F416867

General Info

Members Datasets Scaffolds Average Seq Length
346 192 692 189

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0181570|Ga0466967_0181570_308_883
Length 182
Sequence VITLYDAARCPYAARARIVLAEKGIEFEVVEIDLSDRPSWLYEKNPAGRVPVLEEDGWVLPESVVIMEFLEERYPEPPLLPPDAADRAAVRLLIFRDHDFTDPYYAFRRGEEGAREELDAALRPYLGGTEFGLADIAFVPWLLRARDMLGVELDGFTALADWLARLERRPSIAAEAGIVAAL

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.51
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 17.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0181570 3300045976 Bacteria 1985
2 Ga0070658_10030022 3300005327 Bacteria 4368
3 Ga0070658_10091036 3300005327 Bacteria 2513
4 Ga0070683_100052175 3300005329 Bacteria 3788
5 Ga0070683_100175125 3300005329 Bacteria 2037
6 Ga0070680_100101750 3300005336 Bacteria 2385
7 Ga0070682_100028560 3300005337 Bacteria 3356
8 Ga0070682_100072759 3300005337 Bacteria 2203
9 Ga0070660_100018525 3300005339 Bacteria 5088
10 Ga0070660_100031219 3300005339 Bacteria 4000
11 Ga0070660_100066964 3300005339 Bacteria 2797
12 Ga0070691_10318989 3300005341 Bacteria 854
13 Ga0070661_100101537 3300005344 Bacteria 2140
14 Ga0070659_100052457 3300005366 Bacteria 3208
15 Ga0070709_10157748 3300005434 Bacteria 1575
16 Ga0070714_100014223 3300005435 Bacteria 6390
17 Ga0070714_100024882 3300005435 Bacteria 4935
18 Ga0070714_100130825 3300005435 Bacteria 2243
19 Ga0070714_100358674 3300005435 Bacteria 1370
20 Ga0070714_100410270 3300005435 Bacteria 1282
21 Ga0070713_100017890 3300005436 Bacteria 5376
22 Ga0070713_100074675 3300005436 Bacteria 2873
23 Ga0070713_100124009 3300005436 Bacteria 2269
24 Ga0070711_101248071 3300005439 Bacteria 644
25 Ga0070694_100316922 3300005444 Unclassified 1199
26 Ga0070708_100253060 3300005445 Bacteria 1655
27 Ga0070681_10088843 3300005458 Bacteria 3042
28 Ga0070681_10317489 3300005458 Bacteria 1467
29 Ga0070706_100817265 3300005467 Bacteria 862
30 Ga0070707_100039491 3300005468 Bacteria 4511
31 Ga0070698_100022524 3300005471 Bacteria 6589
32 Ga0070698_100138650 3300005471 Bacteria 2385
33 Ga0070698_100287606 3300005471 Bacteria 1575
34 Ga0070698_101340062 3300005471 Bacteria 666
35 Ga0070699_100153577 3300005518 Bacteria 2037
36 Ga0070679_100083754 3300005530 Bacteria 3177
37 Ga0070679_100264015 3300005530 Bacteria 1677
38 Ga0070684_100073354 3300005535 Bacteria 3015
39 Ga0068853_101328421 3300005539 Bacteria 695
40 Ga0070695_100000024 3300005545 Bacteria 60106
41 Ga0070695_100183022 3300005545 Bacteria 1486
42 Ga0070696_100036279 3300005546 Bacteria 3399
43 Ga0070693_100299364 3300005547 Bacteria 1084
44 Ga0070665_100440297 3300005548 Bacteria 1312
45 Ga0070704_100144568 3300005549 Bacteria 1862
46 Ga0068855_101032087 3300005563 Bacteria 862
47 Ga0070664_100130445 3300005564 Bacteria 2207
48 Ga0068857_100643987 3300005577 Bacteria 1004
49 Ga0068856_100302579 3300005614 Bacteria 1617
50 Ga0070702_100879628 3300005615 Bacteria 700
51 Ga0068864_100161474 3300005618 Bacteria 2037
52 Ga0081539_10000068 3300005985 Bacteria 240998
53 Ga0070717_10023252 3300006028 Bacteria 4908
54 Ga0070717_10058076 3300006028 Bacteria 3199
55 Ga0070717_10062086 3300006028 Bacteria 3098
56 Ga0070715_10065679 3300006163 Bacteria 1606
57 Ga0070716_100021444 3300006173 Bacteria 3405
58 Ga0070716_100566701 3300006173 Bacteria 849
59 Ga0070712_100076480 3300006175 Bacteria 2410
60 Ga0070712_100371916 3300006175 Unclassified 1175
61 Ga0070712_100424206 3300006175 Bacteria 1103
62 Ga0070712_100427753 3300006175 Bacteria 1098
63 Ga0105240_10230634 3300009093 Bacteria 2152
64 Ga0105240_10318876 3300009093 Bacteria 1772
