F416854

General Info

Members Datasets Scaffolds Average Seq Length
346 209 692 147

Family's Representative Sequence

Representative Sequence 3300041459|Ga0451800_1552548|Ga0451800_1552548_256_750
Length 164
Sequence VATATLFPRATSGGTVTDDLENMGPIDYLIVEFPGNKMTGEGLPLLVDLVDRGIIRILDLVFVIKDADGNVAGLEISDLDSDGDFDLTVFEGVSSGLIGDDDIEEASQVLEPNSSAGILVYENVWAAPFASALRRSGAQLVGGGRIPVQAILASLDAVEGATTG

Samples

Sample ID Description Type Environment
1 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
2 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2643221670 Streptomyces sp. Root431 Isolate Unclassified
206 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
207 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
208 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
209 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.93
Metatranscriptomes 4.62
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 8.09
Rhizosphere 87.86
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451800_1552548 3300041459 Bacteria 824
2 Ga0007429J51699_1040613 3300003579 Bacteria 591
3 Ga0058863_11616227 3300004799 Bacteria 1008
4 Ga0058861_11749994 3300004800 Bacteria 1231
5 Ga0058862_12750405 3300004803 Bacteria 1086
6 Ga0070658_10215636 3300005327 Bacteria 1622
7 Ga0070680_100010274 3300005336 Bacteria 7216
8 Ga0070682_100195889 3300005337 Bacteria 1422
9 Ga0068868_100305115 3300005338 Bacteria 1353
10 Ga0068868_102087016 3300005338 Bacteria 539
11 Ga0070660_100136718 3300005339 Bacteria 1964
12 Ga0070660_101312830 3300005339 Bacteria 614
13 Ga0070692_11117694 3300005345 Bacteria 557
14 Ga0070668_100573309 3300005347 Bacteria 984
15 Ga0070668_101169060 3300005347 Bacteria 696
16 Ga0070674_100136955 3300005356 Bacteria 1833
17 Ga0070674_100436513 3300005356 Bacteria 1078
18 Ga0070714_100050070 3300005435 Bacteria 3557
19 Ga0070710_10490802 3300005437 Unclassified 839
20 Ga0070705_100122818 3300005440 Bacteria 1680
21 Ga0070700_100168240 3300005441 Bacteria 1516
22 Ga0070700_100381560 3300005441 Bacteria 1054
23 Ga0070663_100160702 3300005455 Bacteria 1729
24 Ga0070663_100419441 3300005455 Bacteria 1097
25 Ga0070678_100057056 3300005456 Bacteria 2859
26 Ga0070681_10873909 3300005458 Bacteria 817
27 Ga0070685_10095794 3300005466 Bacteria 1805
28 Ga0070699_100000026 3300005518 Bacteria 157963
29 Ga0070679_100029096 3300005530 Bacteria 5449
30 Ga0068853_101752272 3300005539 Bacteria 602
31 Ga0070686_100707228 3300005544 Bacteria 804
32 Ga0070686_101075780 3300005544 Bacteria 663
33 Ga0070695_100666213 3300005545 Bacteria 823
34 Ga0070696_100117409 3300005546 Bacteria 1922
35 Ga0070665_100014771 3300005548 Bacteria 7838
36 Ga0070704_100114080 3300005549 Bacteria 2062
37 Ga0068855_100005045 3300005563 Bacteria 16111
38 Ga0068854_100002147 3300005578 Bacteria 12110
39 Ga0068854_100722020 3300005578 Bacteria 862
40 Ga0068856_100375560 3300005614 Bacteria 1440
41 Ga0070702_100061777 3300005615 Bacteria 2182
42 Ga0068852_100091893 3300005616 Bacteria 2717
43 Ga0068866_10527406 3300005718 Bacteria 786
44 Ga0068861_101848351 3300005719 Bacteria 600
45 Ga0068860_100141925 3300005843 Bacteria 2309
46 Ga0068860_100512904 3300005843 Bacteria 1198
47 Ga0081455_10231549 3300005937 Bacteria 1363
48 Ga0081538_10056039 3300005981 Bacteria 2313
49 Ga0070717_11166157 3300006028 Bacteria 701
50 Ga0075368_10390472 3300006042 Bacteria 610
