F416879

General Info

Members Datasets Scaffolds Average Seq Length
346 209 337 187

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0099591|Ga0495662_0099591_153_791
Length 212
Sequence MICGSLRKGSFNRALMNALPALAPADMKLTEAPSFRGFPLYDADLQAKGFPPDVTALADAIRAADAVIIITPEYNYSIPGALKNAIDWVSRLPDQPFKEKPVAIQSATGGPLGGARMQYHLRQAMIFLNAFSFGTPEIFVGQAPTKFDEKTLELKDEITKKLVAQQLAGYGKCKKSPRRWSCRRLDRRATQGRRPVYPSVAAPCRQKKPTPT

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
3 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
4 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
5 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
6 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 0.29
Rhizoplane 5.78
Rhizosphere 82.66
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10159444 3300003322 Bacteria 2206
2 Ga0070658_10733565 3300005327 Bacteria 858
3 Ga0070680_100046237 3300005336 Bacteria 3540
4 Ga0070682_100024286 3300005337 Bacteria 3605
5 Ga0070689_100099438 3300005340 Bacteria 2301
6 Ga0070675_101033361 3300005354 Bacteria 755
7 Ga0070659_100276511 3300005366 Bacteria 1396
8 Ga0070709_10008744 3300005434 Bacteria 5570
9 Ga0070714_100819893 3300005435 Bacteria 902
10 Ga0070713_100135616 3300005436 Bacteria 2175
11 Ga0070711_100419079 3300005439 Bacteria 1091
12 Ga0070705_100076151 3300005440 Bacteria 2045
13 Ga0070708_100669622 3300005445 Bacteria 977
14 Ga0070662_100130556 3300005457 Bacteria 1936
15 Ga0070681_10342435 3300005458 Bacteria 1405
16 Ga0070685_10206893 3300005466 Bacteria 1279
17 Ga0070706_100275783 3300005467 Bacteria 1569
18 Ga0070707_100117161 3300005468 Bacteria 2585
19 Ga0070699_100001766 3300005518 Bacteria 19714
20 Ga0070699_100066540 3300005518 Bacteria 3128
21 Ga0070699_100412835 3300005518 Bacteria 1221
22 Ga0070679_100030615 3300005530 Bacteria 5313
23 Ga0070679_100157263 3300005530 Bacteria 2247
24 Ga0070693_100315321 3300005547 Unclassified 1059
25 Ga0070693_100412308 3300005547 Bacteria 939
26 Ga0070704_100860124 3300005549 Unclassified 813
27 Ga0068855_100173776 3300005563 Bacteria 2439
28 Ga0070702_100775415 3300005615 Bacteria 739
29 Ga0068863_101083162 3300005841 Bacteria 806
30 Ga0068860_100378553 3300005843 Bacteria 1397
31 Ga0068860_100590513 3300005843 Unclassified 1115
32 Ga0081455_10000896 3300005937 Bacteria 38413
33 Ga0081455_10021572 3300005937 Bacteria 6038
34 Ga0081538_10078279 3300005981 Bacteria 1775
35 Ga0081540_1001528 3300005983 Bacteria 19885
36 Ga0081540_1008359 3300005983 Bacteria 7232
37 Ga0070717_10085473 3300006028 Bacteria 2655
38 Ga0075364_10063874 3300006051 Bacteria 2417
39 Ga0070715_10042928 3300006163 Bacteria 1903
40 Ga0070716_100025148 3300006173 Bacteria 3174
41 Ga0075362_10008292 3300006177 Bacteria 3968
42 Ga0075367_10055480 3300006178 Bacteria 2352
43 Ga0075366_10002248 3300006195 Bacteria 9870
44 Ga0075370_10018173 3300006353 Bacteria 3810
45 Ga0075370_10036114 3300006353 Bacteria 2775
46 Ga0075370_10057558 3300006353 Bacteria 2209
47 Ga0075428_100028276 3300006844 Bacteria 6201
48 Ga0075434_100024816 3300006871 Bacteria 5861
49 Ga0075429_100327324 3300006880 Bacteria 1341
50 Ga0068865_100525178 3300006881 Unclassified 990
51 Ga0075436_100660215 3300006914 Bacteria 773
52 Ga0099794_10175396 3300007265 Bacteria 1093
53 Ga0111539_12136894 3300009094 Bacteria 650
54 Ga0105245_10489972 3300009098 Bacteria 1244
55 Ga0105245_10576747 3300009098 Bacteria 1149
56 Ga0114129_10106557 3300009147 Bacteria 3872
57 Ga0099796_10125707 3300010159 Bacteria 990
58 Ga0157373_10033003 3300013100 Bacteria 3726
59 Ga0157370_10122272 3300013104 Bacteria 2430
60 Ga0157378_10435293 3300013297 Bacteria 1299
61 Ga0163162_10806514 3300013306 Bacteria 1056
62 Ga0157375_10506897 3300013308 Bacteria 1371
63 Ga0157375_11026739 3300013308 Bacteria 963
64 Ga0157379_10965015 3300014968 Bacteria 811
65 Ga0213876_10048152 3300021384 Bacteria 2253
66 Ga0213875_10003368 3300021388 Bacteria 9109
67 Ga0207692_10794085 3300025898 Bacteria 619
68 Ga0207699_10503011 3300025906 Bacteria 875
69 Ga0207693_10042623 3300025915 Bacteria 3572
70 Ga0207693_10202566 3300025915 Bacteria 1561
71 Ga0207663_10121889 3300025916 Bacteria 1787
72 Ga0207662_10075085 3300025918 Bacteria 2053
73 Ga0207652_10093841 3300025921 Bacteria 2641
74 Ga0207652_10970345 3300025921 Unclassified 748
75 Ga0207687_10442330 3300025927 Bacteria 1077
76 Ga0207690_10203948 3300025932 Bacteria 1504
77 Ga0207706_10122464 3300025933 Bacteria 2288
78 Ga0207670_10316267 3300025936 Bacteria 1227
79 Ga0207665_10016058 3300025939 Bacteria 4917
80 Ga0207703_10723603 3300026035 Bacteria 947
81 Ga0207675_100782656 3300026118 Bacteria 966
82 Ga0209179_1012214 3300027512 Bacteria 1539
83 Ga0265332_10001808 3300031238 Bacteria 11498
84 Ga0265329_10234743 3300031242 Bacteria 609
85 Ga0265340_10001397 3300031247 Bacteria 13847
86 Ga0265339_10000643 3300031249 Bacteria 26946
87 Ga0265331_10013242 3300031250 Bacteria 4443
88 Ga0307513_10503512 3300031456 Unclassified 928
89 Ga0265314_10050676 3300031711 Bacteria 2896
90 Ga0265342_10000179 3300031712 Bacteria 70615