65 Ga0105240_10521494 3300009093 Bacteria 1318
66 Ga0105245_10076607 3300009098 Unclassified 3047
67 Ga0114129_10495205 3300009147 Bacteria 1597
68 Ga0105243_10932987 3300009148 Unclassified 866
69 Ga0105238_10346200 3300009551 Bacteria 1475
70 Ga0105238_10696217 3300009551 Unclassified 1028
71 Ga0105238_10953509 3300009551 Bacteria 878
72 Ga0157373_10101756 3300013100 Bacteria 2021
73 Ga0157370_11044738 3300013104 Unclassified 739
74 Ga0157369_10009204 3300013105 Bacteria 11301
75 Ga0157369_10116469 3300013105 Bacteria 2837
76 Ga0157369_10793520 3300013105 Bacteria 973
77 Ga0157372_10268715 3300013307 Bacteria 1981
78 Ga0157372_10765647 3300013307 Bacteria 1122
79 Ga0157375_10026040 3300013308 Bacteria 5445
80 Ga0182008_10012373 3300014497 Bacteria 4505
81 Ga0182008_10038021 3300014497 Bacteria 2407
82 Ga0182008_10073830 3300014497 Bacteria 1678
83 Ga0157377_10066582 3300014745 Bacteria 2071
84 Ga0157376_10154405 3300014969 Bacteria 2074
85 Ga0182007_10030716 3300015262 Bacteria 1834
86 Ga0206354_11000435 3300020081 Bacteria 1858
87 Ga0206354_11453748 3300020081 Bacteria 1247
88 Ga0206353_10406636 3300020082 Bacteria 2607
89 Ga0207692_10218627 3300025898 Bacteria 1128
90 Ga0207699_10091877 3300025906 Bacteria 1907
91 Ga0207643_10250811 3300025908 Bacteria 1090
92 Ga0207705_10063874 3300025909 Bacteria 2660
93 Ga0207705_10371104 3300025909 Unclassified 1104
94 Ga0207707_10099656 3300025912 Bacteria 2539
95 Ga0207707_10285845 3300025912 Bacteria 1427
96 Ga0207707_10333785 3300025912 Bacteria 1308
97 Ga0207695_10134104 3300025913 Bacteria 2431
98 Ga0207671_10750939 3300025914 Bacteria 775
99 Ga0207693_10000686 3300025915 Bacteria 30354
100 Ga0207693_10080963 3300025915 Bacteria 2542
101 Ga0207663_10587825 3300025916 Bacteria 874
102 Ga0207660_10363536 3300025917 Unclassified 1161
103 Ga0207657_10001602 3300025919 Bacteria 24343
104 Ga0207657_10002933 3300025919 Bacteria 18312
105 Ga0207657_10005377 3300025919 Bacteria 13403
106 Ga0207649_10052480 3300025920 Bacteria 2529
107 Ga0207649_10081749 3300025920 Unclassified 2093
108 Ga0207649_10371715 3300025920 Bacteria 1063
109 Ga0207652_10097126 3300025921 Bacteria 2596
110 Ga0207652_10153133 3300025921 Bacteria 2065
111 Ga0207652_10193172 3300025921 Bacteria 1831
112 Ga0207652_10227973 3300025921 Bacteria 1679
113 Ga0207652_10291400 3300025921 Unclassified 1472
114 Ga0207652_10390576 3300025921 Bacteria 1256
115 Ga0207646_10004885 3300025922 Bacteria 14360
116 Ga0207646_10225927 3300025922 Bacteria 1691
117 Ga0207646_10360364 3300025922 Unclassified 1314
118 Ga0207694_10146278 3300025924 Bacteria 1902
119 Ga0207659_10113168 3300025926 Bacteria 2066
120 Ga0207687_10148057 3300025927 Unclassified 1788
121 Ga0207687_10628713 3300025927 Bacteria 907
122 Ga0207700_10084684 3300025928 Bacteria 2486
123 Ga0207700_10198171 3300025928 Bacteria 1691
124 Ga0207700_10319999 3300025928 Unclassified 1344
125 Ga0207664_10003122 3300025929 Bacteria 11003
126 Ga0207664_10025140 3300025929 Bacteria 4481
127 Ga0207664_10055773 3300025929 Bacteria 3136
128 Ga0207664_10307972 3300025929 Unclassified 1395
129 Ga0207664_10349420 3300025929 Bacteria 1309
130 Ga0207664_10411195 3300025929 Unclassified 1204
131 Ga0207644_10102165 3300025931 Bacteria 2156
132 Ga0207690_10077336 3300025932 Bacteria 2313
133 Ga0207690_10101887 3300025932 Bacteria 2052
134 Ga0207690_10452301 3300025932 Bacteria 1032
135 Ga0207665_10354869 3300025939 Bacteria 1107
136 Ga0207661_10073755 3300025944 Bacteria 2796
137 Ga0207667_10403743 3300025949 Unclassified 1391
138 Ga0207702_10176052 3300026078 Bacteria 1966