51 Ga0070712_100167273 3300006175 Bacteria 1703
52 Ga0075428_100013619 3300006844 Bacteria 9056
53 Ga0075428_100508889 3300006844 Bacteria 1288
54 Ga0075430_100740594 3300006846 Bacteria 810
55 Ga0075434_100111371 3300006871 Bacteria 2748
56 Ga0075429_100024013 3300006880 Bacteria 5288
57 Ga0068865_100104645 3300006881 Bacteria 2078
58 Ga0068865_100161072 3300006881 Bacteria 1712
59 Ga0105240_10015709 3300009093 Bacteria 10273
60 Ga0111539_10001616 3300009094 Bacteria 30103
61 Ga0105245_10089591 3300009098 Bacteria 2828
62 Ga0105245_10098235 3300009098 Bacteria 2705
63 Ga0105245_10126667 3300009098 Bacteria 2391
64 Ga0105245_11025625 3300009098 Bacteria 870
65 Ga0105247_10200153 3300009101 Bacteria 1342
66 Ga0114129_10596526 3300009147 Bacteria 1432
67 Ga0105243_11676854 3300009148 Bacteria 664
68 Ga0105241_10005291 3300009174 Bacteria 9533
69 Ga0105242_10012561 3300009176 Bacteria 6521
70 Ga0105242_11583405 3300009176 Bacteria 688
71 Ga0105242_12087559 3300009176 Bacteria 610
72 Ga0105237_10008550 3300009545 Bacteria 11066
73 Ga0105238_10004485 3300009551 Bacteria 13832
74 Ga0105238_10634087 3300009551 Bacteria 1078
75 Ga0105249_10103884 3300009553 Bacteria 2677
76 Ga0105239_10090368 3300010375 Bacteria 3378
77 Ga0105239_10368229 3300010375 Bacteria 1624
78 Ga0105246_10215850 3300011119 Bacteria 1500
79 Ga0157374_10200504 3300013296 Bacteria 1954
80 Ga0157378_10731547 3300013297 Bacteria 1011
81 Ga0157378_12521926 3300013297 Bacteria 566
82 Ga0163162_10260175 3300013306 Bacteria 1867
83 Ga0163162_10760294 3300013306 Bacteria 1088
84 Ga0157375_10058587 3300013308 Bacteria 3811
85 Ga0157375_10374479 3300013308 Bacteria 1590
86 Ga0157375_10959129 3300013308 Bacteria 997
87 Ga0163163_10129525 3300014325 Bacteria 2563
88 Ga0157380_10161379 3300014326 Bacteria 1949
89 Ga0157380_10205212 3300014326 Bacteria 1752
90 Ga0157377_10270038 3300014745 Bacteria 1110
91 Ga0163161_10385406 3300017792 Bacteria 1121
92 Ga0197907_10297004 3300020069 Bacteria 2218
93 Ga0197907_10512154 3300020069 Bacteria 1479
94 Ga0197907_10534462 3300020069 Unclassified 582
95 Ga0206356_10185134 3300020070 Bacteria 694
96 Ga0206356_10614341 3300020070 Bacteria 1190
97 Ga0206356_11563406 3300020070 Bacteria 775
98 Ga0206349_1480386 3300020075 Bacteria 973
99 Ga0206351_10653132 3300020077 Bacteria 570
100 Ga0206351_10972084 3300020077 Bacteria 1054
101 Ga0206352_10677350 3300020078 Bacteria 1056
102 Ga0206350_10167564 3300020080 Bacteria 1038
103 Ga0206350_10653758 3300020080 Bacteria 1328
104 Ga0207642_10017655 3300025899 Bacteria 2720
105 Ga0207710_10157857 3300025900 Bacteria 1103
106 Ga0207647_10005937 3300025904 Bacteria 8902
107 Ga0207685_10047467 3300025905 Bacteria 1639
108 Ga0207699_10575420 3300025906 Bacteria 819
109 Ga0207654_10018748 3300025911 Bacteria 3637
110 Ga0207707_10162163 3300025912 Bacteria 1954
111 Ga0207695_10002866 3300025913 Bacteria 25047
112 Ga0207671_10003461 3300025914 Bacteria 15716
113 Ga0207693_10029230 3300025915 Bacteria 4355
114 Ga0207663_10023523 3300025916 Bacteria 3537
115 Ga0207660_10025601 3300025917 Bacteria 4007
116 Ga0207657_10139215 3300025919 Bacteria 1984
117 Ga0207652_10398266 3300025921 Bacteria 1242
118 Ga0207694_10000843 3300025924 Bacteria 27292
119 Ga0207687_10217480 3300025927 Bacteria 1502
120 Ga0207664_10269404 3300025929 Bacteria 1491
