 5979
227 Ga0495630_0139407 3300046517 Bacteria 1844
228 Ga0495666_0009656 3300046526 Bacteria 4823
229 Ga0495666_0201569 3300046526 Bacteria 915
230 Ga0495652_0005059 3300046529 Bacteria 12483
231 Ga0495652_0029081 3300046529 Bacteria 4855
232 Ga0495640_0000309 3300046533 Bacteria 33726
233 Ga0495640_0109110 3300046533 Bacteria 1810
234 Ga0495586_0000827 3300046535 Bacteria 17795
235 Ga0495586_0024835 3300046535 Bacteria 3205
236 Ga0495587_0075353 3300046536 Bacteria 1959
237 Ga0495645_0002191 3300046543 Bacteria 13279
238 Ga0495645_0308892 3300046543 Bacteria 1030
239 Ga0495667_0013639 3300046559 Bacteria 5494
240 Ga0495667_0044838 3300046559 Bacteria 2928
241 Ga0495634_0005562 3300046642 Bacteria 9670
242 Ga0495635_0008960 3300046663 Bacteria 6985
243 Ga0495599_0000258 3300046678 Bacteria 33541
244 Ga0495599_0002399 3300046678 Bacteria 10897
245 Ga0495658_0018613 3300046683 Bacteria 3613
246 Ga0495613_0002922 3300046689 Bacteria 12811
247 Ga0495624_0434586 3300046690 Bacteria 787
248 Ga0495600_0010616 3300046809 Bacteria 5722
249 Ga0495600_0321609 3300046809 Bacteria 973
250 Ga0495604_0002023 3300047317 Bacteria 16355
251 Ga0495636_0043485 3300047318 Unclassified 1869
252 Ga0495680_0001124 3300047322 Bacteria 29512
253 Ga0495680_0065611 3300047322 Bacteria 2780
254 Ga0495593_0085897 3300047673 Bacteria 1623
255 Ga0496118_0227381 3300048921 Bacteria 1080
256 Ga0496118_0235442 3300048921 Bacteria 1053
257 Ga0501031_0012306 3300049568 Bacteria 5578
258 Ga0501031_0708852 3300049568 Bacteria 646
259 Ga0501033_0003107 3300049570 Bacteria 13782
260 Ga0501034_0000444 3300049571 Bacteria 68426
261 Ga0501034_0140856 3300049571 Bacteria 2391
262 Ga0501036_0001097 3300049572 Bacteria 20530
263 Ga0501037_0010133 3300049573 Bacteria 6917
264 Ga0501038_0000972 3300049574 Bacteria 25704
265 Ga0501038_0358115 3300049574 Bacteria 1135
266 Ga0501039_0000686 3300049575 Bacteria 24376
267 Ga0501040_0000627 3300049576 Bacteria 21539
268 Ga0501041_0000061 3300049577 Bacteria 40487
269 Ga0501041_0022472 3300049577 Bacteria 3777
270 Ga0501041_0642492 3300049577 Bacteria 678
271 Ga0501042_0002672 3300049578 Bacteria 10976
272 Ga0501042_0063913 3300049578 Bacteria 2630
273 Ga0501042_0291144 3300049578 Bacteria 1179
274 Ga0501043_0038919 3300049579 Bacteria 3739
275 Ga0501046_0002154 3300049580 Bacteria 18584
276 Ga0501046_0183165 3300049580 Bacteria 1565
277 Ga0501047_0016231 3300049581 Bacteria 7104
278 Ga0501047_0355560 3300049581 Bacteria 1301
279 Ga0501048_0000204 3300049582 Bacteria 38757
280 Ga0501048_0031390 3300049582 Bacteria 3842
281 Ga0501068_0000307 3300049584 Bacteria 24543
282 Ga0501068_0026164 3300049584 Bacteria 3436
283 Ga0501069_0046696 3300049585 Bacteria 2403
284 Ga0501070_0001974 3300049586 Bacteria 18103
285 Ga0501070_0196161 3300049586 Bacteria 1658
286 Ga0501070_0625227 3300049586 Bacteria 857
287 Ga0501071_0000332 3300049587 Bacteria 22804
288 Ga0501072_0003148 3300049588 Bacteria 12416
289 Ga0501072_0011642 3300049588 Bacteria 6719
290 Ga0501072_0029323 3300049588 Bacteria 4298