139 Ga0207676_10709994 3300026095 Unclassified 975
140 Ga0207674_10275595 3300026116 Bacteria 1630
141 Ga0265326_10038546 3300028558 Bacteria 1358
142 Ga0265319_1011778 3300028563 Bacteria 3562
143 Ga0265334_10001869 3300028573 Bacteria 10009
144 Ga0265318_10000697 3300028577 Bacteria 22602
145 Ga0265323_10075743 3300028653 Bacteria 1143
146 Ga0265322_10010605 3300028654 Bacteria 2676
147 Ga0265336_10009570 3300028666 Bacteria 3346
148 Ga0265336_10047746 3300028666 Unclassified 1299
149 Ga0265338_10000719 3300028800 Bacteria 56662
150 Ga0265338_10018983 3300028800 Bacteria 7326
151 Ga0265338_10040411 3300028800 Bacteria 4381
152 Ga0265338_10234823 3300028800 Bacteria 1361
153 Ga0265324_10072713 3300029957 Bacteria 1171
154 Ga0265330_10076023 3300031235 Bacteria 1450
155 Ga0265328_10017590 3300031239 Bacteria 2767
156 Ga0265320_10014756 3300031240 Bacteria 4433
157 Ga0265325_10000921 3300031241 Bacteria 21225
158 Ga0265329_10015410 3300031242 Bacteria 2669
159 Ga0265340_10005867 3300031247 Bacteria 6792
160 Ga0265339_10009533 3300031249 Bacteria 6090
161 Ga0265327_10008239 3300031251 Bacteria 7810
162 Ga0265327_10013659 3300031251 Bacteria 5377
163 Ga0265316_10006999 3300031344 Bacteria 10687
164 Ga0265316_10030938 3300031344 Bacteria 4381
165 Ga0265316_10170471 3300031344 Bacteria 1624
166 Ga0265313_10014344 3300031595 Bacteria 4687
167 Ga0265313_10028674 3300031595 Bacteria 2890
168 Ga0265314_10008183 3300031711 Bacteria 8991
169 Ga0265314_10043824 3300031711 Bacteria 3176
170 Ga0373923_0376390 3300035111 Unclassified 681
171 Ga0373956_0155626 3300035119 Bacteria 1076
172 Ga0373924_0018120 3300035410 Unclassified 2711
173 Ga0373931_0225584 3300035691 Bacteria 1130
174 Ga0373933_0203538 3300035724 Unclassified 1267
175 Ga0395900_0070952 3300037418 Bacteria 3580
176 Ga0395900_0369681 3300037418 Bacteria 1404
177 Ga0395898_0059618 3300037466 Unclassified 3712
178 Ga0395898_0061447 3300037466 Bacteria 3649
179 Ga0395905_0023926 3300037471 Bacteria 5766
180 Ga0395905_0057041 3300037471 Bacteria 3653
181 Ga0395901_0131990 3300038443 Bacteria 2624
182 Ga0436360_1165091 3300039438 Bacteria 29560
183 Ga0439438_066302 3300041405 Unclassified 898
184 Ga0439461_0023799 3300041410 Bacteria 1234
185 Ga0451853_1656372 3300041512 Bacteria 810
186 Ga0439446_0005377 3300042156 Bacteria 3290
187 Ga0439434_0013630 3300042435 Bacteria 2414
188 Ga0439435_0067871 3300042436 Bacteria 1051
189 Ga0439464_0063566 3300042439 Bacteria 1083
190 Ga0466969_0017511 3300044656 Bacteria 3738
191 Ga0466969_0030756 3300044656 Bacteria 2735
192 Ga0466965_0401531 3300044683 Bacteria 757
193 Ga0466961_0005803 3300044693 Bacteria 7821
194 Ga0466961_0047565 3300044693 Bacteria 2743
195 Ga0466961_0060436 3300044693 Unclassified 2410
196 Ga0466961_0079064 3300044693 Unclassified 2083
197 Ga0466963_0002128 3300044694 Bacteria 10948
198 Ga0466963_0003480 3300044694 Bacteria 9031
199 Ga0466963_0005920 3300044694 Bacteria 7199
200 Ga0466963_0021457 3300044694 Bacteria 4075
201 Ga0466963_0039155 3300044694 Bacteria 3103
202 Ga0466963_0043674 3300044694 Bacteria 2948
203 Ga0466963_0063517 3300044694 Bacteria 2471
204 Ga0466963_0168503 3300044694 Bacteria 1526
205 Ga0466963_0190355 3300044694 Bacteria 1433
206 Ga0466964_0003970 3300044706 Bacteria 5439
207 Ga0466964_0004536 3300044706 Bacteria 5129
208 Ga0466964_0012736 3300044706 Bacteria 3184
209 Ga0466964_0028299 3300044706 Bacteria 2207
210 Ga0466964_0048635 3300044706 Bacteria 1734
211 Ga0466964_0070785 3300044706 Unclassified 1474
212 Ga0466964_0095728 3300044706 Bacteria 1300