121 Ga0207690_10675867 3300025932 Bacteria 847
122 Ga0207686_10017644 3300025934 Bacteria 4025
123 Ga0207686_10671335 3300025934 Bacteria 821
124 Ga0207669_10320135 3300025937 Bacteria 1187
125 Ga0207704_10069407 3300025938 Bacteria 2227
126 Ga0207665_10250132 3300025939 Bacteria 1309
127 Ga0207711_10745928 3300025941 Bacteria 913
128 Ga0207679_11230236 3300025945 Bacteria 687
129 Ga0207712_10176524 3300025961 Bacteria 1674
130 Ga0207668_10709088 3300025972 Bacteria 885
131 Ga0207640_10553962 3300025981 Bacteria 966
132 Ga0207640_10690042 3300025981 Bacteria 874
133 Ga0207677_10411248 3300026023 Bacteria 1150
134 Ga0207677_10498584 3300026023 Bacteria 1052
135 Ga0207677_11609117 3300026023 Bacteria 601
136 Ga0207678_10384639 3300026067 Bacteria 1213
137 Ga0207708_10448491 3300026075 Bacteria 1074
138 Ga0207702_10596423 3300026078 Bacteria 1083
139 Ga0207683_10107754 3300026121 Bacteria 2493
140 Ga0207683_10110657 3300026121 Bacteria 2459
141 Ga0207683_11560244 3300026121 Bacteria 609
142 Ga0209813_10316220 3300027866 Bacteria 610
143 Ga0268266_10271164 3300028379 Bacteria 1575
144 Ga0268264_10850034 3300028381 Bacteria 914
145 Ga0307511_10259028 3300030521 Bacteria 827
146 Ga0307508_10015393 3300031616 Bacteria 6965
147 Ga0307514_10094252 3300031649 Bacteria 2171
148 Ga0307516_10064465 3300031730 Bacteria 3543
149 Ga0307413_10417192 3300031824 Bacteria 1056
150 Ga0307409_101292781 3300031995 Bacteria 754
151 Ga0307415_100739488 3300032126 Bacteria 892
152 Ga0307510_10091414 3300033180 Bacteria 2886
153 Ga0395898_0019382 3300037466 Bacteria 6924
154 Ga0395905_1005448 3300037471 Bacteria 737
155 Ga0439459_0121249 3300042438 Unclassified 659
156 Ga0466969_0010793 3300044656 Bacteria 4840
157 Ga0466972_0041368 3300044658 Bacteria 2244
158 Ga0466965_0006649 3300044683 Bacteria 5268
159 Ga0466965_0851907 3300044683 Bacteria 530
160 Ga0466961_0006855 3300044693 Bacteria 7245
161 Ga0466963_0000444 3300044694 Bacteria 19153
162 Ga0466971_0001558 3300044719 Bacteria 9681
163 Ga0466970_0000401 3300044765 Bacteria 21109
164 Ga0466970_0412164 3300044765 Bacteria 772
165 Ga0466957_0003261 3300044842 Bacteria 8885
166 Ga0466960_0054076 3300044901 Bacteria 1948
167 Ga0466959_0026621 3300045049 Bacteria 4286
168 Ga0466958_0008774 3300045836 Bacteria 5614
169 Ga0466958_0398804 3300045836 Bacteria 888
170 Ga0466967_0033488 3300045976 Bacteria 4350
171 Ga0466967_0360850 3300045976 Bacteria 1408
172 Ga0466967_2304074 3300045976 Bacteria 534
173 Ga0495603_0330125 3300046455 Bacteria 875
174 Ga0495629_0103161 3300046459 Bacteria 1990
175 Ga0495629_0118487 3300046459 Bacteria 1845
176 Ga0495629_0122436 3300046459 Bacteria 1812
177 Ga0495662_0032561 3300046476 Bacteria 2518
178 Ga0495588_0265602 3300046674 Bacteria 904
179 Ga0495647_0551823 3300046681 Bacteria 539
180 Ga0495658_0334076 3300046683 Bacteria 962
181 Ga0495613_0049034 3300046689 Bacteria 3117
182 Ga0495624_0338760 3300046690 Bacteria 905
183 Ga0495670_0584358 3300046691 Unclassified 608
184 Ga0495581_0406723 3300047315 Bacteria 794
185 Ga0495636_0261555 3300047318 Bacteria 802
186 Ga0495636_0297130 3300047318 Bacteria 755
187 Ga0495674_0557150 3300047319 Bacteria 912
188 Ga0495676_0136692 3300047321 Bacteria 1762
189 Ga0495687_001448 3300047443 Bacteria 21780
190 Ga0495685_081290 3300047447 Bacteria 1079