91 Ga0307510_10038031 3300033180 Bacteria 5326
92 Ga0373923_0004478 3300035111 Bacteria 4639
93 Ga0373923_0227014 3300035111 Bacteria 869
94 Ga0373923_0385209 3300035111 Bacteria 673
95 Ga0373932_0231415 3300035112 Bacteria 668
96 Ga0373936_0026867 3300035113 Bacteria 2256
97 Ga0373941_0001631 3300035115 Bacteria 4781
98 Ga0373945_0096243 3300035116 Bacteria 1153
99 Ga0373945_0263080 3300035116 Bacteria 731
100 Ga0373953_0001929 3300035117 Bacteria 6160
101 Ga0373954_0000930 3300035118 Bacteria 11373
102 Ga0373956_0114953 3300035119 Bacteria 1254
103 Ga0373943_0001834 3300035170 Bacteria 9608
104 Ga0373943_0028932 3300035170 Bacteria 2615
105 Ga0373946_0003213 3300035171 Bacteria 5801
106 Ga0373955_0012970 3300035172 Bacteria 4018
107 Ga0373924_0000784 3300035410 Bacteria 9886
108 Ga0373924_0179663 3300035410 Bacteria 931
109 Ga0373935_0000038 3300035692 Bacteria 51446
110 Ga0373935_0015885 3300035692 Bacteria 4557
111 Ga0373935_0108126 3300035692 Bacteria 1842
112 Ga0373935_0156848 3300035692 Bacteria 1549
113 Ga0373927_0338279 3300035695 Bacteria 991
114 Ga0373927_0349432 3300035695 Bacteria 974
115 Ga0373933_0010737 3300035724 Bacteria 5025
116 Ga0373933_0582576 3300035724 Bacteria 734
117 Ga0373947_0292134 3300035725 Bacteria 1085
118 Ga0373947_0312796 3300035725 Bacteria 1049
119 Ga0373937_0000004 3300036401 Bacteria 212269
120 Ga0373937_0018175 3300036401 Bacteria 6273
121 Ga0373925_0001179 3300037068 Bacteria 23100
122 Ga0373925_0014413 3300037068 Bacteria 5715
123 Ga0373925_0730269 3300037068 Bacteria 816
124 Ga0436364_0433271 3300037853 Bacteria 10547
125 Ga0436364_0834040 3300037853 Bacteria 2715
126 Ga0436364_1493907 3300037853 Bacteria 715
127 Ga0436364_1509541 3300037853 Bacteria 641
128 Ga0395901_0359204 3300038443 Bacteria 1502
129 Ga0436365_0511988 3300039437 Bacteria 1854
130 Ga0436365_1259283 3300039437 Bacteria 1690
131 Ga0436363_0797154 3300039450 Bacteria 2323
132 Ga0466957_0836550 3300044842 Bacteria 655
133 Ga0466958_0162400 3300045836 Bacteria 1412
134 Ga0495592_0000032 3300046454 Bacteria 128274
135 Ga0495603_0158547 3300046455 Bacteria 1313
136 Ga0495629_0121935 3300046459 Bacteria 1816
137 Ga0495629_0184422 3300046459 Bacteria 1445
138 Ga0495629_0397140 3300046459 Bacteria 937
139 Ga0495638_0011097 3300046460 Bacteria 6227
140 Ga0495651_0000884 3300046462 Bacteria 23329
141 Ga0495653_0000012 3300046463 Bacteria 266880
142 Ga0495662_0001158 3300046476 Bacteria 12983
143 Ga0495662_0099591 3300046476 Bacteria 1421
144 Ga0495664_0000004 3300046477 Bacteria 489411
145 Ga0495608_0000005 3300046511 Bacteria 350726
146 Ga0495618_0000006 3300046514 Bacteria 229906
147 Ga0495628_0000001 3300046516 Bacteria 917742
148 Ga0495630_0006918 3300046517 Bacteria 8083
149 Ga0495648_0339461 3300046524 Bacteria 690
150 Ga0495652_0000002 3300046529 Bacteria 946606
151 Ga0495652_0258176 3300046529 Bacteria 1288
152 Ga0495665_0063778 3300046531 Bacteria 1945
153 Ga0495665_0333109 3300046531 Bacteria 774
154 Ga0495640_0000001 3300046533 Bacteria 853827
155 Ga0495587_0000008 3300046536 Bacteria 271097
156 Ga0495645_0000002 3300046543 Bacteria 651644
157 Ga0495667_0000007 3300046559 Bacteria 234736
158 Ga0495634_0000003 3300046642 Bacteria 206222
159 Ga0495635_0000002 3300046663 Bacteria 490490
160 Ga0495635_0293280 3300046663 Bacteria 1091
161 Ga0495657_0000054 3300046675 Bacteria 99620
162 Ga0495599_0000005 3300046678 Bacteria 300169
163 Ga0495623_0000034 3300046679 Bacteria 84368
164 Ga0495646_0000002 3300046680 Bacteria 310568
165 Ga0495647_0113556 3300046681 Bacteria 1133
166 Ga0495658_0113225 3300046683 Bacteria 1633
167 Ga0495613_0062226 3300046689 Bacteria 2732
168 Ga0495613_0129771 3300046689 Bacteria 1806
169 Ga0495613_0318813 3300046689 Bacteria 1073
170 Ga0495624_0010251 3300046690 Bacteria 6460
171 Ga0495600_0000012 3300046809 Bacteria 119798
172 Ga0495600_0682284 3300046809 Bacteria 619
173 Ga0495604_0000009 3300047317 Bacteria 326341
174 Ga0495674_0000002 3300047319 Bacteria 642785
175 Ga0495674_0084348 3300047319 Bacteria 2723
176 Ga0495674_0123163 3300047319 Bacteria 2189
177 Ga0495674_0266875 3300047319 Bacteria 1405
178 Ga0495680_0001255 3300047322 Bacteria 27744
179 Ga0495683_0272797 3300047323 Unclassified 735
180 Ga0495675_0000028 3300047444 Bacteria 105848
181 Ga0495685_096763 3300047447 Bacteria 976
182 Ga0495684_0000006 3300047471 Bacteria 247568
183 Ga0495593_0007553 3300047673 Bacteria 6353
184 Ga0495602_0000005 3300048088 Bacteria 325957
185 Ga0496100_0080946 3300048903 Bacteria 2193
186 Ga0496104_0000396 3300048907 Bacteria 38158
187 Ga0496104_0163497 3300048907 Bacteria 2135
188 Ga0496104_0180869 3300048907 Bacteria 2019
189 Ga0496104_0501890 3300048907 Bacteria 1124
190 Ga0496105_0000025 3300048908 Bacteria 150594
191 Ga0496105_0039945 3300048908 Bacteria 3868
192 Ga0496105_0335802 3300048908 Bacteria 1209
193 Ga0496106_0467873 3300048909 Bacteria 1013
194 Ga0496108_0115481 3300048911 Bacteria 2299
195 Ga0496108_0502666 3300048911 Bacteria 1059
196 Ga0496110_0019217 3300048913 Bacteria 5745