213 Ga0466964_0374924 3300044706 Bacteria 737
214 Ga0466971_0001397 3300044719 Bacteria 10134
215 Ga0466971_0007145 3300044719 Bacteria 4859
216 Ga0466971_0025559 3300044719 Bacteria 2637
217 Ga0466971_0129734 3300044719 Bacteria 1170
218 Ga0466968_0016384 3300044735 Bacteria 2951
219 Ga0466968_0067844 3300044735 Bacteria 1548
220 Ga0466970_0046550 3300044765 Bacteria 2310
221 Ga0466970_0119598 3300044765 Unclassified 1442
222 Ga0466957_0005704 3300044842 Bacteria 7000
223 Ga0466957_0013300 3300044842 Bacteria 4774
224 Ga0466957_0013931 3300044842 Bacteria 4675
225 Ga0466957_0107042 3300044842 Bacteria 1769
226 Ga0466957_0195499 3300044842 Bacteria 1326
227 Ga0466960_0019539 3300044901 Bacteria 2988
228 Ga0466959_0010392 3300045049 Bacteria 6652
229 Ga0466959_0011185 3300045049 Bacteria 6436
230 Ga0466959_0107602 3300045049 Bacteria 1993
231 Ga0466959_0527261 3300045049 Unclassified 797
232 Ga0466958_0002651 3300045836 Bacteria 9043
233 Ga0466958_0013676 3300045836 Bacteria 4625
234 Ga0466958_0161520 3300045836 Unclassified 1415
235 Ga0466958_0167973 3300045836 Bacteria 1389
236 Ga0466967_0001546 3300045976 Bacteria 13479
237 Ga0466967_0017792 3300045976 Bacteria 5658
238 Ga0466967_0019301 3300045976 Bacteria 5478
239 Ga0466967_0033983 3300045976 Bacteria 4322
240 Ga0466967_0110421 3300045976 Bacteria 2526
241 Ga0466967_0114856 3300045976 Bacteria 2478
242 Ga0466967_0156807 3300045976 Bacteria 2133
243 Ga0466967_0202042 3300045976 Unclassified 1883
244 Ga0466967_0240012 3300045976 Bacteria 1728
245 Ga0466967_0297368 3300045976 Bacteria 1552
246 Ga0466967_0313996 3300045976 Unclassified 1510
247 Ga0466967_0349846 3300045976 Bacteria 1430
248 Ga0466967_0414830 3300045976 Unclassified 1311
249 Ga0466967_0435777 3300045976 Bacteria 1279
250 Ga0466967_0526834 3300045976 Bacteria 1161
251 Ga0495629_0144883 3300046459 Bacteria 1652
252 Ga0495629_0185388 3300046459 Bacteria 1441
253 Ga0495641_0016588 3300046461 Bacteria 3872
254 Ga0495641_0058828 3300046461 Unclassified 1738
255 Ga0495653_0149845 3300046463 Bacteria 1631
256 Ga0495653_0238451 3300046463 Unclassified 1213
257 Ga0495580_0562123 3300046472 Bacteria 757
258 Ga0495582_0184596 3300046473 Archaea 1189
259 Ga0495582_0241606 3300046473 Bacteria 1035
260 Ga0495639_0257035 3300046475 Bacteria 865
261 Ga0495639_0349073 3300046475 Unclassified 743
262 Ga0495664_0427291 3300046477 Bacteria 794
263 Ga0495608_0016831 3300046511 Bacteria 5060
264 Ga0495608_0200908 3300046511 Unclassified 1256
265 Ga0495628_0125562 3300046516 Unclassified 1966
266 Ga0495630_0028939 3300046517 Bacteria 4117
267 Ga0495630_0106985 3300046517 Unclassified 2118
268 Ga0495631_0043601 3300046518 Bacteria 1979
269 Ga0495644_0148503 3300046523 Bacteria 897
270 Ga0495652_0133708 3300046529 Unclassified 1959
271 Ga0495665_0182872 3300046531 Bacteria 1089
272 Ga0495640_0034791 3300046533 Bacteria 3567
273 Ga0495640_0051476 3300046533 Bacteria 2831
274 Ga0495586_0215504 3300046535 Unclassified 1090
275 Ga0495587_0036215 3300046536 Bacteria 2969
276 Ga0495609_0230035 3300046538 Bacteria 768
277 Ga0495645_0028244 3300046543 Unclassified 4076
278 Ga0495667_0158341 3300046559 Bacteria 1457
279 Ga0495634_0027448 3300046642 Bacteria 3960
280 Ga0495634_0364483 3300046642 Bacteria 863
281 Ga0495657_0068561 3300046675 Bacteria 2324
282 Ga0495657_0182011 3300046675 Unclassified 1289
283 Ga0495657_0639354 3300046675 Unclassified 614
284 Ga0495599_0277095 3300046678 Bacteria 1016
285 Ga0495623_0086432 3300046679 Unclassified 1933
286 Ga0495647_0005684 3300046681 Bacteria 4097
287 Ga0495658_0003046 3300046683 Bacteria 8390