191 Ga0495602_0785847 3300048088 Bacteria 640
192 Ga0496100_0053313 3300048903 Bacteria 2633
193 Ga0496100_0111696 3300048903 Bacteria 1900
194 Ga0496100_0157372 3300048903 Bacteria 1626
195 Ga0496100_0902151 3300048903 Bacteria 694
196 Ga0496101_0024936 3300048904 Bacteria 4145
197 Ga0496101_0034754 3300048904 Bacteria 3563
198 Ga0496102_0013004 3300048905 Bacteria 7207
199 Ga0496102_0016839 3300048905 Bacteria 6395
200 Ga0496102_0097236 3300048905 Bacteria 2730
201 Ga0496103_0010971 3300048906 Bacteria 5363
202 Ga0496103_0697663 3300048906 Bacteria 643
203 Ga0496104_0050275 3300048907 Bacteria 3933
204 Ga0496104_0938940 3300048907 Bacteria 770
205 Ga0496105_0016948 3300048908 Bacteria 5829
206 Ga0496106_0002691 3300048909 Bacteria 13197
207 Ga0496107_0032034 3300048910 Bacteria 3755
208 Ga0496108_0172764 3300048911 Bacteria 1870
209 Ga0496108_1104233 3300048911 Bacteria 674
210 Ga0496109_0080754 3300048912 Bacteria 2996
211 Ga0496110_0012351 3300048913 Bacteria 7022
212 Ga0496111_0009460 3300048914 Bacteria 6507
213 Ga0496112_0266398 3300048915 Bacteria 1662
214 Ga0496114_0010677 3300048917 Bacteria 7309
215 Ga0496114_0120360 3300048917 Bacteria 2257
216 Ga0496114_0732748 3300048917 Bacteria 865
217 Ga0496115_0193473 3300048918 Bacteria 1680
218 Ga0496115_0510155 3300048918 Bacteria 965
219 Ga0501031_0020847 3300049568 Bacteria 4273
220 Ga0501031_0045362 3300049568 Bacteria 2868
221 Ga0501031_0081306 3300049568 Bacteria 2112
222 Ga0501031_0342910 3300049568 Bacteria 967
223 Ga0501031_0370573 3300049568 Bacteria 927
224 Ga0501032_0172876 3300049569 Bacteria 1416
225 Ga0501032_0745396 3300049569 Bacteria 620
226 Ga0501034_1597938 3300049571 Bacteria 525
227 Ga0501036_0003207 3300049572 Bacteria 13057
228 Ga0501036_0004567 3300049572 Bacteria 11185
229 Ga0501037_0084543 3300049573 Bacteria 2298
230 Ga0501037_0512428 3300049573 Bacteria 813
231 Ga0501037_0579271 3300049573 Bacteria 755
232 Ga0501038_0407279 3300049574 Bacteria 1051
233 Ga0501038_0498613 3300049574 Bacteria 931
234 Ga0501039_0038548 3300049575 Bacteria 3690
235 Ga0501039_0052454 3300049575 Bacteria 3156
236 Ga0501039_0085346 3300049575 Bacteria 2459
237 Ga0501039_0151789 3300049575 Bacteria 1820
238 Ga0501039_0211023 3300049575 Bacteria 1527
239 Ga0501039_0341673 3300049575 Bacteria 1176
240 Ga0501040_0004714 3300049576 Bacteria 8852
241 Ga0501040_0013229 3300049576 Bacteria 5428
242 Ga0501040_0106270 3300049576 Bacteria 1961
243 Ga0501040_0154842 3300049576 Bacteria 1618
244 Ga0501040_0440584 3300049576 Bacteria 937
245 Ga0501041_0005145 3300049577 Bacteria 7632
246 Ga0501041_0011743 3300049577 Bacteria 5184
247 Ga0501041_0081402 3300049577 Bacteria 1994
248 Ga0501041_0191179 3300049577 Bacteria 1282
249 Ga0501041_1090138 3300049577 Bacteria 515
250 Ga0501042_0014662 3300049578 Bacteria 5353
251 Ga0501042_0050578 3300049578 Bacteria 2964
252 Ga0501042_0067058 3300049578 Bacteria 2566
253 Ga0501042_0232701 3300049578 Bacteria 1329
254 Ga0501042_0248674 3300049578 Bacteria 1283
255 Ga0501046_0081364 3300049580 Bacteria 2501
256 Ga0501046_0151097 3300049580 Bacteria 1752
257 Ga0501046_0632597 3300049580 Bacteria 757
258 Ga0501048_0063319 3300049582 Archaea 2616
259 Ga0501048_0115953 3300049582 Bacteria 1892
260 Ga0501068_0022254 3300049584 Bacteria 3705
261 Ga0501068_0134053 3300049584 Bacteria 1550
262 Ga0501068_0455425 3300049584 Bacteria 828