197 Ga0496110_0426769 3300048913 Bacteria 1208
198 Ga0496111_0025794 3300048914 Bacteria 4147
199 Ga0496112_0412866 3300048915 Bacteria 1289
200 Ga0496112_0448011 3300048915 Bacteria 1229
201 Ga0496112_0544295 3300048915 Bacteria 1095
202 Ga0496113_0881114 3300048916 Bacteria 709
203 Ga0496115_0081885 3300048918 Bacteria 2629
204 Ga0496115_0111158 3300048918 Bacteria 2251
205 Ga0496126_0372717 3300048929 Bacteria 1164
206 Ga0501031_0014504 3300049568 Bacteria 5123
207 Ga0501031_0178371 3300049568 Bacteria 1388
208 Ga0501032_0031408 3300049569 Bacteria 3641
209 Ga0501032_0049588 3300049569 Bacteria 2832
210 Ga0501032_0070408 3300049569 Bacteria 2332
211 Ga0501032_0107097 3300049569 Bacteria 1851
212 Ga0501032_0371265 3300049569 Bacteria 920
213 Ga0501033_0002016 3300049570 Bacteria 17669
214 Ga0501033_0017366 3300049570 Bacteria 5436
215 Ga0501033_0322207 3300049570 Bacteria 1086
216 Ga0501034_0008241 3300049571 Bacteria 11033
217 Ga0501034_0051708 3300049571 Bacteria 4142
218 Ga0501034_1037987 3300049571 Bacteria 702
219 Ga0501036_0002450 3300049572 Bacteria 14542
220 Ga0501036_0012981 3300049572 Bacteria 6916
221 Ga0501036_0023855 3300049572 Bacteria 5155
222 Ga0501036_0427229 3300049572 Bacteria 1104
223 Ga0501037_0012035 3300049573 Bacteria 6371
224 Ga0501037_0031116 3300049573 Bacteria 3940
225 Ga0501037_0063582 3300049573 Bacteria 2690
226 Ga0501038_0001422 3300049574 Bacteria 21937
227 Ga0501038_0050457 3300049574 Bacteria 3594
228 Ga0501038_0072027 3300049574 Bacteria 2929
229 Ga0501038_0161827 3300049574 Bacteria 1818
230 Ga0501038_0302646 3300049574 Bacteria 1255
231 Ga0501039_0007435 3300049575 Bacteria 8360
232 Ga0501039_0014311 3300049575 Bacteria 6074
233 Ga0501039_0217974 3300049575 Bacteria 1500
234 Ga0501039_0384296 3300049575 Bacteria 1103
235 Ga0501040_0277247 3300049576 Bacteria 1197
236 Ga0501043_0000339 3300049579 Bacteria 42404
237 Ga0501043_0014744 3300049579 Bacteria 6119
238 Ga0501043_0053387 3300049579 Bacteria 3174
239 Ga0501043_0068646 3300049579 Bacteria 2783
240 Ga0501043_0097779 3300049579 Bacteria 2307
241 Ga0501046_0004739 3300049580 Bacteria 12271
242 Ga0501046_0012952 3300049580 Bacteria 7086
243 Ga0501046_0103170 3300049580 Bacteria 2186
244 Ga0501046_0259733 3300049580 Bacteria 1276
245 Ga0501047_0005364 3300049581 Bacteria 12046
246 Ga0501047_0025114 3300049581 Bacteria 5723
247 Ga0501047_0042313 3300049581 Bacteria 4402
248 Ga0501047_0139289 3300049581 Bacteria 2305
249 Ga0501047_0632429 3300049581 Bacteria 890
250 Ga0501048_0013442 3300049582 Bacteria 6075
251 Ga0501048_0210450 3300049582 Bacteria 1379
252 Ga0501067_0003490 3300049583 Bacteria 8642
253 Ga0501067_0012266 3300049583 Bacteria 4751
254 Ga0501067_0237947 3300049583 Bacteria 1013
255 Ga0501068_0005968 3300049584 Bacteria 6684
256 Ga0501068_0016328 3300049584 Bacteria 4278
257 Ga0501068_0056853 3300049584 Bacteria 2371
258 Ga0501068_0183543 3300049584 Bacteria 1323
259 Ga0501069_0000186 3300049585 Bacteria 27883
260 Ga0501069_0008358 3300049585 Bacteria 5436
261 Ga0501070_0004458 3300049586 Bacteria 12026
262 Ga0501070_0032911 3300049586 Bacteria 4336
263 Ga0501070_0060990 3300049586 Bacteria 3126
264 Ga0501070_0073441 3300049586 Bacteria 2830
265 Ga0501070_0289339 3300049586 Bacteria 1335
266 Ga0501070_0324173 3300049586 Bacteria 1252
267 Ga0501071_0009907 3300049587 Bacteria 6363
268 Ga0501071_0531149 3300049587 Bacteria 903
269 Ga0501072_0042267 3300049588 Bacteria 3580
270 Ga0501072_0157156 3300049588 Bacteria 1813
271 Ga0501073_0002376 3300049589 Bacteria 14093
272 Ga0501073_0011485 3300049589 Bacteria 6477
273 Ga0501073_0085090 3300049589 Bacteria 2200
274 Ga0501073_0094720 3300049589 Bacteria 2074
275 Ga0501073_0317755 3300049589 Bacteria 1074
276 Ga0501074_0000220 3300049590 Bacteria 31534
277 Ga0501074_0010508 3300049590 Bacteria 6719
278 Ga0501074_0056198 3300049590 Bacteria 2836
279 Ga0501074_0152873 3300049590 Bacteria 1649
280 Ga0501079_0022012 3300049741 Bacteria 4883
281 Ga0501079_0074621 3300049741 Bacteria 2622
282 Ga0501080_0001486 3300049742 Bacteria 19779
283 Ga0501080_0020779 3300049742 Bacteria 6078
284 Ga0501080_0047128 3300049742 Bacteria 4012
285 Ga0501080_0055814 3300049742 Bacteria 3678
286 Ga0501080_0158671 3300049742 Bacteria 2089
287 Ga0501081_0281077 3300049743 Bacteria 1219
288 Ga0501081_0716788 3300049743 Bacteria 751
289 Ga0501083_0010594 3300049744 Bacteria 6491
290 Ga0501083_0029581 3300049744 Bacteria 3765
291 Ga0501035_0007174 3300049822 Bacteria 10425
292 Ga0501035_0045389 3300049822 Bacteria 3953
293 Ga0501035_0073490 3300049822 Bacteria 3025
294 Ga0501044_0005685 3300049823 Bacteria 13822
295 Ga0501044_0013165 3300049823 Bacteria 8955
296 Ga0501044_0021925 3300049823 Bacteria 6811
297 Ga0501044_0106591 3300049823 Bacteria 2814
298 Ga0501044_0290359 3300049823 Bacteria 1567
299 Ga0501044_0314084 3300049823 Bacteria 1493
300 Ga0501044_0339035 3300049823 Bacteria 1424
301 Ga0501045_0029377 3300049824 Bacteria 3974
302 nmdc:mga03683_8536_c1 3300050489 Bacteria 3606