288 Ga0495658_0147611 3300046683 Unclassified 1442
289 Ga0495613_0132100 3300046689 Bacteria 1787
290 Ga0495581_0081110 3300047315 Bacteria 1878
291 Ga0495604_0175239 3300047317 Unclassified 1504
292 Ga0495674_0032601 3300047319 Bacteria 4725
293 Ga0495674_0359657 3300047319 Unclassified 1180
294 Ga0495680_0012533 3300047322 Bacteria 7456
295 Ga0495680_0444503 3300047322 Bacteria 888
296 Ga0495602_0067136 3300048088 Bacteria 3087
297 Ga0495614_0144972 3300048089 Unclassified 1057
298 Ga0496101_0083367 3300048904 Bacteria 2366
299 Ga0496101_0758705 3300048904 Bacteria 765
300 Ga0496102_0103593 3300048905 Bacteria 2646
301 Ga0496102_0133270 3300048905 Bacteria 2327
302 Ga0496102_0265350 3300048905 Unclassified 1619
303 Ga0496104_0194362 3300048907 Bacteria 1941
304 Ga0496106_0001752 3300048909 Bacteria 16216
305 Ga0496107_0004284 3300048910 Bacteria 9657
306 Ga0496107_0224203 3300048910 Bacteria 1398
307 Ga0496108_0011297 3300048911 Bacteria 7255
308 Ga0496108_0290119 3300048911 Bacteria 1424
309 Ga0496108_0414740 3300048911 Bacteria 1176
310 Ga0496109_0008844 3300048912 Bacteria 8574
311 Ga0496109_0550047 3300048912 Bacteria 1089
312 Ga0496110_0002328 3300048913 Bacteria 14200
313 Ga0496111_0011860 3300048914 Bacteria 5886
314 Ga0496111_0017378 3300048914 Bacteria 4974
315 Ga0496112_0001266 3300048915 Bacteria 19173
316 Ga0496112_0056468 3300048915 Bacteria 3864
317 Ga0496112_0084114 3300048915 Bacteria 3147
318 Ga0496112_0103705 3300048915 Bacteria 2814
319 Ga0496112_0212895 3300048915 Bacteria 1889
320 Ga0496112_1113725 3300048915 Bacteria 707
321 Ga0496113_0398833 3300048916 Unclassified 1104
322 Ga0496113_0407626 3300048916 Bacteria 1091
323 Ga0496115_0326308 3300048918 Bacteria 1255
324 Ga0501036_0077123 3300049572 Bacteria 2820
325 Ga0501038_0721835 3300049574 Bacteria 745
326 Ga0501041_0467849 3300049577 Bacteria 801
327 Ga0501042_0192892 3300049578 Bacteria 1469
328 Ga0501067_0446257 3300049583 Unclassified 722
329 Ga0501069_0232341 3300049585 Bacteria 1074
330 Ga0501075_0133194 3300049591 Bacteria 1894
331 Ga0501075_0313100 3300049591 Unclassified 1196
332 Ga0501076_0148835 3300049592 Bacteria 1904
333 Ga0501076_0459018 3300049592 Unclassified 1049
334 Ga0501081_0107432 3300049743 Bacteria 1979
335 nmdc:mga05p37_123855_c1 3300050507 Bacteria 3175
336 Ga0495601_0033561 3300053077 Unclassified 3198
337 Ga0495601_0645727 3300053077 Unclassified 677
338 Ga0495612_0107060 3300053078 Unclassified 1194
339 Ga0495612_0131446 3300053078 Unclassified 1081
340 Ga0495619_0006636 3300053085 Bacteria 7326
341 Ga0495619_0226075 3300053085 Unclassified 1296
342 Ga0501084_0254831 3300054114 Bacteria 1481
343 Ga0466962_0003167 3300061719 Bacteria 7820
344 Ga0466962_0012505 3300061719 Bacteria 4081
345 Ga0466962_0039575 3300061719 Unclassified 2257
346 Ga0530510_0403020 3300061734 Bacteria 1031
347 Ga0466967_0181570
348 Ga0070658_10030022
349 Ga0070658_10091036
350 Ga0070683_100052175
351 Ga0070683_100175125
352 Ga0070680_100101750
353 Ga0070682_100028560
354 Ga0070682_100072759
355 Ga0070660_100018525
356 Ga0070660_100031219
357 Ga0070660_100066964
358 Ga0070691_10318989
359 Ga0070661_100101537
360 Ga0070659_100052457
361 Ga0070709_10157748
362 Ga0070714_100014223
363 Ga0070714_100024882
364 Ga0070714_100130825
365 Ga0070714_100358674
366 Ga0070714_100410270
367 Ga0070713_100017890
368 Ga0070713_100074675
369 Ga0070713_100124009
370 Ga0070711_101248071
371 Ga0070694_100316922
372 Ga0070708_100253060
373 Ga0070681_10088843
374 Ga0070681_10317489
375 Ga0070706_100817265
376 Ga0070707_100039491
377 Ga0070698_100022524