263 Ga0501069_0048181 3300049585 Bacteria 2366
264 Ga0501070_0357401 3300049586 Bacteria 1185
265 Ga0501071_0004039 3300049587 Bacteria 9270
266 Ga0501071_0007562 3300049587 Bacteria 7153
267 Ga0501071_0046062 3300049587 Bacteria 3132
268 Ga0501071_0050077 3300049587 Bacteria 3009
269 Ga0501071_0188946 3300049587 Bacteria 1544
270 Ga0501071_0198676 3300049587 Bacteria 1506
271 Ga0501072_0007228 3300049588 Bacteria 8428
272 Ga0501072_0045408 3300049588 Bacteria 3455
273 Ga0501072_0065847 3300049588 Bacteria 2857
274 Ga0501072_0082435 3300049588 Bacteria 2550
275 Ga0501072_0104923 3300049588 Bacteria 2247
276 Ga0501072_0197882 3300049588 Bacteria 1602
277 Ga0501074_0098448 3300049590 Archaea 2093
278 Ga0501074_0194843 3300049590 Bacteria 1444
279 Ga0501074_0420499 3300049590 Bacteria 948
280 Ga0501074_0862855 3300049590 Bacteria 637
281 Ga0501075_0033824 3300049591 Bacteria 3803
282 Ga0501075_0045851 3300049591 Bacteria 3282
283 Ga0501075_0055089 3300049591 Bacteria 2992
284 Ga0501075_0057479 3300049591 Bacteria 2929
285 Ga0501075_0064148 3300049591 Bacteria 2770
286 Ga0501076_0003091 3300049592 Bacteria 11593
287 Ga0501076_0011697 3300049592 Bacteria 6551
288 Ga0501076_0032273 3300049592 Bacteria 4086
289 Ga0501076_0251941 3300049592 Bacteria 1445
290 Ga0501076_0370820 3300049592 Unclassified 1176
291 Ga0501077_0022500 3300049593 Bacteria 3993
292 Ga0501077_0046044 3300049593 Bacteria 2772
293 Ga0501077_0096428 3300049593 Archaea 1874
294 Ga0501079_0001990 3300049741 Bacteria 14634
295 Ga0501079_0008719 3300049741 Bacteria 7686
296 Ga0501079_0056089 3300049741 Bacteria 3040
297 Ga0501079_0110025 3300049741 Bacteria 2140
298 Ga0501079_0174013 3300049741 Bacteria 1679
299 Ga0501079_1081180 3300049741 Bacteria 632
300 Ga0501080_0150224 3300049742 Bacteria 2153
301 Ga0501080_0333306 3300049742 Bacteria 1372
302 Ga0501081_0006069 3300049743 Bacteria 7830
303 Ga0501081_0013042 3300049743 Bacteria 5468
304 Ga0501081_0109562 3300049743 Bacteria 1959
305 Ga0501081_0220199 3300049743 Bacteria 1380
306 Ga0501081_0254855 3300049743 Bacteria 1281
307 Ga0501081_0689861 3300049743 Bacteria 766
308 Ga0501035_0018280 3300049822 Bacteria 6458
309 Ga0501035_0177596 3300049822 Archaea 1836
310 Ga0501044_0373602 3300049823 Bacteria 1342
311 Ga0501045_0026104 3300049824 Bacteria 4199
312 Ga0501045_0040217 3300049824 Bacteria 3403
313 Ga0501045_0040746 3300049824 Bacteria 3379
314 Ga0501045_0209923 3300049824 Bacteria 1450
315 Ga0501212_033664 3300049851 Bacteria 833
316 nmdc:mga0yw44_584667_c1 3300050492 Bacteria 758
317 nmdc:mga04h51_350723_c1 3300050495 Bacteria 610
318 nmdc:mga05p37_398293_c1 3300050507 Bacteria 1608
319 nmdc:mga05p37_955517_c1 3300050507 Bacteria 916
320 nmdc:mga09592_272231_c1 3300050508 Bacteria 1469
321 nmdc:mga0qj67_1146769_c1 3300050509 Bacteria 606
322 nmdc:mga0n895_124954_c1 3300050512 Bacteria 2596
323 Ga0500650_0228794 3300053098 Bacteria 839
324 Ga0500556_0000758 3300053104 Bacteria 19238
325 Ga0500616_0097922 3300053153 Bacteria 1439
326 Ga0501084_0000970 3300054114 Bacteria 22234
327 Ga0501084_0078272 3300054114 Bacteria 2771
328 Ga0501084_0134221 3300054114 Bacteria 2083
329 Ga0501084_0247483 3300054114 Bacteria 1505
330 Ga0501084_0339740 3300054114 Bacteria 1268
331 Ga0501082_0002980 3300060353 Bacteria 14791
332 Ga0501082_0052416 3300060353 Bacteria 3517