303 nmdc:mga00v17_1217_c1 3300050491 Bacteria 13509
304 nmdc:mga0yw44_593973_c1 3300050492 Bacteria 752
305 nmdc:mga0k408_170190_c2 3300050493 Bacteria 728
306 nmdc:mga0k408_492183_c1 3300050493 Bacteria 727
307 nmdc:mga0k408_735_c1 3300050493 Bacteria 17956
308 nmdc:mga06z11_52351_c1 3300050494 Bacteria 2094
309 nmdc:mga07m45_103238_c1 3300050496 Bacteria 1638
310 nmdc:mga07m45_19280_c1 3300050496 Bacteria 3694
311 nmdc:mga07m45_199072_c1 3300050496 Bacteria 1165
312 nmdc:mga05p37_1713_c1 3300050507 Bacteria 25556
313 nmdc:mga05p37_300532_c1 3300050507 Bacteria 1907
314 nmdc:mga05p37_8154_c1 3300050507 Bacteria 12382
315 nmdc:mga09592_71811_c1 3300050508 Bacteria 2938
316 nmdc:mga0n895_1007195_c1 3300050512 Bacteria 814
317 nmdc:mga0n895_214921_c1 3300050512 Bacteria 1952
318 nmdc:mga0rr50_329134_c1 3300050513 Bacteria 1282
319 nmdc:mga08x19_377042_c1 3300050514 Bacteria 993
320 nmdc:mga08x19_79178_c1 3300050514 Bacteria 2155
321 Ga0495601_0000002 3300053077 Bacteria 528704
322 Ga0495601_0185971 3300053077 Bacteria 1358
323 Ga0495601_0340875 3300053077 Bacteria 975
324 Ga0495612_0000010 3300053078 Bacteria 227618
325 Ga0495595_0000026 3300053084 Bacteria 99949
326 Ga0495619_0000019 3300053085 Bacteria 209518
327 Ga0500578_0160339 3300053086 Unclassified 1396
328 Ga0500641_0010606 3300053096 Bacteria 3334
329 Ga0500604_0007516 3300053151 Bacteria 2886
330 Ga0500622_0003134 3300053156 Bacteria 11350
331 Ga0500599_031372 3300053736 Bacteria 792
332 Ga0501084_0006870 3300054114 Bacteria 9368
333 Ga0501082_0006019 3300060353 Bacteria 10518
334 Ga0501082_0038073 3300060353 Bacteria 4148
335 Ga0501082_0115690 3300060353 Bacteria 2323
336 Ga0501082_0857636 3300060353 Bacteria 794
337 Ga0501082_1017874 3300060353 Bacteria 724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0019217 Ga0496110_0019217_5220_5711 139
2 3300037853 Ga0436364_1493907 Ga0436364_1493907_21_491 154
3 3300035410 Ga0373924_0179663 Ga0373924_0179663_326_859 172
4 3300025915 Ga0207693_10202566 Ga0207693_102025662 179
5 3300035111 Ga0373923_0227014 Ga0373923_0227014_38_577 179
6 3300035116 Ga0373945_0096243 Ga0373945_0096243_261_800 179
7 3300035170 Ga0373943_0028932 Ga0373943_0028932_1774_2313 179
8 3300035692 Ga0373935_0108126 Ga0373935_0108126_1265_1804 179
9 3300035695 Ga0373927_0338279 Ga0373927_0338279_177_716 179
10 3300035725 Ga0373947_0292134 Ga0373947_0292134_485_1024 179
11 3300037068 Ga0373925_0014413 Ga0373925_0014413_3336_3875 179
12 3300046459 Ga0495629_0184422 Ga0495629_0184422_712_1251 179
13 3300046476 Ga0495662_0099591 Ga0495662_0099591_153_791 179
14 3300046663 Ga0495635_0293280 Ga0495635_0293280_385_924 179
15 3300046681 Ga0495647_0113556 Ga0495647_0113556_400_939 179
16 3300046683 Ga0495658_0113225 Ga0495658_0113225_473_1012 179
17 3300046689 Ga0495613_0318813 Ga0495613_0318813_372_911 179
18 3300047319 Ga0495674_0266875 Ga0495674_0266875_49_588 179
19 3300049743 Ga0501081_0716788 Ga0501081_0716788_105_680 179
20 3300053077 Ga0495601_0340875 Ga0495601_0340875_127_666 179
21 3300060353 Ga0501082_0115690 Ga0501082_0115690_1587_2162 179
22 iso_pu_bacteria 2883291878 2883294519 179
23 iso_pu_bacteria 2513237094 2513640055 181
24 iso_pu_bacteria 2824753945 2824756186 181
25 iso_pu_bacteria 2824763712 2824765813 181
26 iso_pu_bacteria 2904711408 2904715475 181
27 3300049589 Ga0501073_0094720 Ga0501073_0094720_735_1292 182
28 iso_pu_bacteria 2908669403 2908673974 182
29 3300005327 Ga0070658_10733565 Ga0070658_107335651 183
30 3300005337 Ga0070682_100024286 Ga0070682_1000242865 183
31 3300005440 Ga0070705_100076151 Ga0070705_1000761512 183
32 3300005530 Ga0070679_100030615 Ga0070679_1000306152 183
33 3300005547 Ga0070693_100315321 Ga0070693_1003153212 183
34 3300005547 Ga0070693_100412308 Ga0070693_1004123081 183
35 3300005549 Ga0070704_100860124 Ga0070704_1008601242 183
36 3300005563 Ga0068855_100173776 Ga0068855_1001737762 183
37 3300005843 Ga0068860_100590513 Ga0068860_1005905132 183
38 3300006881 Ga0068865_100525178 Ga0068865_1005251781 183
39 3300013100 Ga0157373_10033003 Ga0157373_100330035 183
40 3300013104 Ga0157370_10122272 Ga0157370_101222721 183
41 3300025906 Ga0207699_10503011 Ga0207699_105030111 183
42 3300025921 Ga0207652_10970345 Ga0207652_109703451 183
43 3300033180 Ga0307510_10038031 Ga0307510_100380313 183
44 3300046524 Ga0495648_0339461 Ga0495648_0339461_116_676 183
45 3300047323 Ga0495683_0272797 Ga0495683_0272797_57_617 183
46 3300048907 Ga0496104_0000396 Ga0496104_0000396_14238_14795 183
47 3300048907 Ga0496104_0163497 Ga0496104_0163497_1220_1777 183
48 3300048907 Ga0496104_0501890 Ga0496104_0501890_191_748 183
49 3300048908 Ga0496105_0000025 Ga0496105_0000025_59247_59804 183
50 3300048908 Ga0496105_0039945 Ga0496105_0039945_2264_2821 183
51 3300048918 Ga0496115_0111158 Ga0496115_0111158_679_1236 183
52 3300048929 Ga0496126_0372717 Ga0496126_0372717_72_626 183
53 3300053086 Ga0500578_0160339 Ga0500578_0160339_771_1331 183
54 3300053156 Ga0500622_0003134 Ga0500622_0003134_9512_10072 183
55 3300053736 Ga0500599_031372 Ga0500599_031372_142_702 183