378 Ga0070698_100138650
379 Ga0070698_100287606
380 Ga0070698_101340062
381 Ga0070699_100153577
382 Ga0070679_100083754
383 Ga0070679_100264015
384 Ga0070684_100073354
385 Ga0068853_101328421
386 Ga0070695_100000024
387 Ga0070695_100183022
388 Ga0070696_100036279
389 Ga0070693_100299364
390 Ga0070665_100440297
391 Ga0070704_100144568
392 Ga0068855_101032087
393 Ga0070664_100130445
394 Ga0068857_100643987
395 Ga0068856_100302579
396 Ga0070702_100879628
397 Ga0068864_100161474
398 Ga0081539_10000068
399 Ga0070717_10023252
400 Ga0070717_10058076
401 Ga0070717_10062086
402 Ga0070715_10065679
403 Ga0070716_100021444
404 Ga0070716_100566701
405 Ga0070712_100076480
406 Ga0070712_100371916
407 Ga0070712_100424206
408 Ga0070712_100427753
409 Ga0105240_10230634
410 Ga0105240_10318876
411 Ga0105240_10521494
412 Ga0105245_10076607
413 Ga0114129_10495205
414 Ga0105243_10932987
415 Ga0105238_10346200
416 Ga0105238_10696217
417 Ga0105238_10953509
418 Ga0157373_10101756
419 Ga0157370_11044738
420 Ga0157369_10009204
421 Ga0157369_10116469
422 Ga0157369_10793520
423 Ga0157372_10268715
424 Ga0157372_10765647
425 Ga0157375_10026040
426 Ga0182008_10012373
427 Ga0182008_10038021
428 Ga0182008_10073830
429 Ga0157377_10066582
430 Ga0157376_10154405
431 Ga0182007_10030716
432 Ga0206354_11000435
433 Ga0206354_11453748
434 Ga0206353_10406636
435 Ga0207692_10218627
436 Ga0207699_10091877
437 Ga0207643_10250811
438 Ga0207705_10063874
439 Ga0207705_10371104
440 Ga0207707_10099656
441 Ga0207707_10285845
442 Ga0207707_10333785
443 Ga0207695_10134104
444 Ga0207671_10750939
445 Ga0207693_10000686
446 Ga0207693_10080963
447 Ga0207663_10587825
448 Ga0207660_10363536
449 Ga0207657_10001602
450 Ga0207657_10002933
451 Ga0207657_10005377
452 Ga0207649_10052480
453 Ga0207649_10081749
454 Ga0207649_10371715
455 Ga0207652_10097126
456 Ga0207652_10153133
457 Ga0207652_10193172
458 Ga0207652_10227973
459 Ga0207652_10291400
460 Ga0207652_10390576
461 Ga0207646_10004885
462 Ga0207646_10225927
463 Ga0207646_10360364
464 Ga0207694_10146278
465 Ga0207659_10113168
466 Ga0207687_10148057
467 Ga0207687_10628713
468 Ga0207700_10084684
469 Ga0207700_10198171
470 Ga0207700_10319999
471 Ga0207664_10003122
472 Ga0207664_10025140
473 Ga0207664_10055773
474 Ga0207664_10307972
475 Ga0207664_10349420
476 Ga0207664_10411195
477 Ga0207644_10102165
478 Ga0207690_10077336
479 Ga0207690_10101887
480 Ga0207690_10452301
481 Ga0207665_10354869
482 Ga0207661_10073755
483 Ga0207667_10403743
484 Ga0207702_10176052
485 Ga0207676_10709994
486 Ga0207674_10275595
487 Ga0265326_10038546
488 Ga0265319_1011778
489 Ga0265334_10001869
490 Ga0265318_10000697
491 Ga0265323_10075743
492 Ga0265322_10010605
493 Ga0265336_10009570
494 Ga0265336_10047746
495 Ga0265338_10000719
496 Ga0265338_10018983
497 Ga0265338_10040411
498 Ga0265338_10234823
499 Ga0265324_10072713
500 Ga0265330_10076023
501 Ga0265328_10017590
502 Ga0265320_10014756
503 Ga0265325_10000921
504 Ga0265329_10015410
505 Ga0265340_10005867
506 Ga0265339_10009533
507 Ga0265327_10008239
508 Ga0265327_10013659
509 Ga0265316_10006999
510 Ga0265316_10030938
511 Ga0265316_10170471
512 Ga0265313_10014344
513 Ga0265313_10028674
514 Ga0265314_10008183
515 Ga0265314_10043824
516 Ga0373923_0376390
517 Ga0373956_0155626
518 Ga0373924_0018120
519 Ga0373931_0225584
520 Ga0373933_0203538
521 Ga0395900_0070952
522 Ga0395900_0369681
523 Ga0395898_0059618
524 Ga0395898_0061447
525 Ga0395905_0023926
526 Ga0395905_0057041
527 Ga0395901_0131990
528 Ga0436360_1165091
529 Ga0439438_066302
530 Ga0439461_0023799
531 Ga0451853_1656372
532 Ga0439446_0005377