333 Ga0501082_0088256 3300060353 Archaea 2676
334 Ga0501082_0376129 3300060353 Bacteria 1239
335 Ga0501082_1566072 3300060353 Unclassified 575
336 Ga0466962_0003512 3300061719 Bacteria 7468
337 Ga0530510_0006624 3300061734 Bacteria 8077
338 Ga0530510_0010085 3300061734 Bacteria 6622
339 Ga0530510_0013177 3300061734 Bacteria 5815
340 Ga0530510_0014614 3300061734 Bacteria 5541
341 Ga0530510_0052117 3300061734 Bacteria 2957
342 2644390327 2643221670 Bacteria 6497041
343 2811846372 2808606982 Bacteria 7791042
344 2918508673 2918501144 Bacteria 8668083
345 2919715185 2919713450 Bacteria 7431245
346 8056836195 8056829672 Bacteria 9045328
347 Ga0451800_1552548
348 Ga0007429J51699_1040613
349 Ga0058863_11616227
350 Ga0058861_11749994
351 Ga0058862_12750405
352 Ga0070658_10215636
353 Ga0070680_100010274
354 Ga0070682_100195889
355 Ga0068868_100305115
356 Ga0068868_102087016
357 Ga0070660_100136718
358 Ga0070660_101312830
359 Ga0070692_11117694
360 Ga0070668_100573309
361 Ga0070668_101169060
362 Ga0070674_100136955
363 Ga0070674_100436513
364 Ga0070714_100050070
365 Ga0070710_10490802
366 Ga0070705_100122818
367 Ga0070700_100168240
368 Ga0070700_100381560
369 Ga0070663_100160702
370 Ga0070663_100419441
371 Ga0070678_100057056
372 Ga0070681_10873909
373 Ga0070685_10095794
374 Ga0070699_100000026
375 Ga0070679_100029096
376 Ga0068853_101752272
377 Ga0070686_100707228
378 Ga0070686_101075780
379 Ga0070695_100666213
380 Ga0070696_100117409
381 Ga0070665_100014771
382 Ga0070704_100114080
383 Ga0068855_100005045
384 Ga0068854_100002147
385 Ga0068854_100722020
386 Ga0068856_100375560
387 Ga0070702_100061777
388 Ga0068852_100091893
389 Ga0068866_10527406
390 Ga0068861_101848351
391 Ga0068860_100141925
392 Ga0068860_100512904
393 Ga0081455_10231549
394 Ga0081538_10056039
395 Ga0070717_11166157
396 Ga0075368_10390472
397 Ga0070712_100167273
398 Ga0075428_100013619
399 Ga0075428_100508889
400 Ga0075430_100740594
401 Ga0075434_100111371
402 Ga0075429_100024013
403 Ga0068865_100104645
404 Ga0068865_100161072
405 Ga0105240_10015709
406 Ga0111539_10001616
407 Ga0105245_10089591
408 Ga0105245_10098235
409 Ga0105245_10126667
410 Ga0105245_11025625
411 Ga0105247_10200153
412 Ga0114129_10596526
413 Ga0105243_11676854
414 Ga0105241_10005291
415 Ga0105242_10012561
416 Ga0105242_11583405
417 Ga0105242_12087559
418 Ga0105237_10008550
419 Ga0105238_10004485
420 Ga0105238_10634087
421 Ga0105249_10103884
422 Ga0105239_10090368
423 Ga0105239_10368229
424 Ga0105246_10215850
425 Ga0157374_10200504
426 Ga0157378_10731547
427 Ga0157378_12521926
428 Ga0163162_10260175
429 Ga0163162_10760294
430 Ga0157375_10058587
431 Ga0157375_10374479
432 Ga0157375_10959129
433 Ga0163163_10129525
434 Ga0157380_10161379
435 Ga0157380_10205212
436 Ga0157377_10270038
437 Ga0163161_10385406
438 Ga0197907_10297004
439 Ga0197907_10512154
440 Ga0197907_10534462
441 Ga0206356_10185134
442 Ga0206356_10614341
443 Ga0206356_11563406
444 Ga0206349_1480386
445 Ga0206351_10653132
446 Ga0206351_10972084
447 Ga0206352_10677350
448 Ga0206350_10167564
449 Ga0206350_10653758
450 Ga0207642_10017655
451 Ga0207710_10157857
452 Ga0207647_10005937
453 Ga0207685_10047467
454 Ga0207699_10575420
455 Ga0207654_10018748
456 Ga0207707_10162163
457 Ga0207695_10002866
458 Ga0207671_10003461
459 Ga0207693_10029230
460 Ga0207663_10023523
461 Ga0207660_10025601