56 iso_pu_bacteria 8054563764 8054566707 183
57 3300005340 Ga0070689_100099438 Ga0070689_1000994383 184
58 3300005354 Ga0070675_101033361 Ga0070675_1010333611 184
59 3300005366 Ga0070659_100276511 Ga0070659_1002765112 184
60 3300005457 Ga0070662_100130556 Ga0070662_1001305561 184
61 3300005466 Ga0070685_10206893 Ga0070685_102068931 184
62 3300005615 Ga0070702_100775415 Ga0070702_1007754151 184
63 3300013308 Ga0157375_11026739 Ga0157375_110267392 184
64 3300025898 Ga0207692_10794085 Ga0207692_107940851 184
65 3300025918 Ga0207662_10075085 Ga0207662_100750852 184
66 3300025932 Ga0207690_10203948 Ga0207690_102039481 184
67 3300025933 Ga0207706_10122464 Ga0207706_101224642 184
68 3300031456 Ga0307513_10503512 Ga0307513_105035121 184
69 3300046460 Ga0495638_0011097 Ga0495638_0011097_4390_4950 184
70 3300048903 Ga0496100_0080946 Ga0496100_0080946_126_686 184
71 3300050492 nmdc:mga0yw44_593973_c1 nmdc:mga0yw44_593973_c1_160_720 184
72 3300050493 nmdc:mga0k408_170190_c2 nmdc:mga0k408_170190_c2_77_637 184
73 3300053096 Ga0500641_0010606 Ga0500641_0010606_143_703 184
74 3300053151 Ga0500604_0007516 Ga0500604_0007516_2301_2861 184
75 3300005937 Ga0081455_10021572 Ga0081455_100215725 185
76 3300006051 Ga0075364_10063874 Ga0075364_100638742 185
77 3300006177 Ga0075362_10008292 Ga0075362_100082924 185
78 3300006178 Ga0075367_10055480 Ga0075367_100554802 185
79 3300006195 Ga0075366_10002248 Ga0075366_100022483 185
80 3300006353 Ga0075370_10018173 Ga0075370_100181732 185
81 3300006353 Ga0075370_10036114 Ga0075370_100361143 185
82 3300021388 Ga0213875_10003368 Ga0213875_100033684 185
83 3300037853 Ga0436364_0433271 Ga0436364_0433271_7014_7577 185
84 3300037853 Ga0436364_1509541 Ga0436364_1509541_66_629 185
85 3300049569 Ga0501032_0070408 Ga0501032_0070408_1395_1958 185
86 3300049570 Ga0501033_0002016 Ga0501033_0002016_10237_10800 185
87 3300049571 Ga0501034_0008241 Ga0501034_0008241_1479_2042 185
88 3300049572 Ga0501036_0002450 Ga0501036_0002450_9100_9663 185
89 3300049574 Ga0501038_0001422 Ga0501038_0001422_4361_4924 185
90 3300049575 Ga0501039_0007435 Ga0501039_0007435_3104_3667 185
91 3300049579 Ga0501043_0000339 Ga0501043_0000339_33567_34130 185
92 3300049580 Ga0501046_0004739 Ga0501046_0004739_4264_4827 185
93 3300049581 Ga0501047_0005364 Ga0501047_0005364_3691_4254 185
94 3300049583 Ga0501067_0003490 Ga0501067_0003490_1281_1844 185
95 3300049584 Ga0501068_0016328 Ga0501068_0016328_1080_1643 185
96 3300049585 Ga0501069_0000186 Ga0501069_0000186_15062_15625 185
97 3300049586 Ga0501070_0004458 Ga0501070_0004458_3461_4024 185
98 3300049589 Ga0501073_0002376 Ga0501073_0002376_6930_7493 185
99 3300049590 Ga0501074_0000220 Ga0501074_0000220_26622_27185 185
100 3300049741 Ga0501079_0074621 Ga0501079_0074621_586_1173 185
101 3300049742 Ga0501080_0001486 Ga0501080_0001486_12902_13465 185
102 3300049744 Ga0501083_0029581 Ga0501083_0029581_1479_2042 185
103 3300049822 Ga0501035_0007174 Ga0501035_0007174_2070_2633 185
104 3300049823 Ga0501044_0021925 Ga0501044_0021925_542_1105 185
105 3300050489 nmdc:mga03683_8536_c1 nmdc:mga03683_8536_c1_1810_2373 185
106 3300050491 nmdc:mga00v17_1217_c1 nmdc:mga00v17_1217_c1_7066_7629 185
107 3300050493 nmdc:mga0k408_492183_c1 nmdc:mga0k408_492183_c1_39_596 185
108 3300050493 nmdc:mga0k408_735_c1 nmdc:mga0k408_735_c1_4083_4646 185
109 3300050494 nmdc:mga06z11_52351_c1 nmdc:mga06z11_52351_c1_1045_1608 185
110 3300050496 nmdc:mga07m45_103238_c1 nmdc:mga07m45_103238_c1_709_1272 185
111 3300050496 nmdc:mga07m45_19280_c1 nmdc:mga07m45_19280_c1_2184_2741 185
112 3300054114 Ga0501084_0006870 Ga0501084_0006870_3327_3890 185
113 3300060353 Ga0501082_0006019 Ga0501082_0006019_971_1534 185
114 3300005336 Ga0070680_100046237 Ga0070680_1000462372 186
115 3300005458 Ga0070681_10342435 Ga0070681_103424352 186
116 3300005530 Ga0070679_100157263 Ga0070679_1001572633 186
117 3300006028 Ga0070717_10085473 Ga0070717_100854732 186
118 3300006163 Ga0070715_10042928 Ga0070715_100429281 186
119 3300006173 Ga0070716_100025148 Ga0070716_1000251481 186
120 3300009098 Ga0105245_10489972 Ga0105245_104899722 186
121 3300025921 Ga0207652_10093841 Ga0207652_100938413 186
122 3300025939 Ga0207665_10016058 Ga0207665_100160586 186
123 3300031238 Ga0265332_10001808 Ga0265332_100018089 186
124 3300031242 Ga0265329_10234743 Ga0265329_102347431 186
125 3300031247 Ga0265340_10001397 Ga0265340_100013977 186
126 3300031249 Ga0265339_10000643 Ga0265339_1000064324 186
127 3300031250 Ga0265331_10013242 Ga0265331_100132425 186
128 3300031711 Ga0265314_10050676 Ga0265314_100506763 186
129 3300031712 Ga0265342_10000179 Ga0265342_1000017962 186
130 3300035116 Ga0373945_0263080 Ga0373945_0263080_97_669 186
131 3300035692 Ga0373935_0015885 Ga0373935_0015885_3676_4248 186
132 3300035725 Ga0373947_0312796 Ga0373947_0312796_176_748 186
133 3300037853 Ga0436364_0834040 Ga0436364_0834040_631_1197 186
134 3300039437 Ga0436365_1259283 Ga0436365_1259283_100_666 186
135 3300044842 Ga0466957_0836550 Ga0466957_0836550_25_585 186