291 Ga0501073_0000898 3300049589 Bacteria 21350
292 Ga0501073_0025893 3300049589 Bacteria 4203
293 Ga0501074_0005475 3300049590 Bacteria 9135
294 Ga0501074_0011937 3300049590 Bacteria 6316
295 Ga0501074_0258607 3300049590 Bacteria 1238
296 Ga0501075_0001008 3300049591 Bacteria 18004
297 Ga0501075_0058711 3300049591 Bacteria 2897
298 Ga0501075_0327329 3300049591 Bacteria 1168
299 Ga0501076_0000301 3300049592 Bacteria 30794
300 Ga0501076_0074484 3300049592 Bacteria 2720
301 Ga0501077_0000664 3300049593 Bacteria 20826
302 Ga0501079_0001433 3300049741 Bacteria 16836
303 Ga0501079_0327571 3300049741 Bacteria 1199
304 Ga0501079_0609806 3300049741 Bacteria 859
305 Ga0501079_0899243 3300049741 Bacteria 697
306 Ga0501080_0001696 3300049742 Bacteria 18787
307 Ga0501080_0009280 3300049742 Bacteria 8970
308 Ga0501081_0000061 3300049743 Bacteria 42076
309 Ga0501081_0031606 3300049743 Bacteria 3588
310 Ga0501083_0037790 3300049744 Bacteria 3286
311 Ga0501035_0006914 3300049822 Bacteria 10596
312 Ga0501044_0045943 3300049823 Bacteria 4523
313 Ga0501044_0083258 3300049823 Bacteria 3236
314 Ga0501044_0149395 3300049823 Bacteria 2320
315 Ga0501045_0001390 3300049824 Bacteria 16149
316 nmdc:mga03683_131603_c1 3300050489 Bacteria 1119
317 nmdc:mga05p37_1373_c1 3300050507 Bacteria 28308
318 nmdc:mga09592_369_c1 3300050508 Bacteria 32912
319 nmdc:mga0qj67_280506_c1 3300050509 Bacteria 1350
320 nmdc:mga08y16_3865_c1 3300050511 Bacteria 15580
321 nmdc:mga08y16_68743_c1 3300050511 Bacteria 3693
322 nmdc:mga08y16_98554_c1 3300050511 Bacteria 3044
323 nmdc:mga0n895_26979_c1 3300050512 Bacteria 5449
324 nmdc:mga0n895_272_c1 3300050512 Bacteria 33829
325 nmdc:mga0rr50_394818_c1 3300050513 Bacteria 1168
326 nmdc:mga0rr50_65_c1 3300050513 Bacteria 62915
327 nmdc:mga0rr50_8643_c1 3300050513 Bacteria 6348
328 nmdc:mga08x19_1138_c1 3300050514 Bacteria 16598
329 nmdc:mga08x19_127723_c1 3300050514 Bacteria 1708
330 nmdc:mga08x19_26212_c1 3300050514 Bacteria 3636
331 nmdc:mga08x19_48163_c1 3300050514 Bacteria 2730
332 nmdc:mga08x19_62271_c1 3300050514 Bacteria 2419
333 nmdc:mga0a205_154835_c1 3300050515 Bacteria 2190
334 nmdc:mga0a205_17312_c1 3300050515 Bacteria 6752
335 nmdc:mga0a205_38_c1 3300050515 Bacteria 73135
336 Ga0495601_0012405 3300053077 Bacteria 5113
337 Ga0501084_0000706 3300054114 Bacteria 25545
338 Ga0501084_0299869 3300054114 Bacteria 1357
339 Ga0501082_0000471 3300060353 Bacteria 35550
340 Ga0501082_0047966 3300060353 Bacteria 3681
341 Ga0501082_0255269 3300060353 Bacteria 1525
342 Ga0501082_0319395 3300060353 Bacteria 1353
343 Ga0530510_0000947 3300061734 Bacteria 19139
344 Ga0530510_0198130 3300061734 Bacteria 1491
345 2902332000 2902330777 Bacteria 6395352
346 643603178 643348564 Bacteria 8839022
347 Ga0495599_0165929
348 Ga0070676_10010158
349 Ga0070690_100514989
350 Ga0070670_100012641
351 Ga0070677_10000770
352 Ga0068869_100006931
353 Ga0068869_100882161
354 Ga0070666_10036367
355 Ga0070680_100076567
356 Ga0070680_100313558
357 Ga0068868_100013809
358 Ga0070689_100000981
359 Ga0070689_100114983