533 Ga0439434_0013630
534 Ga0439435_0067871
535 Ga0439464_0063566
536 Ga0466969_0017511
537 Ga0466969_0030756
538 Ga0466965_0401531
539 Ga0466961_0005803
540 Ga0466961_0047565
541 Ga0466961_0060436
542 Ga0466961_0079064
543 Ga0466963_0002128
544 Ga0466963_0003480
545 Ga0466963_0005920
546 Ga0466963_0021457
547 Ga0466963_0039155
548 Ga0466963_0043674
549 Ga0466963_0063517
550 Ga0466963_0168503
551 Ga0466963_0190355
552 Ga0466964_0003970
553 Ga0466964_0004536
554 Ga0466964_0012736
555 Ga0466964_0028299
556 Ga0466964_0048635
557 Ga0466964_0070785
558 Ga0466964_0095728
559 Ga0466964_0374924
560 Ga0466971_0001397
561 Ga0466971_0007145
562 Ga0466971_0025559
563 Ga0466971_0129734
564 Ga0466968_0016384
565 Ga0466968_0067844
566 Ga0466970_0046550
567 Ga0466970_0119598
568 Ga0466957_0005704
569 Ga0466957_0013300
570 Ga0466957_0013931
571 Ga0466957_0107042
572 Ga0466957_0195499
573 Ga0466960_0019539
574 Ga0466959_0010392
575 Ga0466959_0011185
576 Ga0466959_0107602
577 Ga0466959_0527261
578 Ga0466958_0002651
579 Ga0466958_0013676
580 Ga0466958_0161520
581 Ga0466958_0167973
582 Ga0466967_0001546
583 Ga0466967_0017792
584 Ga0466967_0019301
585 Ga0466967_0033983
586 Ga0466967_0110421
587 Ga0466967_0114856
588 Ga0466967_0156807
589 Ga0466967_0202042
590 Ga0466967_0240012
591 Ga0466967_0297368
592 Ga0466967_0313996
593 Ga0466967_0349846
594 Ga0466967_0414830
595 Ga0466967_0435777
596 Ga0466967_0526834
597 Ga0495629_0144883
598 Ga0495629_0185388
599 Ga0495641_0016588
600 Ga0495641_0058828
601 Ga0495653_0149845
602 Ga0495653_0238451
603 Ga0495580_0562123
604 Ga0495582_0184596
605 Ga0495582_0241606
606 Ga0495639_0257035
607 Ga0495639_0349073
608 Ga0495664_0427291
609 Ga0495608_0016831
610 Ga0495608_0200908
611 Ga0495628_0125562
612 Ga0495630_0028939
613 Ga0495630_0106985
614 Ga0495631_0043601
615 Ga0495644_0148503
616 Ga0495652_0133708
617 Ga0495665_0182872
618 Ga0495640_0034791
619 Ga0495640_0051476
620 Ga0495586_0215504
621 Ga0495587_0036215
622 Ga0495609_0230035
623 Ga0495645_0028244
624 Ga0495667_0158341
625 Ga0495634_0027448
626 Ga0495634_0364483
627 Ga0495657_0068561
628 Ga0495657_0182011
629 Ga0495657_0639354
630 Ga0495599_0277095
631 Ga0495623_0086432
632 Ga0495647_0005684
633 Ga0495658_0003046
634 Ga0495658_0147611
635 Ga0495613_0132100
636 Ga0495581_0081110
637 Ga0495604_0175239
638 Ga0495674_0032601
639 Ga0495674_0359657
640 Ga0495680_0012533
641 Ga0495680_0444503
642 Ga0495602_0067136
643 Ga0495614_0144972
644 Ga0496101_0083367
645 Ga0496101_0758705
646 Ga0496102_0103593
647 Ga0496102_0133270
648 Ga0496102_0265350
649 Ga0496104_0194362
650 Ga0496106_0001752
651 Ga0496107_0004284
652 Ga0496107_0224203
653 Ga0496108_0011297
654 Ga0496108_0290119
655 Ga0496108_0414740
656 Ga0496109_0008844
657 Ga0496109_0550047
658 Ga0496110_0002328
659 Ga0496111_0011860
660 Ga0496111_0017378
661 Ga0496112_0001266
662 Ga0496112_0056468
663 Ga0496112_0084114
664 Ga0496112_0103705
665 Ga0496112_0212895
666 Ga0496112_1113725
667 Ga0496113_0398833
668 Ga0496113_0407626
669 Ga0496115_0326308
670 Ga0501036_0077123
671 Ga0501038_0721835
672 Ga0501041_0467849
673 Ga0501042_0192892
674 Ga0501067_0446257
675 Ga0501069_0232341
676 Ga0501075_0133194
677 Ga0501075_0313100
678 Ga0501076_0148835
679 Ga0501076_0459018
680 Ga0501081_0107432
681 nmdc:mga05p37_123855_c1
682 Ga0495601_0033561
683 Ga0495601_0645727
684 Ga0495612_0107060
685 Ga0495612_0131446
686 Ga0495619_0006636
687 Ga0495619_0226075
688 Ga0501084_0254831
689 Ga0466962_0003167
690 Ga0466962_0012505
691 Ga0466962_0039575
692 Ga0530510_0403020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