136 3300045836 Ga0466958_0162400 Ga0466958_0162400_593_1153 186
137 3300047319 Ga0495674_0084348 Ga0495674_0084348_309_881 186
138 3300048907 Ga0496104_0180869 Ga0496104_0180869_1205_1771 186
139 3300048908 Ga0496105_0335802 Ga0496105_0335802_91_657 186
140 3300048909 Ga0496106_0467873 Ga0496106_0467873_65_631 186
141 3300048911 Ga0496108_0502666 Ga0496108_0502666_11_580 186
142 3300048913 Ga0496110_0426769 Ga0496110_0426769_324_893 186
143 3300048914 Ga0496111_0025794 Ga0496111_0025794_349_918 186
144 3300048915 Ga0496112_0412866 Ga0496112_0412866_405_974 186
145 3300048918 Ga0496115_0081885 Ga0496115_0081885_161_727 186
146 3300049569 Ga0501032_0371265 Ga0501032_0371265_41_607 186
147 3300049574 Ga0501038_0072027 Ga0501038_0072027_1455_2021 186
148 3300049579 Ga0501043_0053387 Ga0501043_0053387_1469_2035 186
149 3300049580 Ga0501046_0259733 Ga0501046_0259733_644_1210 186
150 3300049582 Ga0501048_0210450 Ga0501048_0210450_534_1100 186
151 3300049586 Ga0501070_0060990 Ga0501070_0060990_334_900 186
152 3300049587 Ga0501071_0531149 Ga0501071_0531149_271_837 186
153 3300049742 Ga0501080_0047128 Ga0501080_0047128_306_872 186
154 3300049823 Ga0501044_0005685 Ga0501044_0005685_1825_2391 186
155 3300050507 nmdc:mga05p37_1713_c1 nmdc:mga05p37_1713_c1_621_1190 186
156 3300003322 rootL2_10159444 rootL2_101594442 187
157 3300005340 Ga0070689_100099438 Ga0070689_1000994382 187
158 3300005434 Ga0070709_10008744 Ga0070709_100087446 187
159 3300005435 Ga0070714_100819893 Ga0070714_1008198932 187
160 3300005436 Ga0070713_100135616 Ga0070713_1001356162 187
161 3300005439 Ga0070711_100419079 Ga0070711_1004190792 187
162 3300005445 Ga0070708_100669622 Ga0070708_1006696222 187
163 3300005467 Ga0070706_100275783 Ga0070706_1002757832 187
164 3300005468 Ga0070707_100117161 Ga0070707_1001171612 187
165 3300005518 Ga0070699_100001766 Ga0070699_1000017669 187
166 3300005518 Ga0070699_100066540 Ga0070699_1000665402 187
167 3300005518 Ga0070699_100412835 Ga0070699_1004128352 187
168 3300005841 Ga0068863_101083162 Ga0068863_1010831622 187
169 3300005843 Ga0068860_100378553 Ga0068860_1003785532 187
170 3300005937 Ga0081455_10000896 Ga0081455_1000089616 187
171 3300005981 Ga0081538_10078279 Ga0081538_100782792 187
172 3300005983 Ga0081540_1001528 Ga0081540_10015288 187
173 3300005983 Ga0081540_1008359 Ga0081540_10083593 187
174 3300006353 Ga0075370_10057558 Ga0075370_100575582 187
175 3300006844 Ga0075428_100028276 Ga0075428_1000282765 187
176 3300006871 Ga0075434_100024816 Ga0075434_1000248162 187
177 3300006880 Ga0075429_100327324 Ga0075429_1003273242 187
178 3300006914 Ga0075436_100660215 Ga0075436_1006602151 187
179 3300007265 Ga0099794_10175396 Ga0099794_101753961 187
180 3300009094 Ga0111539_12136894 Ga0111539_121368941 187
181 3300009098 Ga0105245_10576747 Ga0105245_105767472 187
182 3300009147 Ga0114129_10106557 Ga0114129_101065575 187
183 3300010159 Ga0099796_10125707 Ga0099796_101257072 187
184 3300013297 Ga0157378_10435293 Ga0157378_104352931 187
185 3300013306 Ga0163162_10806514 Ga0163162_108065142 187
186 3300013308 Ga0157375_10506897 Ga0157375_105068972 187
187 3300014968 Ga0157379_10965015 Ga0157379_109650151 187
188 3300021384 Ga0213876_10048152 Ga0213876_100481523 187
189 3300025915 Ga0207693_10042623 Ga0207693_100426233 187
190 3300025916 Ga0207663_10121889 Ga0207663_101218892 187
191 3300025918 Ga0207662_10075085 Ga0207662_100750853 187
192 3300025927 Ga0207687_10442330 Ga0207687_104423302 187
193 3300025936 Ga0207670_10316267 Ga0207670_103162672 187
194 3300026035 Ga0207703_10723603 Ga0207703_107236032 187
195 3300026118 Ga0207675_100782656 Ga0207675_1007826562 187
196 3300027512 Ga0209179_1012214 Ga0209179_10122141 187
197 3300035111 Ga0373923_0004478 Ga0373923_0004478_2814_3383 187
198 3300035111 Ga0373923_0385209 Ga0373923_0385209_18_596 187
199 3300035112 Ga0373932_0231415 Ga0373932_0231415_60_629 187
200 3300035113 Ga0373936_0026867 Ga0373936_0026867_1601_2170 187
201 3300035115 Ga0373941_0001631 Ga0373941_0001631_3203_3766 187
202 3300035117 Ga0373953_0001929 Ga0373953_0001929_2816_3385 187
203 3300035118 Ga0373954_0000930 Ga0373954_0000930_135_707 187
204 3300035119 Ga0373956_0114953 Ga0373956_0114953_145_714 187
205 3300035170 Ga0373943_0001834 Ga0373943_0001834_8852_9421 187
206 3300035171 Ga0373946_0003213 Ga0373946_0003213_1899_2468 187
207 3300035172 Ga0373955_0012970 Ga0373955_0012970_2019_2588 187
208 3300035410 Ga0373924_0000784 Ga0373924_0000784_7840_8409 187
209 3300035692 Ga0373935_0000038 Ga0373935_0000038_481_1050 187
210 3300035692 Ga0373935_0156848 Ga0373935_0156848_245_814 187
211 3300035695 Ga0373927_0349432 Ga0373927_0349432_109_678 187
212 3300035724 Ga0373933_0010737 Ga0373933_0010737_4388_4957 187
213 3300035724 Ga0373933_0582576 Ga0373933_0582576_62_643 187
214 3300036401 Ga0373937_0000004 Ga0373937_0000004_16314_16883 187
215 3300036401 Ga0373937_0018175 Ga0373937_0018175_696_1274 187
216 3300037068 Ga0373925_0001179 Ga0373925_0001179_5414_5983 187
217 3300037068 Ga0373925_0730269 Ga0373925_0730269_183_752 187
