F416826

General Info

Members Datasets Scaffolds Average Seq Length
346 220 345 212

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0167353|Ga0373955_0167353_249_1001
Length 250
Sequence VAFAALRYNFGNALRRAVQAGLVNAGLCPLYSAQTSFEDLMYTLYSDQRSGNSYKVRLALARLGIPFKLVEVDILQGASRTPEFLAKNPNGHVPLLEVAPDRYLPESNAILWYVAGGTTLAPEDRIDRAEAMQWMFFEQHSLEPNIGAAYFWLALVKGGRDLQQHALEDWMENGYRALGVMEKHLAGHLYFAANHFTIADIALYAYTHVANQADFDLVRYPAIRAWLARVEAEPGHVAMDWQPEALTAAQ

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
119 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
216 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.16
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.34
Nodule 0
Rhizoplane 10.4
Rhizosphere 82.95
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10050036 3300005327 Bacteria 3386
2 Ga0070683_100077591 3300005329 Bacteria 3106
3 Ga0070680_100063437 3300005336 Bacteria 3026
4 Ga0070680_100110915 3300005336 Bacteria 2284
5 Ga0070680_100129484 3300005336 Bacteria 2110
6 Ga0070682_100049029 3300005337 Bacteria 2631
7 Ga0068868_100012694 3300005338 Bacteria 6162
8 Ga0070671_100237224 3300005355 Bacteria 1548
9 Ga0070688_100219247 3300005365 Bacteria 1340
10 Ga0070709_10080946 3300005434 Bacteria 2118
11 Ga0070709_10139723 3300005434 Bacteria 1663
12 Ga0070709_10238051 3300005434 Bacteria 1306
13 Ga0070714_100020969 3300005435 Bacteria 5342
14 Ga0070714_100035900 3300005435 Bacteria 4155
15 Ga0070713_100001505 3300005436 Bacteria 14853
16 Ga0070710_10010638 3300005437 Bacteria 4524
17 Ga0070710_10055139 3300005437 Bacteria 2245
18 Ga0070710_10082544 3300005437 Bacteria 1879
19 Ga0070711_100076412 3300005439 Bacteria 2374
20 Ga0070711_100206947 3300005439 Bacteria 1517
21 Ga0070708_100433975 3300005445 Bacteria 1239
22 Ga0070681_10043190 3300005458 Bacteria 4516
23 Ga0070681_10232779 3300005458 Bacteria 1757
24 Ga0070681_10343175 3300005458 Bacteria 1403
25 Ga0070679_100078708 3300005530 Bacteria 3285
26 Ga0070679_100270184 3300005530 Bacteria 1654
27 Ga0070679_100316001 3300005530 Bacteria 1511
28 Ga0070684_100349682 3300005535 Bacteria 1359
29 Ga0068853_100567844 3300005539 Bacteria 1076
30 Ga0070693_100047197 3300005547 Bacteria 2450
31 Ga0068855_100083049 3300005563 Bacteria 3711
32 Ga0068855_100243941 3300005563 Bacteria 2006
33 Ga0068855_100484673 3300005563 Bacteria 1346
34 Ga0068856_100343102 3300005614 Bacteria 1512
35 Ga0068856_100449788 3300005614 Bacteria 1309
36 Ga0068859_100477736 3300005617 Bacteria 1342
37 Ga0068864_100210260 3300005618 Bacteria 1791
38 Ga0081455_10001269 3300005937 Bacteria 31519
39 Ga0081455_10026313 3300005937 Bacteria 5354
40 Ga0081538_10014865 3300005981 Bacteria 6065
41 Ga0081538_10041813 3300005981 Bacteria 2902
42 Ga0081539_10027335 3300005985 Bacteria 3616
43 Ga0075363_100037429 3300006048 Bacteria 2548
44 Ga0075364_10172367 3300006051 Bacteria 1463
45 Ga0070715_10130678 3300006163 Bacteria 1208
46 Ga0070712_100000431 3300006175 Bacteria 23938
47 Ga0070712_100014807 3300006175 Bacteria 5011
48 Ga0070712_100115698 3300006175 Bacteria 2010
49 Ga0075362_10014500 3300006177 Bacteria 3183
50 Ga0075367_10000772 3300006178 Bacteria 12545
51 Ga0075366_10400281 3300006195 Bacteria 845
52 Ga0075370_10112629 3300006353 Bacteria 1581
53 Ga0075428_100583221 3300006844 Bacteria 1195
54 Ga0075430_100125143 3300006846 Bacteria 2143
55 Ga0075431_100190487 3300006847 Bacteria 2101
56 Ga0075434_100987496 3300006871 Bacteria 856
57 Ga0075429_100168169 3300006880 Bacteria 1921
58 Ga0075436_100143668 3300006914 Bacteria 1678
59 Ga0097620_100477659 3300006931 Bacteria 1342
60 Ga0105240_10110698 3300009093 Bacteria 3324
61 Ga0105245_10162841 3300009098 Bacteria 2118
62 Ga0105247_10577226 3300009101 Bacteria 830
63 Ga0105241_10077525 3300009174 Bacteria 2594
64 Ga0105242_10124437 3300009176 Bacteria 2218
65 Ga0105248_10266559 3300009177 Bacteria 1928
66 Ga0105238_10039889 3300009551 Bacteria 4759
67 Ga0105246_10318151 3300011119 Bacteria 1263
68 Ga0105246_10710506 3300011119 Bacteria 882
69 Ga0157373_10052062 3300013100 Bacteria 2914
70 Ga0157371_10012852 3300013102 Bacteria 6376
71 Ga0157371_10140687 3300013102 Bacteria 1719
72 Ga0157370_10047002 3300013104 Bacteria 4138
73 Ga0157370_10177187 3300013104 Bacteria 1982
74 Ga0157369_10262301 3300013105 Bacteria 1802
75 Ga0157372_10063974 3300013307 Bacteria 4126
76 Ga0157372_10243489 3300013307 Bacteria 2087
77 Ga0157372_10283570 3300013307 Bacteria 1926
78 Ga0206353_10247202 3300020082 Bacteria 1665
79 Ga0213876_10051969 3300021384 Bacteria 2166
80 Ga0207692_10032536 3300025898 Bacteria 2507
81 Ga0207692_10045545 3300025898 Bacteria 2195
82 Ga0207692_10052767 3300025898 Bacteria 2067
83 Ga0207692_10151142 3300025898 Bacteria 1330
84 Ga0207699_10244241 3300025906 Bacteria 1235
85 Ga0207705_10122842 3300025909 Bacteria 1928
86 Ga0207705_10314072 3300025909 Bacteria 1203
87 Ga0207707_10049410 3300025912 Bacteria 3664
88 Ga0207707_10267474 3300025912 Bacteria 1482
89 Ga0207695_10268613 3300025913 Bacteria 1602
90 Ga0207693_10001247 3300025915 Bacteria 22646