360 Ga0070689_100483332
361 Ga0070691_10000802
362 Ga0070692_10566818
363 Ga0070668_100014707
364 Ga0070675_100003807
365 Ga0070671_100489490
366 Ga0070674_100010476
367 Ga0070673_100001943
368 Ga0070673_100379761
369 Ga0070688_100104385
370 Ga0070667_100078248
371 Ga0070714_100026726
372 Ga0070701_10006434
373 Ga0070701_10449702
374 Ga0070700_100000274
375 Ga0070694_100183069
376 Ga0070663_100210126
377 Ga0070678_100008505
378 Ga0070681_10000246
379 Ga0068867_100014242
380 Ga0070706_100077315
381 Ga0070707_100214984
382 Ga0070707_100934386
383 Ga0070698_100123482
384 Ga0070698_100259811
385 Ga0070699_100084704
386 Ga0070699_100772754
387 Ga0070679_100008427
388 Ga0070697_100191154
389 Ga0070686_100000893
390 Ga0070686_100535209
391 Ga0070695_100020761
392 Ga0070695_100052893
393 Ga0070695_100175454
394 Ga0070695_100232453
395 Ga0070665_100078527
396 Ga0070665_100755121
397 Ga0068856_100116711
398 Ga0070702_100001785
399 Ga0070702_100185139
400 Ga0070702_100300550
401 Ga0070702_100459225
402 Ga0068852_100070018
403 Ga0068859_100010953
404 Ga0068859_100252062
405 Ga0068859_100482687
406 Ga0068859_100708604
407 Ga0068859_100755694
408 Ga0068859_101009800
409 Ga0068864_100020676
410 Ga0068866_10033844
411 Ga0068861_100000767
412 Ga0068870_10004451
413 Ga0068863_100025153
414 Ga0068858_100029687
415 Ga0068858_100032536
416 Ga0068860_100320769
417 Ga0068862_100001828
418 Ga0070716_100296178
419 Ga0075362_10152581
420 Ga0075369_10030074
421 Ga0097621_100222643
422 Ga0075428_100000107
423 Ga0075433_10002934
424 Ga0075433_10029305
425 Ga0075433_10148730
426 Ga0075434_100001090
427 Ga0075434_100027592
428 Ga0075429_100000317
429 Ga0075429_100034735
430 Ga0068865_100020477
431 Ga0075436_100001604
432 Ga0075436_100057886
433 Ga0075436_100159573
434 Ga0097620_100010954
435 Ga0097620_100252089
436 Ga0097620_100482718
437 Ga0097620_100708614
438 Ga0097620_100755633
439 Ga0075435_100000229
440 Ga0075435_100015973
441 Ga0075435_100199775
442 Ga0099794_10113478
443 Ga0111539_10018067
444 Ga0111539_10021992
445 Ga0111539_10102449
446 Ga0105245_10000612
447 Ga0114129_10001717
448 Ga0105243_10001989
449 Ga0105242_10001251
450 Ga0105248_10071172
451 Ga0105249_10020387
452 Ga0105239_10197350
453 Ga0157374_10077880
454 Ga0157378_10000682
455 Ga0163162_10099873
456 Ga0163162_10195597
457 Ga0157375_10014172
458 Ga0163163_10372495
459 Ga0157380_10000298
460 Ga0157380_10335084
461 Ga0157376_10164625
462 Ga0207697_10013657
463 Ga0207656_10020984
464 Ga0207642_10003475
465 Ga0207680_10058699
466 Ga0207685_10058324
467 Ga0207645_10005558
468 Ga0207645_10195395
469 Ga0207643_10001922
470 Ga0207643_10012496
471 Ga0207660_10100768
472 Ga0207660_10706134
473 Ga0207646_10019514
474 Ga0207646_10757979
475 Ga0207681_10107097
476 Ga0207650_10239687
477 Ga0207659_10014778
478 Ga0207687_10010200
479 Ga0207644_10017859
480 Ga0207670_10032935
481 Ga0207670_10063129
482 Ga0207670_10131436
483 Ga0207670_10530323
484 Ga0207669_10027274
485 Ga0207669_10704670
486 Ga0207704_10310974
487 Ga0207691_10000030
488 Ga0207711_10044207