218 3300038443 Ga0395901_0359204 Ga0395901_0359204_88_663 187
219 3300039437 Ga0436365_0511988 Ga0436365_0511988_278_844 187
220 3300039450 Ga0436363_0797154 Ga0436363_0797154_1033_1611 187
221 3300046454 Ga0495592_0000032 Ga0495592_0000032_79470_80039 187
222 3300046455 Ga0495603_0158547 Ga0495603_0158547_695_1264 187
223 3300046459 Ga0495629_0121935 Ga0495629_0121935_138_707 187
224 3300046459 Ga0495629_0397140 Ga0495629_0397140_46_615 187
225 3300046462 Ga0495651_0000884 Ga0495651_0000884_22509_23078 187
226 3300046463 Ga0495653_0000012 Ga0495653_0000012_154098_154667 187
227 3300046476 Ga0495662_0001158 Ga0495662_0001158_10610_11179 187
228 3300046477 Ga0495664_0000004 Ga0495664_0000004_227650_228219 187
229 3300046511 Ga0495608_0000005 Ga0495608_0000005_315317_315886 187
230 3300046514 Ga0495618_0000006 Ga0495618_0000006_186743_187312 187
231 3300046516 Ga0495628_0000001 Ga0495628_0000001_227639_228208 187
232 3300046517 Ga0495630_0006918 Ga0495630_0006918_5747_6316 187
233 3300046529 Ga0495652_0000002 Ga0495652_0000002_442173_442742 187
234 3300046529 Ga0495652_0258176 Ga0495652_0258176_609_1217 187
235 3300046531 Ga0495665_0063778 Ga0495665_0063778_1140_1709 187
236 3300046531 Ga0495665_0333109 Ga0495665_0333109_172_741 187
237 3300046533 Ga0495640_0000001 Ga0495640_0000001_536177_536746 187
238 3300046536 Ga0495587_0000008 Ga0495587_0000008_227857_228426 187
239 3300046543 Ga0495645_0000002 Ga0495645_0000002_227652_228221 187
240 3300046559 Ga0495667_0000007 Ga0495667_0000007_20387_20956 187
241 3300046642 Ga0495634_0000003 Ga0495634_0000003_129561_130130 187
242 3300046663 Ga0495635_0000002 Ga0495635_0000002_258716_259285 187
243 3300046675 Ga0495657_0000054 Ga0495657_0000054_74071_74640 187
244 3300046678 Ga0495599_0000005 Ga0495599_0000005_55874_56443 187
245 3300046679 Ga0495623_0000034 Ga0495623_0000034_18963_19532 187
246 3300046680 Ga0495646_0000002 Ga0495646_0000002_243668_244237 187
247 3300046689 Ga0495613_0062226 Ga0495613_0062226_1499_2068 187
248 3300046689 Ga0495613_0129771 Ga0495613_0129771_1180_1749 187
249 3300046690 Ga0495624_0010251 Ga0495624_0010251_4347_4916 187
250 3300046809 Ga0495600_0000012 Ga0495600_0000012_78782_79351 187
251 3300046809 Ga0495600_0682284 Ga0495600_0682284_21_599 187
252 3300047317 Ga0495604_0000009 Ga0495604_0000009_98084_98653 187
253 3300047319 Ga0495674_0000002 Ga0495674_0000002_227640_228209 187
254 3300047319 Ga0495674_0123163 Ga0495674_0123163_1265_1843 187
255 3300047322 Ga0495680_0001255 Ga0495680_0001255_651_1220 187
256 3300047444 Ga0495675_0000028 Ga0495675_0000028_9733_10302 187
257 3300047447 Ga0495685_096763 Ga0495685_096763_32_607 187
258 3300047471 Ga0495684_0000006 Ga0495684_0000006_227599_228168 187
259 3300047673 Ga0495593_0007553 Ga0495593_0007553_942_1511 187
260 3300048088 Ga0495602_0000005 Ga0495602_0000005_117465_118034 187
261 3300048911 Ga0496108_0115481 Ga0496108_0115481_102_677 187
262 3300048915 Ga0496112_0448011 Ga0496112_0448011_176_751 187
263 3300048915 Ga0496112_0544295 Ga0496112_0544295_63_632 187
264 3300048916 Ga0496113_0881114 Ga0496113_0881114_99_668 187
265 3300049568 Ga0501031_0014504 Ga0501031_0014504_1441_2004 187
266 3300049568 Ga0501031_0178371 Ga0501031_0178371_598_1161 187
267 3300049569 Ga0501032_0031408 Ga0501032_0031408_636_1199 187
268 3300049569 Ga0501032_0049588 Ga0501032_0049588_2032_2595 187
269 3300049569 Ga0501032_0107097 Ga0501032_0107097_669_1232 187
270 3300049570 Ga0501033_0017366 Ga0501033_0017366_565_1128 187
271 3300049570 Ga0501033_0322207 Ga0501033_0322207_288_860 187
272 3300049571 Ga0501034_0051708 Ga0501034_0051708_2443_3006 187
273 3300049571 Ga0501034_1037987 Ga0501034_1037987_118_681 187
274 3300049572 Ga0501036_0012981 Ga0501036_0012981_842_1405 187
275 3300049572 Ga0501036_0023855 Ga0501036_0023855_1770_2333 187
276 3300049572 Ga0501036_0427229 Ga0501036_0427229_113_676 187
277 3300049573 Ga0501037_0012035 Ga0501037_0012035_2143_2706 187
278 3300049573 Ga0501037_0031116 Ga0501037_0031116_935_1498 187
279 3300049573 Ga0501037_0063582 Ga0501037_0063582_1535_2098 187
280 3300049574 Ga0501038_0050457 Ga0501038_0050457_2443_3006 187
281 3300049574 Ga0501038_0161827 Ga0501038_0161827_358_921 187
282 3300049574 Ga0501038_0302646 Ga0501038_0302646_134_709 187
283 3300049575 Ga0501039_0014311 Ga0501039_0014311_3069_3632 187
284 3300049575 Ga0501039_0217974 Ga0501039_0217974_36_599 187
285 3300049575 Ga0501039_0384296 Ga0501039_0384296_16_579 187
286 3300049576 Ga0501040_0277247 Ga0501040_0277247_527_1090 187
287 3300049579 Ga0501043_0014744 Ga0501043_0014744_3974_4537 187
288 3300049579 Ga0501043_0068646 Ga0501043_0068646_1490_2053 187
289 3300049579 Ga0501043_0097779 Ga0501043_0097779_428_991 187
290 3300049580 Ga0501046_0012952 Ga0501046_0012952_5576_6139 187
291 3300049580 Ga0501046_0103170 Ga0501046_0103170_294_857 187
292 3300049581 Ga0501047_0025114 Ga0501047_0025114_2718_3281 187
293 3300049581 Ga0501047_0042313 Ga0501047_0042313_174_737 187
294 3300049581 Ga0501047_0139289 Ga0501047_0139289_168_731 187