4

78

0.99

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

9

73

0.96

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

72

0.95

PF22441

CLIC-like_N

CLIC-like N-terminal domain

5

78

0.94

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

106

170

0.91

PF00462

Glutaredoxin

Glutaredoxin

2

57

0.83

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

106

165

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vln-assembly1.cif.gz_A-2 human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid 0.9206 2 185
5zfg-assembly1.cif.gz_A crystal structure of a diazinon-metabolizing glutathione s-transferase in the silkworm, bombyx mori 0.9174 1 191
5f0g-assembly1.cif.gz_A structure of the glutathione transferase delta 2 from drosophila melanogaster 0.9172 3 191
5zfg-assembly1.cif.gz_B crystal structure of a diazinon-metabolizing glutathione s-transferase in the silkworm, bombyx mori 0.9171 1 191
3lfl-assembly2.cif.gz_C crystal structure of human glutathione transferase omega 1, delta 155 0.9137 2 185
ID Description Score Start End Superfamily
af_Q9H4Y5_21_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9407 2 73 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9374 1 82 3.40.30.10
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9362 2 71 3.80.10.10
af_Q9VSL6_6_114_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9334 1 89 3.40.30.10
3q19A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9316 2 76 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A538I439-F1-model_v4 GNAT family N-acetyltransferase 0.9875 1 192 GO:0005737
GO:0016747
AF-A0A7M2Z108-F1-model_v4 Glutathione S-transferase 0.986 1 191 GO:0005737
GO:0016740
AF-A0A538I439-F1-model_v4 GNAT family N-acetyltransferase 0.9773 1 192 GO:0005737
GO:0016747
AF-A0A1Q7UEQ8-F1-model_v4 Glutathione S-transferase family protein 0.9757 50 192 GO:0005737
AF-A0A1Q7UEQ8-F1-model_v4 Glutathione S-transferase family protein 0.969 50 192 GO:0005737

Map