489 Ga0207689_10000527
490 Ga0207689_10752618
491 Ga0207651_10033543
492 Ga0207651_10508631
493 Ga0207677_10034308
494 Ga0207703_10042579
495 Ga0207703_10617828
496 Ga0207639_10016373
497 Ga0207708_10000314
498 Ga0207702_10157498
499 Ga0207641_10157737
500 Ga0207641_10405515
501 Ga0207648_10000437
502 Ga0207648_10009533
503 Ga0207676_10030973
504 Ga0207675_100000118
505 Ga0207683_10000019
506 Ga0207683_10012860
507 Ga0209981_1016823
508 Ga0210000_1000758
509 Ga0209588_1006348
510 Ga0207428_10000179
511 Ga0268266_10604917
512 Ga0265314_10030896
513 Ga0307416_100448988
514 Ga0307411_10399369
515 Ga0373930_0011429
516 Ga0373948_0004699
517 Ga0373958_0004214
518 Ga0373928_0015143
519 Ga0373929_0013878
520 Ga0373934_0000091
521 Ga0373949_0006042
522 Ga0373951_0038315
523 Ga0373952_0019068
524 Ga0373932_0007642
525 Ga0373941_0013049
526 Ga0373953_0014053
527 Ga0373954_0000036
528 Ga0373960_0013869
529 Ga0373955_0008340
530 Ga0373955_0035013
531 Ga0373942_0005366
532 Ga0373961_0010507
533 Ga0373962_0065552
534 Ga0316574_0125855
535 Ga0373931_0010935
536 Ga0373931_0099613
537 Ga0373927_0096272
538 Ga0373933_0001319
539 Ga0373933_0616025
540 Ga0373937_0001593
541 Ga0373937_0002261
542 Ga0373937_0004489
543 Ga0373937_0112710
544 Ga0373925_0150675
545 Ga0395900_0170269
546 Ga0436365_1160466
547 Ga0439441_004943
548 Ga0439446_0044506
549 Ga0439434_0049311
550 Ga0451577_0104895
551 Ga0453684_0041584
552 Ga0466968_0043194
553 Ga0451576_0045855
554 Ga0451576_0050037
555 Ga0451576_0141202
556 Ga0495592_0001147
557 Ga0495592_0001600
558 Ga0495629_0454401
559 Ga0495641_0041864
560 Ga0495651_0001982
561 Ga0495651_0333082
562 Ga0495653_0046568
563 Ga0495582_0270044
564 Ga0495639_0341584
565 Ga0495662_0005281
566 Ga0495608_0000167
567 Ga0495608_0115860
568 Ga0495618_0022903
569 Ga0495628_0001379
570 Ga0495628_0003674
571 Ga0495630_0001186
572 Ga0495630_0013349
573 Ga0495630_0139407
574 Ga0495666_0009656
575 Ga0495666_0201569
576 Ga0495652_0005059
577 Ga0495652_0029081
578 Ga0495640_0000309
579 Ga0495640_0109110
580 Ga0495586_0000827
581 Ga0495586_0024835
582 Ga0495587_0075353
583 Ga0495645_0002191
584 Ga0495645_0308892
585 Ga0495667_0013639
586 Ga0495667_0044838
587 Ga0495634_0005562
588 Ga0495635_0008960
589 Ga0495599_0000258
590 Ga0495599_0002399
591 Ga0495658_0018613
592 Ga0495613_0002922
593 Ga0495624_0434586
594 Ga0495600_0010616
595 Ga0495600_0321609
596 Ga0495604_0002023
597 Ga0495636_0043485
598 Ga0495680_0001124
599 Ga0495680_0065611
600 Ga0495593_0085897
601 Ga0496118_0227381
602 Ga0496118_0235442
603 Ga0501031_0012306
604 Ga0501031_0708852
605 Ga0501033_0003107
606 Ga0501034_0000444
607 Ga0501034_0140856
608 Ga0501036_0001097
609 Ga0501037_0010133
610 Ga0501038_0000972
611 Ga0501038_0358115
612 Ga0501039_0000686
613 Ga0501040_0000627
614 Ga0501041_0000061
615 Ga0501041_0022472
616 Ga0501041_0642492
617 Ga0501042_0002672
618 Ga0501042_0063913
619 Ga0501042_0291144
620 Ga0501043_0038919
621 Ga0501046_0002154
622 Ga0501046_0183165
623 Ga0501047_0016231
624 Ga0501047_0355560
625 Ga0501048_0000204