295 3300049581 Ga0501047_0632429 Ga0501047_0632429_224_790 187
296 3300049582 Ga0501048_0013442 Ga0501048_0013442_3309_3872 187
297 3300049583 Ga0501067_0012266 Ga0501067_0012266_634_1197 187
298 3300049583 Ga0501067_0237947 Ga0501067_0237947_297_863 187
299 3300049584 Ga0501068_0005968 Ga0501068_0005968_4117_4680 187
300 3300049584 Ga0501068_0056853 Ga0501068_0056853_881_1444 187
301 3300049584 Ga0501068_0183543 Ga0501068_0183543_479_1042 187
302 3300049585 Ga0501069_0008358 Ga0501069_0008358_866_1429 187
303 3300049586 Ga0501070_0032911 Ga0501070_0032911_1331_1894 187
304 3300049586 Ga0501070_0073441 Ga0501070_0073441_454_1017 187
305 3300049586 Ga0501070_0289339 Ga0501070_0289339_177_743 187
306 3300049586 Ga0501070_0324173 Ga0501070_0324173_429_992 187
307 3300049587 Ga0501071_0009907 Ga0501071_0009907_2995_3558 187
308 3300049588 Ga0501072_0042267 Ga0501072_0042267_575_1138 187
309 3300049588 Ga0501072_0157156 Ga0501072_0157156_443_1006 187
310 3300049589 Ga0501073_0011485 Ga0501073_0011485_5646_6209 187
311 3300049589 Ga0501073_0085090 Ga0501073_0085090_1232_1795 187
312 3300049589 Ga0501073_0317755 Ga0501073_0317755_229_795 187
313 3300049590 Ga0501074_0010508 Ga0501074_0010508_948_1511 187
314 3300049590 Ga0501074_0056198 Ga0501074_0056198_2153_2716 187
315 3300049590 Ga0501074_0152873 Ga0501074_0152873_927_1493 187
316 3300049741 Ga0501079_0022012 Ga0501079_0022012_2799_3362 187
317 3300049742 Ga0501080_0020779 Ga0501080_0020779_3300_3863 187
318 3300049742 Ga0501080_0055814 Ga0501080_0055814_673_1236 187
319 3300049742 Ga0501080_0158671 Ga0501080_0158671_1223_1786 187
320 3300049743 Ga0501081_0281077 Ga0501081_0281077_219_782 187
321 3300049744 Ga0501083_0010594 Ga0501083_0010594_1691_2254 187
322 3300049822 Ga0501035_0045389 Ga0501035_0045389_948_1511 187
323 3300049822 Ga0501035_0073490 Ga0501035_0073490_1534_2097 187
324 3300049823 Ga0501044_0013165 Ga0501044_0013165_2773_3336 187
325 3300049823 Ga0501044_0106591 Ga0501044_0106591_1824_2387 187
326 3300049823 Ga0501044_0290359 Ga0501044_0290359_80_643 187
327 3300049823 Ga0501044_0314084 Ga0501044_0314084_497_1060 187
328 3300049823 Ga0501044_0339035 Ga0501044_0339035_744_1307 187
329 3300049824 Ga0501045_0029377 Ga0501045_0029377_3013_3576 187
330 3300050496 nmdc:mga07m45_199072_c1 nmdc:mga07m45_199072_c1_81_674 187
331 3300050507 nmdc:mga05p37_300532_c1 nmdc:mga05p37_300532_c1_1109_1684 187
332 3300050507 nmdc:mga05p37_8154_c1 nmdc:mga05p37_8154_c1_3054_3629 187
333 3300050508 nmdc:mga09592_71811_c1 nmdc:mga09592_71811_c1_1371_1949 187
334 3300050512 nmdc:mga0n895_1007195_c1 nmdc:mga0n895_1007195_c1_208_786 187
335 3300050512 nmdc:mga0n895_214921_c1 nmdc:mga0n895_214921_c1_652_1227 187
336 3300050513 nmdc:mga0rr50_329134_c1 nmdc:mga0rr50_329134_c1_431_1006 187
337 3300050514 nmdc:mga08x19_377042_c1 nmdc:mga08x19_377042_c1_294_872 187
338 3300050514 nmdc:mga08x19_79178_c1 nmdc:mga08x19_79178_c1_470_1039 187
339 3300053077 Ga0495601_0000002 Ga0495601_0000002_83253_83822 187
340 3300053077 Ga0495601_0185971 Ga0495601_0185971_624_1202 187
341 3300053078 Ga0495612_0000010 Ga0495612_0000010_19141_19710 187
342 3300053084 Ga0495595_0000026 Ga0495595_0000026_53747_54316 187
343 3300053085 Ga0495619_0000019 Ga0495619_0000019_42589_43158 187
344 3300060353 Ga0501082_0038073 Ga0501082_0038073_2638_3201 187
345 3300060353 Ga0501082_0857636 Ga0501082_0857636_83_646 187
346 3300060353 Ga0501082_1017874 Ga0501082_1017874_28_603 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

1

145

0.94

PF02525

Flavodoxin_2

Flavodoxin-like fold

7

162

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.9742 2 185
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.974 4 183
4hs4-assembly1.cif.gz_G-1 crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. 0.9726 2 185
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.9688 2 185
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.9639 2 185
ID Description Score Start End Superfamily
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9731 4 182 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9574 4 182 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9499 4 179 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9394 4 179 3.40.50.360
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.897 3 180 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A537TG81-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9798 18 187 GO:0005829
GO:0010181
GO:0016491
AF-A0A447N194-F1-model_v4 Putative oxidoreductase (EC 1.7.1.6) 0.9774 2 137 GO:0005829
GO:0010181
GO:0050446
AF-W1X5B8-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 0.9772 2 118 GO:0005829
GO:0010181
GO:0016491
AF-A0A7G8QIP8-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9759 1 187 GO:0005829
GO:0010181
GO:0016491
AF-A0A6D2GG69-F1-model_v4 Phosphopantetheinyl transferase (EC 1.7.-.-) 0.9755 1 187 GO:0000287
GO:0005829
GO:0008897
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.96 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map