91 Ga0207693_10012988 3300025915 Bacteria 6719
92 Ga0207693_10038386 3300025915 Bacteria 3772
93 Ga0207693_10063176 3300025915 Bacteria 2901
94 Ga0207693_10169909 3300025915 Bacteria 1717
95 Ga0207663_10055019 3300025916 Bacteria 2495
96 Ga0207663_10114865 3300025916 Bacteria 1833
97 Ga0207660_10027077 3300025917 Bacteria 3908
98 Ga0207660_10065007 3300025917 Bacteria 2634
99 Ga0207660_10199903 3300025917 Bacteria 1561
100 Ga0207652_10002869 3300025921 Bacteria 14429
101 Ga0207652_10091417 3300025921 Bacteria 2676
102 Ga0207652_10449294 3300025921 Bacteria 1162
103 Ga0207687_10230538 3300025927 Bacteria 1463
104 Ga0207700_10046449 3300025928 Bacteria 3211
105 Ga0207700_10169136 3300025928 Bacteria 1822
106 Ga0207700_10837608 3300025928 Bacteria 823
107 Ga0207664_10028547 3300025929 Bacteria 4241
108 Ga0207664_10451584 3300025929 Bacteria 1147
109 Ga0207690_10777835 3300025932 Bacteria 790
110 Ga0207665_10082468 3300025939 Bacteria 2216
111 Ga0207711_10590215 3300025941 Bacteria 1036
112 Ga0207689_10304488 3300025942 Bacteria 1321
113 Ga0207661_10149000 3300025944 Bacteria 2021
114 Ga0207667_10036135 3300025949 Bacteria 5297
115 Ga0207667_10044509 3300025949 Bacteria 4703
116 Ga0207667_10475815 3300025949 Bacteria 1268
117 Ga0207640_10403594 3300025981 Bacteria 1114
118 Ga0207677_10180687 3300026023 Bacteria 1659
119 Ga0207639_10224628 3300026041 Bacteria 1624
120 Ga0207702_10432466 3300026078 Bacteria 1274
121 Ga0207648_10728523 3300026089 Bacteria 920
122 Ga0207676_10347732 3300026095 Bacteria 1370
123 Ga0207674_10841543 3300026116 Bacteria 885
124 Ga0207698_10336958 3300026142 Bacteria 1419
125 Ga0207698_10582357 3300026142 Bacteria 1101
126 Ga0265357_1003967 3300028023 Bacteria 1311
127 Ga0265337_1003538 3300028556 Bacteria 6733
128 Ga0265338_10079308 3300028800 Bacteria 2763
129 Ga0265338_10651361 3300028800 Bacteria 730
130 Ga0265763_1001604 3300030763 Bacteria 1638
131 Ga0265771_1008881 3300031010 Bacteria 712
132 Ga0265760_10048397 3300031090 Bacteria 1277
133 Ga0265330_10040576 3300031235 Bacteria 2066
134 Ga0265325_10001627 3300031241 Bacteria 15649
135 Ga0265325_10014461 3300031241 Bacteria 4458
136 Ga0265340_10070739 3300031247 Bacteria 1654
137 Ga0265340_10302813 3300031247 Bacteria 709
138 Ga0265339_10085858 3300031249 Bacteria 1656
139 Ga0265339_10263310 3300031249 Bacteria 831
140 Ga0265316_10402157 3300031344 Bacteria 986
141 Ga0265313_10010440 3300031595 Bacteria 5870
142 Ga0265313_10011381 3300031595 Bacteria 5538
143 Ga0265313_10034899 3300031595 Bacteria 2538
144 Ga0265313_10129505 3300031595 Bacteria 1095
145 Ga0265342_10000321 3300031712 Bacteria 54074
146 Ga0265342_10082227 3300031712 Bacteria 1858
147 Ga0373936_0035238 3300035113 Bacteria 1992
148 Ga0373945_0056340 3300035116 Bacteria 1458
149 Ga0373953_0038829 3300035117 Bacteria 1885
150 Ga0373954_0002982 3300035118 Bacteria 7141
151 Ga0373956_0024735 3300035119 Bacteria 2590
152 Ga0373957_0008142 3300035120 Bacteria 3385
153 Ga0373943_0044970 3300035170 Bacteria 2150
154 Ga0373946_0175870 3300035171 Bacteria 1013
155 Ga0373955_0004927 3300035172 Bacteria 5957
156 Ga0373955_0167353 3300035172 Bacteria 1300
157 Ga0373955_0279010 3300035172 Bacteria 1005
158 Ga0373924_0031920 3300035410 Bacteria 2120
159 Ga0373924_0109490 3300035410 Bacteria 1193
160 Ga0373935_0733896 3300035692 Unclassified 727
161 Ga0373933_0003720 3300035724 Bacteria 8432
162 Ga0373933_0006185 3300035724 Bacteria 6516
163 Ga0373947_0034631 3300035725 Bacteria 2987
164 Ga0373947_0118089 3300035725 Bacteria 1683
165 Ga0373937_0001774 3300036401 Bacteria 18124
166 Ga0373937_0004840 3300036401 Bacteria 11443
167 Ga0373937_0018606 3300036401 Bacteria 6205
168 Ga0373937_0019286 3300036401 Bacteria 6104
169 Ga0373937_0057659 3300036401 Bacteria 3568
170 Ga0395899_0075718 3300037312 Bacteria 2457
171 Ga0395899_0076877 3300037312 Bacteria 2436
172 Ga0395900_0013242 3300037418 Bacteria 8429
173 Ga0395900_0046811 3300037418 Bacteria 4453
174 Ga0395900_0115788 3300037418 Bacteria 2751
175 Ga0395898_0004026 3300037466 Bacteria 16158
176 Ga0395898_0049270 3300037466 Bacteria 4127
177 Ga0395898_0130619 3300037466 Bacteria 2406
178 Ga0436364_0309040 3300037853 Bacteria 2763
179 Ga0436364_1106244 3300037853 Bacteria 1087
180 Ga0395901_0035858 3300038443 Bacteria 5125
181 Ga0395901_0037404 3300038443 Bacteria 5020
182 Ga0395901_0264369 3300038443 Bacteria 1790
183 Ga0395901_0710086 3300038443 Bacteria 1002
184 Ga0436365_0856205 3300039437 Bacteria 4947
185 Ga0436365_1375681 3300039437 Bacteria 3103
186 Ga0436365_1860416 3300039437 Bacteria 1647
187 Ga0436363_1461177 3300039450 Bacteria 706
188 Ga0439431_0095588 3300041997 Bacteria 813
189 Ga0439455_0023686 3300042012 Bacteria 1480
190 Ga0439440_0022628 3300042993 Bacteria 1426
191 Ga0466966_0061801 3300044684 Bacteria 2362
192 Ga0466961_0110261 3300044693 Bacteria 1732
193 Ga0466963_0000930 3300044694 Bacteria 14954
194 Ga0466963_0331824 3300044694 Bacteria 1071
195 Ga0466957_0016561 3300044842 Bacteria 4311
196 Ga0466957_0244101 3300044842 Bacteria 1192