462 Ga0207657_10139215
463 Ga0207652_10398266
464 Ga0207694_10000843
465 Ga0207687_10217480
466 Ga0207664_10269404
467 Ga0207690_10675867
468 Ga0207686_10017644
469 Ga0207686_10671335
470 Ga0207669_10320135
471 Ga0207704_10069407
472 Ga0207665_10250132
473 Ga0207711_10745928
474 Ga0207679_11230236
475 Ga0207712_10176524
476 Ga0207668_10709088
477 Ga0207640_10553962
478 Ga0207640_10690042
479 Ga0207677_10411248
480 Ga0207677_10498584
481 Ga0207677_11609117
482 Ga0207678_10384639
483 Ga0207708_10448491
484 Ga0207702_10596423
485 Ga0207683_10107754
486 Ga0207683_10110657
487 Ga0207683_11560244
488 Ga0209813_10316220
489 Ga0268266_10271164
490 Ga0268264_10850034
491 Ga0307511_10259028
492 Ga0307508_10015393
493 Ga0307514_10094252
494 Ga0307516_10064465
495 Ga0307413_10417192
496 Ga0307409_101292781
497 Ga0307415_100739488
498 Ga0307510_10091414
499 Ga0395898_0019382
500 Ga0395905_1005448
501 Ga0439459_0121249
502 Ga0466969_0010793
503 Ga0466972_0041368
504 Ga0466965_0006649
505 Ga0466965_0851907
506 Ga0466961_0006855
507 Ga0466963_0000444
508 Ga0466971_0001558
509 Ga0466970_0000401
510 Ga0466970_0412164
511 Ga0466957_0003261
512 Ga0466960_0054076
513 Ga0466959_0026621
514 Ga0466958_0008774
515 Ga0466958_0398804
516 Ga0466967_0033488
517 Ga0466967_0360850
518 Ga0466967_2304074
519 Ga0495603_0330125
520 Ga0495629_0103161
521 Ga0495629_0118487
522 Ga0495629_0122436
523 Ga0495662_0032561
524 Ga0495588_0265602
525 Ga0495647_0551823
526 Ga0495658_0334076
527 Ga0495613_0049034
528 Ga0495624_0338760
529 Ga0495670_0584358
530 Ga0495581_0406723
531 Ga0495636_0261555
532 Ga0495636_0297130
533 Ga0495674_0557150
534 Ga0495676_0136692
535 Ga0495687_001448
536 Ga0495685_081290
537 Ga0495602_0785847
538 Ga0496100_0053313
539 Ga0496100_0111696
540 Ga0496100_0157372
541 Ga0496100_0902151
542 Ga0496101_0024936
543 Ga0496101_0034754
544 Ga0496102_0013004
545 Ga0496102_0016839
546 Ga0496102_0097236
547 Ga0496103_0010971
548 Ga0496103_0697663
549 Ga0496104_0050275
550 Ga0496104_0938940
551 Ga0496105_0016948
552 Ga0496106_0002691
553 Ga0496107_0032034
554 Ga0496108_0172764
555 Ga0496108_1104233
556 Ga0496109_0080754
557 Ga0496110_0012351
558 Ga0496111_0009460
559 Ga0496112_0266398
560 Ga0496114_0010677
561 Ga0496114_0120360
562 Ga0496114_0732748
563 Ga0496115_0193473
564 Ga0496115_0510155
565 Ga0501031_0020847
566 Ga0501031_0045362
567 Ga0501031_0081306
568 Ga0501031_0342910
569 Ga0501031_0370573
570 Ga0501032_0172876
571 Ga0501032_0745396
572 Ga0501034_1597938
573 Ga0501036_0003207
574 Ga0501036_0004567
575 Ga0501037_0084543
576 Ga0501037_0512428
577 Ga0501037_0579271
578 Ga0501038_0407279
579 Ga0501038_0498613
580 Ga0501039_0038548
581 Ga0501039_0052454
582 Ga0501039_0085346
583 Ga0501039_0151789
584 Ga0501039_0211023
585 Ga0501039_0341673
586 Ga0501040_0004714
587 Ga0501040_0013229
588 Ga0501040_0106270
589 Ga0501040_0154842
590 Ga0501040_0440584
591 Ga0501041_0005145
592 Ga0501041_0011743
593 Ga0501041_0081402
594 Ga0501041_0191179
595 Ga0501041_1090138
596 Ga0501042_0014662
597 Ga0501042_0050578
598 Ga0501042_0067058
599 Ga0501042_0232701
600 Ga0501042_0248674
601 Ga0501046_0081364
602 Ga0501046_0151097
603 Ga0501046_0632597
604 Ga0501048_0063319
605 Ga0501048_0115953
606 Ga0501068_0022254
607 Ga0501068_0134053
608 Ga0501068_0455425
609 Ga0501069_0048181
610 Ga0501070_0357401