626 Ga0501048_0031390
627 Ga0501068_0000307
628 Ga0501068_0026164
629 Ga0501069_0046696
630 Ga0501070_0001974
631 Ga0501070_0196161
632 Ga0501070_0625227
633 Ga0501071_0000332
634 Ga0501072_0003148
635 Ga0501072_0011642
636 Ga0501072_0029323
637 Ga0501073_0000898
638 Ga0501073_0025893
639 Ga0501074_0005475
640 Ga0501074_0011937
641 Ga0501074_0258607
642 Ga0501075_0001008
643 Ga0501075_0058711
644 Ga0501075_0327329
645 Ga0501076_0000301
646 Ga0501076_0074484
647 Ga0501077_0000664
648 Ga0501079_0001433
649 Ga0501079_0327571
650 Ga0501079_0609806
651 Ga0501079_0899243
652 Ga0501080_0001696
653 Ga0501080_0009280
654 Ga0501081_0000061
655 Ga0501081_0031606
656 Ga0501083_0037790
657 Ga0501035_0006914
658 Ga0501044_0045943
659 Ga0501044_0083258
660 Ga0501044_0149395
661 Ga0501045_0001390
662 nmdc:mga03683_131603_c1
663 nmdc:mga05p37_1373_c1
664 nmdc:mga09592_369_c1
665 nmdc:mga0qj67_280506_c1
666 nmdc:mga08y16_3865_c1
667 nmdc:mga08y16_68743_c1
668 nmdc:mga08y16_98554_c1
669 nmdc:mga0n895_26979_c1
670 nmdc:mga0n895_272_c1
671 nmdc:mga0rr50_394818_c1
672 nmdc:mga0rr50_65_c1
673 nmdc:mga0rr50_8643_c1
674 nmdc:mga08x19_1138_c1
675 nmdc:mga08x19_127723_c1
676 nmdc:mga08x19_26212_c1
677 nmdc:mga08x19_48163_c1
678 nmdc:mga08x19_62271_c1
679 nmdc:mga0a205_154835_c1
680 nmdc:mga0a205_17312_c1
681 nmdc:mga0a205_38_c1
682 Ga0495601_0012405
683 Ga0501084_0000706
684 Ga0501084_0299869
685 Ga0501082_0000471
686 Ga0501082_0047966
687 Ga0501082_0255269
688 Ga0501082_0319395
689 Ga0530510_0000947
690 Ga0530510_0198130
691 2902332000
692 643603178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

19

199

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.978 5 201
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9761 3 201
1men-assembly1.cif.gz_A complex structure of human gar tfase and substrate beta-gar 0.9694 4 201
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9693 3 202
5j9f-assembly2.cif.gz_A human gar transformylase in complex with gar and (4-{[2-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)ethyl]amino}benzoyl)-l-glutamic acid (agf183) 0.9688 4 201
ID Description Score Start End Superfamily
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9761 3 201 3.40.50.170
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9753 3 190 3.40.50.170
1njsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9676 4 201 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9653 5 202 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9569 3 185 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A832K7A1-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9919 4 190 GO:0004644
GO:0005829
GO:0006189
AF-A0A450T9D9-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9915 3 184 GO:0004644
GO:0005829
GO:0006189
AF-A0A3C0KBB1-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9902 102 184 GO:0004644
GO:0005829
GO:0006189
AF-A0A658AGP0-F1-model_v4 deleted 0.9871 4 203
AF-A0A090QZB5-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9871 3 158 GO:0004644
GO:0005829
GO:0006189

Map