197 Ga0466959_0180743 3300045049 Bacteria 1475
198 Ga0466958_0140433 3300045836 Bacteria 1520
199 Ga0466967_0001436 3300045976 Bacteria 13829
200 Ga0495592_0034707 3300046454 Bacteria 3801
201 Ga0495590_0054343 3300046457 Bacteria 1399
202 Ga0495641_0252306 3300046461 Bacteria 793
203 Ga0495653_0098341 3300046463 Bacteria 2125
204 Ga0495580_0047140 3300046472 Bacteria 3056
205 Ga0495582_0092265 3300046473 Bacteria 1689
206 Ga0495664_0050236 3300046477 Bacteria 2476
207 Ga0495584_0003721 3300046491 Bacteria 8317
208 Ga0495608_0110978 3300046511 Bacteria 1763
209 Ga0495618_0098783 3300046514 Bacteria 1868
210 Ga0495628_0012617 3300046516 Bacteria 7119
211 Ga0495630_0025874 3300046517 Bacteria 4342
212 Ga0495637_0096734 3300046520 Bacteria 1158
213 Ga0495652_0007442 3300046529 Bacteria 10094
214 Ga0495652_0162546 3300046529 Bacteria 1732
215 Ga0495665_0290966 3300046531 Bacteria 837
216 Ga0495640_0102235 3300046533 Bacteria 1880
217 Ga0495586_0183166 3300046535 Bacteria 1185
218 Ga0495587_0025448 3300046536 Bacteria 3616
219 Ga0495645_0026702 3300046543 Bacteria 4192
220 Ga0495667_0006729 3300046559 Bacteria 7798
221 Ga0495634_0032733 3300046642 Bacteria 3574
222 Ga0495611_0224703 3300046648 Bacteria 873
223 Ga0495657_0070451 3300046675 Bacteria 2285
224 Ga0495657_0083536 3300046675 Bacteria 2061
225 Ga0495623_0030043 3300046679 Bacteria 3497
226 Ga0495658_0016021 3300046683 Bacteria 3856
227 Ga0495613_0040061 3300046689 Bacteria 3472
228 Ga0495613_0122891 3300046689 Bacteria 1863
229 Ga0495670_0232873 3300046691 Bacteria 980
230 Ga0495600_0000619 3300046809 Bacteria 18337
231 Ga0495600_0029323 3300046809 Bacteria 3562
232 Ga0495604_0033522 3300047317 Bacteria 4065
233 Ga0495604_0075668 3300047317 Bacteria 2535
234 Ga0495674_0051637 3300047319 Bacteria 3624
235 Ga0495674_0067464 3300047319 Bacteria 3099
236 Ga0495674_0193988 3300047319 Bacteria 1687
237 Ga0495672_0037025 3300047320 Bacteria 2990
238 Ga0495672_0236945 3300047320 Bacteria 893
239 Ga0495680_0002014 3300047322 Bacteria 21314
240 Ga0495680_0019403 3300047322 Bacteria 5739
241 Ga0495675_0049832 3300047444 Bacteria 2661
242 Ga0495684_0378993 3300047471 Bacteria 998
243 Ga0495593_0079953 3300047673 Bacteria 1692
244 Ga0495602_0144805 3300048088 Bacteria 1876
245 Ga0495602_0250173 3300048088 Bacteria 1321
246 Ga0496100_0003609 3300048903 Bacteria 8075
247 Ga0496101_0008473 3300048904 Bacteria 6717
248 Ga0496101_0106912 3300048904 Bacteria 2101
249 Ga0496101_0182744 3300048904 Bacteria 1615
250 Ga0496102_0255367 3300048905 Bacteria 1652
251 Ga0496102_0386622 3300048905 Bacteria 1316
252 Ga0496104_0000878 3300048907 Bacteria 25861
253 Ga0496104_0004463 3300048907 Bacteria 12190
254 Ga0496104_0044492 3300048907 Bacteria 4171
255 Ga0496104_0066311 3300048907 Bacteria 3427
256 Ga0496104_0116848 3300048907 Bacteria 2560
257 Ga0496104_0146312 3300048907 Bacteria 2269
258 Ga0496105_0000170 3300048908 Bacteria 43535
259 Ga0496105_0011898 3300048908 Bacteria 6890
260 Ga0496105_0037792 3300048908 Bacteria 3976
261 Ga0496106_0005621 3300048909 Bacteria 9277
262 Ga0496107_0007150 3300048910 Bacteria 7692
263 Ga0496107_0466095 3300048910 Bacteria 938
264 Ga0496108_0119096 3300048911 Bacteria 2264
265 Ga0496108_0208889 3300048911 Bacteria 1694
266 Ga0496109_0002491 3300048912 Bacteria 15432
267 Ga0496109_0002725 3300048912 Bacteria 14810
268 Ga0496109_0074685 3300048912 Bacteria 3117
269 Ga0496109_0175733 3300048912 Bacteria 2010
270 Ga0496110_0008692 3300048913 Bacteria 8177
271 Ga0496110_0021478 3300048913 Bacteria 5466
272 Ga0496110_0436069 3300048913 Bacteria 1194
273 Ga0496110_0505030 3300048913 Bacteria 1101
274 Ga0496111_0020095 3300048914 Bacteria 4645
275 Ga0496112_0095232 3300048915 Bacteria 2948
276 Ga0496112_0492700 3300048915 Bacteria 1161
277 Ga0496113_0058110 3300048916 Bacteria 2909
278 Ga0496114_0166699 3300048917 Bacteria 1918
279 Ga0496114_0196643 3300048917 Bacteria 1765
280 Ga0496115_0029470 3300048918 Bacteria 4311
281 Ga0496115_0135656 3300048918 Bacteria 2029
282 Ga0501032_0060123 3300049569 Bacteria 2549
283 Ga0501036_0298066 3300049572 Bacteria 1349
284 Ga0501037_0100061 3300049573 Bacteria 2094
285 Ga0501038_0245983 3300049574 Bacteria 1418
286 Ga0501040_0111729 3300049576 Bacteria 1911
287 Ga0501040_0532838 3300049576 Bacteria 847
288 Ga0501043_0284071 3300049579 Bacteria 1268
289 Ga0501047_0037888 3300049581 Bacteria 4663
290 Ga0501048_0157116 3300049582 Bacteria 1609
291 Ga0501067_0051221 3300049583 Bacteria 2289
292 Ga0501067_0136541 3300049583 Bacteria 1366
293 Ga0501069_0343772 3300049585 Bacteria 879
294 Ga0501072_0000991 3300049588 Bacteria 20984
295 Ga0501072_0252643 3300049588 Bacteria 1404
296 Ga0501073_0099573 3300049589 Bacteria 2018
297 Ga0501074_0379208 3300049590 Bacteria 1003
298 Ga0501076_0090313 3300049592 Bacteria 2464
299 Ga0501077_0036006 3300049593 Bacteria 3152
300 Ga0501077_0144369 3300049593 Bacteria 1510
301 Ga0501079_0083164 3300049741 Bacteria 2476
302 Ga0501080_0984374 3300049742 Bacteria 732
303 Ga0501081_0145658 3300049743 Bacteria 1699