611 Ga0501071_0004039
612 Ga0501071_0007562
613 Ga0501071_0046062
614 Ga0501071_0050077
615 Ga0501071_0188946
616 Ga0501071_0198676
617 Ga0501072_0007228
618 Ga0501072_0045408
619 Ga0501072_0065847
620 Ga0501072_0082435
621 Ga0501072_0104923
622 Ga0501072_0197882
623 Ga0501074_0098448
624 Ga0501074_0194843
625 Ga0501074_0420499
626 Ga0501074_0862855
627 Ga0501075_0033824
628 Ga0501075_0045851
629 Ga0501075_0055089
630 Ga0501075_0057479
631 Ga0501075_0064148
632 Ga0501076_0003091
633 Ga0501076_0011697
634 Ga0501076_0032273
635 Ga0501076_0251941
636 Ga0501076_0370820
637 Ga0501077_0022500
638 Ga0501077_0046044
639 Ga0501077_0096428
640 Ga0501079_0001990
641 Ga0501079_0008719
642 Ga0501079_0056089
643 Ga0501079_0110025
644 Ga0501079_0174013
645 Ga0501079_1081180
646 Ga0501080_0150224
647 Ga0501080_0333306
648 Ga0501081_0006069
649 Ga0501081_0013042
650 Ga0501081_0109562
651 Ga0501081_0220199
652 Ga0501081_0254855
653 Ga0501081_0689861
654 Ga0501035_0018280
655 Ga0501035_0177596
656 Ga0501044_0373602
657 Ga0501045_0026104
658 Ga0501045_0040217
659 Ga0501045_0040746
660 Ga0501045_0209923
661 Ga0501212_033664
662 nmdc:mga0yw44_584667_c1
663 nmdc:mga04h51_350723_c1
664 nmdc:mga05p37_398293_c1
665 nmdc:mga05p37_955517_c1
666 nmdc:mga09592_272231_c1
667 nmdc:mga0qj67_1146769_c1
668 nmdc:mga0n895_124954_c1
669 Ga0500650_0228794
670 Ga0500556_0000758
671 Ga0500616_0097922
672 Ga0501084_0000970
673 Ga0501084_0078272
674 Ga0501084_0134221
675 Ga0501084_0247483
676 Ga0501084_0339740
677 Ga0501082_0002980
678 Ga0501082_0052416
679 Ga0501082_0088256
680 Ga0501082_0376129
681 Ga0501082_1566072
682 Ga0466962_0003512
683 Ga0530510_0006624
684 Ga0530510_0010085
685 Ga0530510_0013177
686 Ga0530510_0014614
687 Ga0530510_0052117
688 2644390327
689 2811846372
690 2918508673
691 2919715185
692 8056836195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19850

DUF6325

Family of unknown function (DUF6325)

22

161

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gs0-assembly2.cif.gz_L crystal structure of the complex of tlr3 and bi-specific diabody 0.58 38 59
6ey6-assembly3.cif.gz_F c-terminal part (residues 315-516) of porm with the llama nanobody nb130 0.5518 40 58
6ey5-assembly1.cif.gz_A c-terminal part (residues 224-515) of porm 0.5453 40 58
3lou-assembly1.cif.gz_B crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.5415 10 119
7dl8-assembly1.cif.gz_C crystal structure of alba1 from trypanosoma brucei 0.5248 4 120
ID Description Score Start End Superfamily
af_Q5A3N2_457_547_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.715 45 59 3.10.20.90
4e2uA00 Mainly Beta;Beta Complex;Endonuclease - Pi-scei; Chain A, domain 1;Hedgehog/Intein (Hint) domain 0.5883 40 58 2.170.16.10
af_P0C130_20_124_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.5712 44 74 3.10.20.90
1iyjD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.5467 41 62 2.40.50.140
3louD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5403 10 119 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A1G6K4S2-F1-model_v4 DUF1269 domain-containing protein 0.9687 2 142
AF-K4QWD9-F1-model_v4 DUF1269 domain-containing protein 0.9611 2 145
AF-A0A3G4W275-F1-model_v4 DUF1269 domain-containing protein 0.9601 4 148
AF-A0A853A5B7-F1-model_v4 deleted 0.9591 7 143
AF-F4H0Y0-F1-model_v4 DUF1269 domain-containing protein 0.959 3 143

Map