304 Ga0501081_0444436 3300049743 Bacteria 963
305 Ga0501081_0564380 3300049743 Bacteria 851
306 Ga0501083_0018225 3300049744 Bacteria 4893
307 Ga0501083_0188270 3300049744 Bacteria 1347
308 Ga0501035_0772071 3300049822 Bacteria 770
309 Ga0501044_0063474 3300049823 Bacteria 3773
310 Ga0501044_0149495 3300049823 Bacteria 2319
311 Ga0501045_0232019 3300049824 Bacteria 1374
312 nmdc:mga03683_15478_c1 3300050489 Bacteria 2847
313 nmdc:mga03n38_13858_c1 3300050490 Bacteria 3074
314 nmdc:mga0yw44_1856_c2 3300050492 Bacteria 7220
315 nmdc:mga0k408_113225_c1 3300050493 Bacteria 1604
316 nmdc:mga06z11_37407_c1 3300050494 Bacteria 2403
317 nmdc:mga07m45_30547_c1 3300050496 Bacteria 2984
318 nmdc:mga07m45_565663_c1 3300050496 Bacteria 657
319 nmdc:mga09592_171620_c1 3300050508 Bacteria 1875
320 nmdc:mga06r32_146558_c1 3300050510 Bacteria 2338
321 nmdc:mga06r32_191744_c1 3300050510 Bacteria 2031
322 nmdc:mga08y16_295351_c1 3300050511 Bacteria 1670
323 nmdc:mga0n895_949420_c1 3300050512 Bacteria 843
324 nmdc:mga08x19_372071_c1 3300050514 Bacteria 1000
325 Ga0495601_0000280 3300053077 Bacteria 27384
326 Ga0495601_0001415 3300053077 Bacteria 13214
327 Ga0495601_0010100 3300053077 Bacteria 5607
328 Ga0495601_0016992 3300053077 Bacteria 4413
329 Ga0495612_0009294 3300053078 Bacteria 3988
330 Ga0495612_0012892 3300053078 Bacteria 3368
331 Ga0495595_0005516 3300053084 Bacteria 5124
332 Ga0495595_0016364 3300053084 Bacteria 3172
333 Ga0495595_0020711 3300053084 Bacteria 2864
334 Ga0495619_0000429 3300053085 Archaea 28523
335 Ga0495619_0000459 3300053085 Bacteria 27482
336 Ga0495619_0102379 3300053085 Bacteria 1950
337 Ga0500593_001409 3300053117 Bacteria 8656
338 Ga0500642_0101504 3300053130 Bacteria 1338
339 Ga0501084_0231550 3300054114 Bacteria 1559
340 Ga0501082_0063986 3300060353 Bacteria 3167
341 Ga0501082_0065105 3300060353 Bacteria 3139
342 Ga0501082_0129699 3300060353 Bacteria 2187
343 Ga0466962_0075351 3300061719 Bacteria 1612
344 Ga0530510_0104741 3300061734 Bacteria 2070
345 Ga0530510_0290382 3300061734 Bacteria 1222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0050236 Ga0495664_0050236_1415_2017 200
2 3300025928 Ga0207700_10837608 Ga0207700_108376081 204
3 3300039450 Ga0436363_1461177 Ga0436363_1461177_15_629 204
4 3300048912 Ga0496109_0002725 Ga0496109_0002725_18_680 204
5 3300048913 Ga0496110_0505030 Ga0496110_0505030_134_751 204
6 3300049576 Ga0501040_0532838 Ga0501040_0532838_12_641 204
7 3300050496 nmdc:mga07m45_565663_c1 nmdc:mga07m45_565663_c1_18_638 204
8 3300050510 nmdc:mga06r32_191744_c1 nmdc:mga06r32_191744_c1_1229_1843 204
9 3300053130 Ga0500642_0101504 Ga0500642_0101504_537_1166 204
10 iso_pu_bacteria 2643221547 2643757554 205
11 3300037312 Ga0395899_0076877 Ga0395899_0076877_829_1455 208
12 3300037418 Ga0395900_0013242 Ga0395900_0013242_4976_5602 208
13 3300037466 Ga0395898_0004026 Ga0395898_0004026_6733_7359 208
14 3300038443 Ga0395901_0037404 Ga0395901_0037404_3113_3739 208
15 3300005365 Ga0070688_100219247 Ga0070688_1002192472 209
16 3300005436 Ga0070713_100001505 Ga0070713_1000015057 209
17 3300005437 Ga0070710_10010638 Ga0070710_100106384 209
18 3300005445 Ga0070708_100433975 Ga0070708_1004339752 209
19 3300005937 Ga0081455_10001269 Ga0081455_100012699 209
20 3300005985 Ga0081539_10027335 Ga0081539_100273351 209
21 3300006175 Ga0070712_100115698 Ga0070712_1001156981 209
22 3300006844 Ga0075428_100583221 Ga0075428_1005832213 209
23 3300006871 Ga0075434_100987496 Ga0075434_1009874961 209
24 3300006880 Ga0075429_100168169 Ga0075429_1001681691 209
25 3300011119 Ga0105246_10710506 Ga0105246_107105061 209
26 3300025898 Ga0207692_10032536 Ga0207692_100325362 209
27 3300025915 Ga0207693_10169909 Ga0207693_101699091 209
28 3300025916 Ga0207663_10055019 Ga0207663_100550192 209
29 3300025928 Ga0207700_10046449 Ga0207700_100464493 209
30 3300031241 Ga0265325_10001627 Ga0265325_1000162715 209
31 3300031249 Ga0265339_10263310 Ga0265339_102633102 209
32 3300031595 Ga0265313_10011381 Ga0265313_100113814 209
33 3300035113 Ga0373936_0035238 Ga0373936_0035238_531_1160 209
34 3300035117 Ga0373953_0038829 Ga0373953_0038829_740_1369 209
35 3300035119 Ga0373956_0024735 Ga0373956_0024735_787_1416 209
36 3300035171 Ga0373946_0175870 Ga0373946_0175870_53_682 209
37 3300035410 Ga0373924_0109490 Ga0373924_0109490_409_1038 209
38 3300035692 Ga0373935_0733896 Ga0373935_0733896_40_669 209
39 3300035724 Ga0373933_0006185 Ga0373933_0006185_5587_6216 209
40 3300035725 Ga0373947_0118089 Ga0373947_0118089_291_920 209
41 3300036401 Ga0373937_0001774 Ga0373937_0001774_1836_2465 209
42 3300036401 Ga0373937_0018606 Ga0373937_0018606_2835_3464 209
43 3300041997 Ga0439431_0095588 Ga0439431_0095588_15_644 209
44 3300042012 Ga0439455_0023686 Ga0439455_0023686_603_1232 209
45 3300042993 Ga0439440_0022628 Ga0439440_0022628_753_1382 209
46 3300046454 Ga0495592_0034707 Ga0495592_0034707_1849_2478 209
47 3300046461 Ga0495641_0252306 Ga0495641_0252306_118_747 209
48 3300046463 Ga0495653_0098341 Ga0495653_0098341_403_1032 209
49 3300046473 Ga0495582_0092265 Ga0495582_0092265_435_1064 209
50 3300046514 Ga0495618_0098783 Ga0495618_0098783_416_1045 209
51 3300046516 Ga0495628_0012617 Ga0495628_0012617_5196_5825 209
52 3300046529 Ga0495652_0007442 Ga0495652_0007442_2997_3626 209
53 3300046531 Ga0495665_0290966 Ga0495665_0290966_131_760 209
54 3300046535 Ga0495586_0183166 Ga0495586_0183166_79_708 209
55 3300046536 Ga0495587_0025448 Ga0495587_0025448_2553_3182 209
56 3300046543 Ga0495645_0026702 Ga0495645_0026702_1782_2411 209
57 3300046559 Ga0495667_0006729 Ga0495667_0006729_1260_1889 209
58 3300046675 Ga0495657_0070451 Ga0495657_0070451_1491_2120 209
59 3300046679 Ga0495623_0030043 Ga0495623_0030043_2846_3475 209
60 3300046683 Ga0495658_0016021 Ga0495658_0016021_998_1627 209
61 3300046691 Ga0495670_0232873 Ga0495670_0232873_59_688 209
62 3300046809 Ga0495600_0000619 Ga0495600_0000619_15485_16114 209
63 3300047317 Ga0495604_0033522 Ga0495604_0033522_1335_1964 209
64 3300047317 Ga0495604_0075668 Ga0495604_0075668_759_1388 209
65 3300047319 Ga0495674_0051637 Ga0495674_0051637_1695_2324 209
66 3300047319 Ga0495674_0193988 Ga0495674_0193988_419_1048 209
67 3300047322 Ga0495680_0019403 Ga0495680_0019403_2690_3319 209
68 3300047471 Ga0495684_0378993 Ga0495684_0378993_124_753 209
69 3300047673 Ga0495593_0079953 Ga0495593_0079953_411_1040 209
70 3300048088 Ga0495602_0250173 Ga0495602_0250173_600_1229 209
71 3300048907 Ga0496104_0000878 Ga0496104_0000878_18797_19426 209
72 3300048908 Ga0496105_0000170 Ga0496105_0000170_591_1220 209
73 3300049583 Ga0501067_0051221 Ga0501067_0051221_1376_2005 209
74 3300049588 Ga0501072_0000991 Ga0501072_0000991_470_1099 209
75 3300050508 nmdc:mga09592_171620_c1 nmdc:mga09592_171620_c1_1048_1677 209
76 3300050512 nmdc:mga0n895_949420_c1 nmdc:mga0n895_949420_c1_73_702 209
77 3300053077 Ga0495601_0000280 Ga0495601_0000280_7673_8302 209
78 3300053077 Ga0495601_0001415 Ga0495601_0001415_6770_7399 209
79 3300053078 Ga0495612_0009294 Ga0495612_0009294_228_857 209
80 3300053084 Ga0495595_0005516 Ga0495595_0005516_2821_3450 209
81 3300053084 Ga0495595_0020711 Ga0495595_0020711_1529_2158 209
82 3300053085 Ga0495619_0000429 Ga0495619_0000429_27366_27995 209
83 3300053085 Ga0495619_0000459 Ga0495619_0000459_7755_8384 209
84 3300054114 Ga0501084_0231550 Ga0501084_0231550_60_689 209
85 3300060353 Ga0501082_0065105 Ga0501082_0065105_2032_2661 209
86 3300005327 Ga0070658_10050036 Ga0070658_100500362 210
87 3300005329 Ga0070683_100077591 Ga0070683_1000775913 210
88 3300005336 Ga0070680_100063437 Ga0070680_1000634374 210
89 3300005336 Ga0070680_100110915 Ga0070680_1001109151 210
90 3300005336 Ga0070680_100129484 Ga0070680_1001294841 210
91 3300005337 Ga0070682_100049029 Ga0070682_1000490293 210
92 3300005338 Ga0068868_100012694 Ga0068868_1000126945 210
93 3300005355 Ga0070671_100237224 Ga0070671_1002372242 210
94 3300005434 Ga0070709_10080946 Ga0070709_100809462 210
95 3300005434 Ga0070709_10139723 Ga0070709_101397232 210
96 3300005434 Ga0070709_10238051 Ga0070709_102380511 210
97 3300005435 Ga0070714_100020969 Ga0070714_1000209694 210
98 3300005435 Ga0070714_100035900 Ga0070714_1000359008 210
99 3300005437 Ga0070710_10055139 Ga0070710_100551392 210
100 3300005437 Ga0070710_10082544 Ga0070710_100825442 210
101 3300005439 Ga0070711_100076412 Ga0070711_1000764122 210
102 3300005439 Ga0070711_100206947 Ga0070711_1002069472 210
103 3300005458 Ga0070681_10043190 Ga0070681_100431905 210
104 3300005458 Ga0070681_10232779 Ga0070681_102327791 210
105 3300005458 Ga0070681_10343175 Ga0070681_103431752 210
106 3300005530 Ga0070679_100078708 Ga0070679_1000787083 210
107 3300005530 Ga0070679_100270184 Ga0070679_1002701842 210
108 3300005530 Ga0070679_100316001 Ga0070679_1003160012 210
109 3300005535 Ga0070684_100349682 Ga0070684_1003496822 210
110 3300005539 Ga0068853_100567844 Ga0068853_1005678441 210
111 3300005547 Ga0070693_100047197 Ga0070693_1000471972 210
112 3300005563 Ga0068855_100083049 Ga0068855_1000830495 210
113 3300005563 Ga0068855_100243941 Ga0068855_1002439412 210
114 3300005563 Ga0068855_100484673 Ga0068855_1004846731 210
115 3300005614 Ga0068856_100343102 Ga0068856_1003431022 210
116 3300005614 Ga0068856_100449788 Ga0068856_1004497881 210
117 3300005617 Ga0068859_100477736 Ga0068859_1004777363 210
118 3300005618 Ga0068864_100210260 Ga0068864_1002102603 210
119 3300005937 Ga0081455_10026313 Ga0081455_100263135 210
120 3300005981 Ga0081538_10014865 Ga0081538_100148653 210
121 3300005981 Ga0081538_10041813 Ga0081538_100418133 210
122 3300006048 Ga0075363_100037429 Ga0075363_1000374292 210
123 3300006051 Ga0075364_10172367 Ga0075364_101723672 210
124 3300006163 Ga0070715_10130678 Ga0070715_101306782 210
125 3300006175 Ga0070712_100000431 Ga0070712_10000043118 210
126 3300006175 Ga0070712_100014807 Ga0070712_1000148072 210
127 3300006177 Ga0075362_10014500 Ga0075362_100145003 210
128 3300006178 Ga0075367_10000772 Ga0075367_100007725 210
129 3300006195 Ga0075366_10400281 Ga0075366_104002811 210
130 3300006353 Ga0075370_10112629 Ga0075370_101126291 210
131 3300006846 Ga0075430_100125143 Ga0075430_1001251433 210
132 3300006847 Ga0075431_100190487 Ga0075431_1001904872 210
133 3300006914 Ga0075436_100143668 Ga0075436_1001436681 210
134 3300006931 Ga0097620_100477659 Ga0097620_1004776593 210
135 3300009093 Ga0105240_10110698 Ga0105240_101106983 210
136 3300009098 Ga0105245_10162841 Ga0105245_101628413 210
137 3300009101 Ga0105247_10577226 Ga0105247_105772261 210
138 3300009174 Ga0105241_10077525 Ga0105241_100775252 210
139 3300009176 Ga0105242_10124437 Ga0105242_101244373 210
140 3300009177 Ga0105248_10266559 Ga0105248_102665593 210
141 3300009551 Ga0105238_10039889 Ga0105238_100398891 210
142 3300011119 Ga0105246_10318151 Ga0105246_103181511 210
143 3300013100 Ga0157373_10052062 Ga0157373_100520623 210
144 3300013102 Ga0157371_10012852 Ga0157371_100128522 210
145 3300013102 Ga0157371_10140687 Ga0157371_101406872 210
146 3300013104 Ga0157370_10047002 Ga0157370_100470022 210
147 3300013104 Ga0157370_10177187 Ga0157370_101771872 210
148 3300013105 Ga0157369_10262301 Ga0157369_102623012 210
149 3300013307 Ga0157372_10063974 Ga0157372_100639744 210
150 3300013307 Ga0157372_10243489 Ga0157372_102434892 210
151 3300013307 Ga0157372_10283570 Ga0157372_102835702 210
152 3300020082 Ga0206353_10247202 Ga0206353_102472023 210
153 3300021384 Ga0213876_10051969 Ga0213876_100519692 210
154 3300025898 Ga0207692_10045545 Ga0207692_100455452 210
155 3300025898 Ga0207692_10052767 Ga0207692_100527672 210
156 3300025898 Ga0207692_10151142 Ga0207692_101511422 210
157 3300025906 Ga0207699_10244241 Ga0207699_102442413 210
158 3300025909 Ga0207705_10122842 Ga0207705_101228422 210
159 3300025909 Ga0207705_10314072 Ga0207705_103140721 210
160 3300025912 Ga0207707_10049410 Ga0207707_100494103 210
161 3300025912 Ga0207707_10267474 Ga0207707_102674742 210
162 3300025913 Ga0207695_10268613 Ga0207695_102686132 210
163 3300025915 Ga0207693_10001247 Ga0207693_100012477 210
164 3300025915 Ga0207693_10012988 Ga0207693_100129887 210
165 3300025915 Ga0207693_10038386 Ga0207693_100383862 210
166 3300025915 Ga0207693_10063176 Ga0207693_100631765 210
167 3300025916 Ga0207663_10114865 Ga0207663_101148651 210
168 3300025917 Ga0207660_10027077 Ga0207660_100270774 210
169 3300025917 Ga0207660_10065007 Ga0207660_100650073 210
170 3300025917 Ga0207660_10199903 Ga0207660_101999032 210
171 3300025921 Ga0207652_10002869 Ga0207652_100028692 210
172 3300025921 Ga0207652_10091417 Ga0207652_100914172 210
173 3300025921 Ga0207652_10449294 Ga0207652_104492941 210
174 3300025927 Ga0207687_10230538 Ga0207687_102305383 210
175 3300025928 Ga0207700_10169136 Ga0207700_101691362 210
176 3300025929 Ga0207664_10028547 Ga0207664_100285473 210
177 3300025929 Ga0207664_10451584 Ga0207664_104515842 210
178 3300025932 Ga0207690_10777835 Ga0207690_107778351 210
179 3300025939 Ga0207665_10082468 Ga0207665_100824683 210
180 3300025941 Ga0207711_10590215 Ga0207711_105902151 210
181 3300025942 Ga0207689_10304488 Ga0207689_103044883 210
182 3300025944 Ga0207661_10149000 Ga0207661_101490003 210
183 3300025949 Ga0207667_10036135 Ga0207667_100361354 210
184 3300025949 Ga0207667_10044509 Ga0207667_100445092 210
185 3300025949 Ga0207667_10475815 Ga0207667_104758152 210
186 3300025981 Ga0207640_10403594 Ga0207640_104035942 210
187 3300026023 Ga0207677_10180687 Ga0207677_101806873 210
188 3300026041 Ga0207639_10224628 Ga0207639_102246281 210
189 3300026078 Ga0207702_10432466 Ga0207702_104324661 210
190 3300026089 Ga0207648_10728523 Ga0207648_107285231 210
191 3300026095 Ga0207676_10347732 Ga0207676_103477323 210
192 3300026116 Ga0207674_10841543 Ga0207674_108415432 210
193 3300026142 Ga0207698_10336958 Ga0207698_103369582 210
194 3300026142 Ga0207698_10582357 Ga0207698_105823572 210
195 3300028023 Ga0265357_1003967 Ga0265357_10039672 210
196 3300028556 Ga0265337_1003538 Ga0265337_10035386 210
197 3300028800 Ga0265338_10079308 Ga0265338_100793082 210
198 3300028800 Ga0265338_10651361 Ga0265338_106513611 210
199 3300030763 Ga0265763_1001604 Ga0265763_10016043 210
200 3300031010 Ga0265771_1008881 Ga0265771_10088811 210
201 3300031090 Ga0265760_10048397 Ga0265760_100483971 210
202 3300031235 Ga0265330_10040576 Ga0265330_100405762 210
203 3300031241 Ga0265325_10014461 Ga0265325_100144614 210
204 3300031247 Ga0265340_10070739 Ga0265340_100707392 210
205 3300031247 Ga0265340_10302813 Ga0265340_103028131 210
206 3300031249 Ga0265339_10085858 Ga0265339_100858582 210
207 3300031344 Ga0265316_10402157 Ga0265316_104021571 210
208 3300031595 Ga0265313_10010440 Ga0265313_100104404 210
209 3300031595 Ga0265313_10034899 Ga0265313_100348993 210
210 3300031595 Ga0265313_10129505 Ga0265313_101295052 210
211 3300031712 Ga0265342_10000321 Ga0265342_1000032125 210
212 3300031712 Ga0265342_10082227 Ga0265342_100822272 210
213 3300035116 Ga0373945_0056340 Ga0373945_0056340_339_971 210
214 3300035118 Ga0373954_0002982 Ga0373954_0002982_5380_6012 210
215 3300035120 Ga0373957_0008142 Ga0373957_0008142_1590_2222 210
216 3300035170 Ga0373943_0044970 Ga0373943_0044970_312_944 210
217 3300035172 Ga0373955_0004927 Ga0373955_0004927_881_1513 210
218 3300035172 Ga0373955_0167353 Ga0373955_0167353_249_1001 210
219 3300035172 Ga0373955_0279010 Ga0373955_0279010_127_759 210
220 3300035410 Ga0373924_0031920 Ga0373924_0031920_1049_1681 210
221 3300035724 Ga0373933_0003720 Ga0373933_0003720_1013_1645 210
222 3300035725 Ga0373947_0034631 Ga0373947_0034631_80_712 210
223 3300036401 Ga0373937_0004840 Ga0373937_0004840_10604_11236 210
224 3300036401 Ga0373937_0019286 Ga0373937_0019286_1176_1808 210
225 3300036401 Ga0373937_0057659 Ga0373937_0057659_2221_2973 210
226 3300037312 Ga0395899_0075718 Ga0395899_0075718_907_1539 210
227 3300037418 Ga0395900_0046811 Ga0395900_0046811_1040_1672 210
228 3300037418 Ga0395900_0115788 Ga0395900_0115788_1670_2302 210
229 3300037466 Ga0395898_0049270 Ga0395898_0049270_2154_2786 210
230 3300037466 Ga0395898_0130619 Ga0395898_0130619_1540_2172 210
231 3300037853 Ga0436364_0309040 Ga0436364_0309040_522_1154 210
232 3300037853 Ga0436364_1106244 Ga0436364_1106244_391_1023 210
233 3300038443 Ga0395901_0035858 Ga0395901_0035858_2971_3603 210
234 3300038443 Ga0395901_0264369 Ga0395901_0264369_471_1103 210
235 3300038443 Ga0395901_0710086 Ga0395901_0710086_128_760 210
236 3300039437 Ga0436365_0856205 Ga0436365_0856205_4115_4747 210
237 3300039437 Ga0436365_1375681 Ga0436365_1375681_1673_2305 210
238 3300039437 Ga0436365_1860416 Ga0436365_1860416_10_642 210
239 3300044684 Ga0466966_0061801 Ga0466966_0061801_985_1617 210
240 3300044693 Ga0466961_0110261 Ga0466961_0110261_253_885 210
241 3300044694 Ga0466963_0000930 Ga0466963_0000930_7568_8200 210
242 3300044694 Ga0466963_0331824 Ga0466963_0331824_173_805 210
243 3300044842 Ga0466957_0016561 Ga0466957_0016561_1838_2470 210
244 3300044842 Ga0466957_0244101 Ga0466957_0244101_286_918 210
245 3300045049 Ga0466959_0180743 Ga0466959_0180743_20_652 210
246 3300045836 Ga0466958_0140433 Ga0466958_0140433_111_743 210
247 3300045976 Ga0466967_0001436 Ga0466967_0001436_7423_8055 210
248 3300046457 Ga0495590_0054343 Ga0495590_0054343_336_968 210
249 3300046472 Ga0495580_0047140 Ga0495580_0047140_953_1585 210
250 3300046491 Ga0495584_0003721 Ga0495584_0003721_1910_2542 210
251 3300046511 Ga0495608_0110978 Ga0495608_0110978_662_1294 210
252 3300046517 Ga0495630_0025874 Ga0495630_0025874_2933_3565 210
253 3300046520 Ga0495637_0096734 Ga0495637_0096734_479_1111 210
254 3300046529 Ga0495652_0162546 Ga0495652_0162546_669_1301 210
255 3300046533 Ga0495640_0102235 Ga0495640_0102235_423_1055 210
256 3300046642 Ga0495634_0032733 Ga0495634_0032733_2604_3236 210
257 3300046648 Ga0495611_0224703 Ga0495611_0224703_19_651 210
258 3300046675 Ga0495657_0083536 Ga0495657_0083536_507_1139 210
259 3300046689 Ga0495613_0040061 Ga0495613_0040061_911_1543 210
260 3300046689 Ga0495613_0122891 Ga0495613_0122891_920_1552 210
261 3300046809 Ga0495600_0029323 Ga0495600_0029323_2082_2714 210
262 3300047319 Ga0495674_0067464 Ga0495674_0067464_970_1602 210
263 3300047320 Ga0495672_0037025 Ga0495672_0037025_2045_2677 210
264 3300047320 Ga0495672_0236945 Ga0495672_0236945_153_785 210
265 3300047322 Ga0495680_0002014 Ga0495680_0002014_2338_2970 210
266 3300047444 Ga0495675_0049832 Ga0495675_0049832_1455_2087 210
267 3300048088 Ga0495602_0144805 Ga0495602_0144805_171_803 210
268 3300048903 Ga0496100_0003609 Ga0496100_0003609_4611_5291 210
269 3300048904 Ga0496101_0008473 Ga0496101_0008473_1847_2527 210
270 3300048904 Ga0496101_0106912 Ga0496101_0106912_500_1132 210
271 3300048904 Ga0496101_0182744 Ga0496101_0182744_815_1447 210
272 3300048905 Ga0496102_0255367 Ga0496102_0255367_839_1471 210
273 3300048905 Ga0496102_0386622 Ga0496102_0386622_548_1228 210
274 3300048907 Ga0496104_0004463 Ga0496104_0004463_5234_5914 210
275 3300048907 Ga0496104_0044492 Ga0496104_0044492_2902_3534 210
276 3300048907 Ga0496104_0066311 Ga0496104_0066311_199_831 210
277 3300048907 Ga0496104_0116848 Ga0496104_0116848_318_950 210
278 3300048907 Ga0496104_0146312 Ga0496104_0146312_457_1137 210
279 3300048908 Ga0496105_0011898 Ga0496105_0011898_5639_6271 210
280 3300048908 Ga0496105_0037792 Ga0496105_0037792_443_1123 210
281 3300048909 Ga0496106_0005621 Ga0496106_0005621_4862_5542 210
282 3300048910 Ga0496107_0007150 Ga0496107_0007150_2168_2848 210
283 3300048910 Ga0496107_0466095 Ga0496107_0466095_281_913 210
284 3300048911 Ga0496108_0119096 Ga0496108_0119096_333_965 210
285 3300048911 Ga0496108_0208889 Ga0496108_0208889_606_1286 210
286 3300048912 Ga0496109_0002491 Ga0496109_0002491_8832_9512 210
287 3300048912 Ga0496109_0074685 Ga0496109_0074685_388_1020 210
288 3300048912 Ga0496109_0175733 Ga0496109_0175733_54_686 210
289 3300048913 Ga0496110_0008692 Ga0496110_0008692_2591_3271 210
290 3300048913 Ga0496110_0021478 Ga0496110_0021478_4700_5380 210
291 3300048913 Ga0496110_0436069 Ga0496110_0436069_109_741 210
292 3300048914 Ga0496111_0020095 Ga0496111_0020095_2905_3585 210
293 3300048915 Ga0496112_0095232 Ga0496112_0095232_1513_2145 210
294 3300048915 Ga0496112_0492700 Ga0496112_0492700_157_789 210
295 3300048916 Ga0496113_0058110 Ga0496113_0058110_941_1621 210
296 3300048917 Ga0496114_0166699 Ga0496114_0166699_261_941 210
297 3300048917 Ga0496114_0196643 Ga0496114_0196643_369_1001 210
298 3300048918 Ga0496115_0029470 Ga0496115_0029470_2345_2977 210
299 3300048918 Ga0496115_0135656 Ga0496115_0135656_990_1670 210
300 3300049569 Ga0501032_0060123 Ga0501032_0060123_1522_2154 210
301 3300049572 Ga0501036_0298066 Ga0501036_0298066_80_712 210
302 3300049573 Ga0501037_0100061 Ga0501037_0100061_93_734 210
303 3300049574 Ga0501038_0245983 Ga0501038_0245983_268_909 210
304 3300049576 Ga0501040_0111729 Ga0501040_0111729_1064_1696 210
305 3300049579 Ga0501043_0284071 Ga0501043_0284071_592_1224 210
306 3300049581 Ga0501047_0037888 Ga0501047_0037888_145_786 210
307 3300049582 Ga0501048_0157116 Ga0501048_0157116_763_1395 210
308 3300049583 Ga0501067_0136541 Ga0501067_0136541_207_848 210
309 3300049585 Ga0501069_0343772 Ga0501069_0343772_76_756 210
310 3300049588 Ga0501072_0252643 Ga0501072_0252643_396_1028 210
311 3300049589 Ga0501073_0099573 Ga0501073_0099573_590_1231 210
312 3300049590 Ga0501074_0379208 Ga0501074_0379208_128_835 210
313 3300049592 Ga0501076_0090313 Ga0501076_0090313_375_1007 210
314 3300049593 Ga0501077_0036006 Ga0501077_0036006_613_1260 210
315 3300049593 Ga0501077_0144369 Ga0501077_0144369_689_1321 210
316 3300049741 Ga0501079_0083164 Ga0501079_0083164_896_1543 210
317 3300049742 Ga0501080_0984374 Ga0501080_0984374_80_712 210
318 3300049743 Ga0501081_0145658 Ga0501081_0145658_380_1027 210
319 3300049743 Ga0501081_0444436 Ga0501081_0444436_191_823 210
320 3300049743 Ga0501081_0564380 Ga0501081_0564380_166_798 210
321 3300049744 Ga0501083_0018225 Ga0501083_0018225_4235_4867 210
322 3300049744 Ga0501083_0188270 Ga0501083_0188270_517_1164 210
323 3300049822 Ga0501035_0772071 Ga0501035_0772071_29_661 210
324 3300049823 Ga0501044_0063474 Ga0501044_0063474_2138_2845 210
325 3300049823 Ga0501044_0149495 Ga0501044_0149495_979_1620 210
326 3300049824 Ga0501045_0232019 Ga0501045_0232019_175_807 210
327 3300050489 nmdc:mga03683_15478_c1 nmdc:mga03683_15478_c1_2104_2736 210
328 3300050490 nmdc:mga03n38_13858_c1 nmdc:mga03n38_13858_c1_1757_2401 210
329 3300050492 nmdc:mga0yw44_1856_c2 nmdc:mga0yw44_1856_c2_2781_3413 210
330 3300050493 nmdc:mga0k408_113225_c1 nmdc:mga0k408_113225_c1_150_788 210
331 3300050494 nmdc:mga06z11_37407_c1 nmdc:mga06z11_37407_c1_1511_2155 210
332 3300050496 nmdc:mga07m45_30547_c1 nmdc:mga07m45_30547_c1_1769_2413 210
333 3300050510 nmdc:mga06r32_146558_c1 nmdc:mga06r32_146558_c1_1141_1773 210
334 3300050511 nmdc:mga08y16_295351_c1 nmdc:mga08y16_295351_c1_867_1499 210
335 3300050514 nmdc:mga08x19_372071_c1 nmdc:mga08x19_372071_c1_200_880 210
336 3300053077 Ga0495601_0010100 Ga0495601_0010100_1260_1892 210
337 3300053077 Ga0495601_0016992 Ga0495601_0016992_1111_1743 210
338 3300053078 Ga0495612_0012892 Ga0495612_0012892_377_1009 210
339 3300053084 Ga0495595_0016364 Ga0495595_0016364_1704_2456 210
340 3300053085 Ga0495619_0102379 Ga0495619_0102379_740_1372 210
341 3300053117 Ga0500593_001409 Ga0500593_001409_7095_7730 210
342 3300060353 Ga0501082_0063986 Ga0501082_0063986_590_1222 210
343 3300060353 Ga0501082_0129699 Ga0501082_0129699_332_979 210
344 3300061719 Ga0466962_0075351 Ga0466962_0075351_967_1599 210
345 3300061734 Ga0530510_0104741 Ga0530510_0104741_1254_1886 210
346 3300061734 Ga0530510_0290382 Ga0530510_0290382_560_1192 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

40

116

0.96

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

164

229

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

49

116

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

44

116

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

146

234

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

160

238

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9959 2 203
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9814 2 203
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9779 2 203
3m8n-assembly2.cif.gz_C crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9729 2 203
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9711 2 199
ID Description Score Start End Superfamily
3m8nC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9921 1 81 3.40.30.10
3m8nD01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9838 1 85 3.40.30.10
3m8nC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.98 1 81 3.40.30.10
4hz2B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9753 82 198 1.20.1050.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9676 1 75 3.40.30.10
ID Description Score Start End GO Terms
AF-E6VQI7-F1-model_v4 Glutathione S-transferase domain 0.9941 1 203 GO:0016740
AF-A0A0S6UJS3-F1-model_v4 GstA protein 0.9885 1 207
AF-A0A4D7QS46-F1-model_v4 Glutathione S-transferase family protein 0.9884 2 203 GO:0016740
AF-Q8YS96-F1-model_v4 Alr3195 protein 0.9869 2 204
AF-A0A2E8FZP4-F1-model_v4 Glutathione S-transferase 0.9852 1 201 GO:0016740

Feature Viewer

pLDDT pTM Quality
92.89 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map