F416811

General Info

Members Datasets Scaffolds Average Seq Length
346 178 340 335

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10157373|Ga0265314_101573732
Length 371
Sequence MRNWIAILVCALFAAGLPWPAITAAAAETKLLNVSYDVTREFYQDYNQAFAAYWKEKTGNAVTINQSHGGSTKQAQSVVNGLEADVVTMNQPPDIDILHSVDLIPANWSSRLPNNSVPYTSTIVFVVRKGNPKNIRNWDDLVRSDVSVVIPNPKTSGNGRYSYLAAWGYALKKSAGLRRAGADSHLADGQQQDVNSRLASTGYGPAEAGDEKQARAFVASLFANVPVLDTGGRGATTTFADRGIGDVLLTFENEAALVQKQFSDDGLLVVLPPVSILAENPVVWVDHNVQRHHTEAVSRAYLEYLFSDAGQELAAQHFFRPKNQAILARYSTRYKPLELFTVDEIAGGWQKAQQVHFADGGIFDQIYQPNQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2643221629 Devosia sp. Root105 Isolate Unclassified
3 2643221662 Devosia sp. Root413D1 Isolate Unclassified
4 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
5 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
6 2952252522 Salinicola sp. DM10 Isolate Unclassified
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
31 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
69 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
70 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 3.76
Rhizosphere 89.31
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_842 2124908027 Bacteria 15127
2 rootH1_10179806 3300003316 Bacteria 2573
3 rootH2_10002624 3300003320 Bacteria 11438
4 rootL2_10217873 3300003322 Bacteria 2875
5 rootH1_10199924 3300003323 Bacteria 2701
6 Ga0070659_100072054 3300005366 Bacteria 2749
7 Ga0068855_100398129 3300005563 Bacteria 1509
8 Ga0068857_100368597 3300005577 Bacteria 1332
9 Ga0068852_100047849 3300005616 Bacteria 3651
10 Ga0068861_100251685 3300005719 Bacteria 1508
11 Ga0068871_100094509 3300006358 Bacteria 2495
12 Ga0075430_100247839 3300006846 Bacteria 1476
13 Ga0105251_10000060 3300009011 Bacteria 102799
14 Ga0105240_10070615 3300009093 Bacteria 4320
15 Ga0105241_10008431 3300009174 Bacteria 7579
16 Ga0105242_10117822 3300009176 Bacteria 2274
17 Ga0105237_10307333 3300009545 Bacteria 1588
18 Ga0105238_10178547 3300009551 Bacteria 2100
19 Ga0157373_10003330 3300013100 Bacteria 12136
20 Ga0157370_10026152 3300013104 Bacteria 5765
21 Ga0157378_10481575 3300013297 Bacteria 1236
22 Ga0163162_10000043 3300013306 Bacteria 129324
23 Ga0157375_10194357 3300013308 Bacteria 2184
24 Ga0157380_10011787 3300014326 Bacteria 6324
25 Ga0182006_1017384 3300015261 Bacteria 3056
26 Ga0209051_1000856 3300025303 Bacteria 31040
27 Ga0207705_10005475 3300025909 Bacteria 9494
28 Ga0207654_10002614 3300025911 Bacteria 9136
29 Ga0207695_10010158 3300025913 Bacteria 11550
30 Ga0207671_10186111 3300025914 Bacteria 1618
31 Ga0207690_10117424 3300025932 Bacteria 1926
32 Ga0207686_10003938 3300025934 Bacteria 7959
33 Ga0207667_10279037 3300025949 Bacteria 1707
34 Ga0207702_10327217 3300026078 Bacteria 1461
35 Ga0207641_10059480 3300026088 Bacteria 3254
36 Ga0265337_1023990 3300028556 Bacteria 1871
37 Ga0265337_1045704 3300028556 Bacteria 1245
38 Ga0265326_10006308 3300028558 Bacteria 3698
39 Ga0265319_1000001 3300028563 Bacteria 549513
40 Ga0265319_1000516 3300028563 Bacteria 26631
41 Ga0265334_10043696 3300028573 Unclassified 1743
42 Ga0265334_10061505 3300028573 Bacteria 1415
43 Ga0265323_10000403 3300028653 Bacteria 24762
44 Ga0265323_10013678 3300028653 Bacteria 3229
45 Ga0265322_10004294 3300028654 Bacteria 4258
46 Ga0265336_10044842 3300028666 Bacteria 1345
47 Ga0265338_10000008 3300028800 Bacteria 481542
48 Ga0265338_10000593 3300028800 Bacteria 63891
49 Ga0265338_10003058 3300028800 Bacteria 24044
50 Ga0265338_10006488 3300028800 Bacteria 14884
51 Ga0265338_10007764 3300028800 Bacteria 13200
52 Ga0265338_10008893 3300028800 Bacteria 12094
53 Ga0265338_10015530 3300028800 Bacteria 8352
54 Ga0265338_10022827 3300028800 Bacteria 6457
55 Ga0265338_10152833 3300028800 Bacteria 1791
56 Ga0265324_10000856 3300029957 Bacteria 19561
57 Ga0265324_10007861 3300029957 Bacteria 4279
58 Ga0265324_10009304 3300029957 Bacteria 3843
59 Ga0265324_10025379 3300029957 Bacteria 2101
60 Ga0265324_10052343 3300029957 Bacteria 1402
61 Ga0265328_10006716 3300031239 Bacteria 4845
62 Ga0265320_10000707 3300031240 Bacteria 25491
63 Ga0265320_10025642 3300031240 Bacteria 3096
64 Ga0265320_10053968 3300031240 Bacteria 1940
65 Ga0265340_10001288 3300031247 Bacteria 14393
66 Ga0265339_10114886 3300031249 Bacteria 1389
67 Ga0265331_10002575 3300031250 Bacteria 12194
68 Ga0265331_10030597 3300031250 Bacteria 2680
69 Ga0265327_10000213 3300031251 Bacteria 121151
70 Ga0265327_10000730 3300031251 Bacteria 51310
71 Ga0265327_10002332 3300031251 Bacteria 20284
72 Ga0265327_10002506 3300031251 Bacteria 19194
73 Ga0265327_10003389 3300031251 Bacteria 15312
74 Ga0265316_10002265 3300031344 Bacteria 20164
75 Ga0265316_10005611 3300031344 Bacteria 12156
76 Ga0265316_10024926 3300031344 Bacteria 5000
77 Ga0265316_10128664 3300031344 Bacteria 1908
78 Ga0307408_100037976 3300031548 Bacteria 3395
79 Ga0307408_100136339 3300031548 Bacteria 1921
80 Ga0265313_10002447 3300031595 Bacteria 16031
81 Ga0265313_10004624 3300031595 Bacteria 10435
82 Ga0307508_10000183 3300031616 Bacteria 75801
83 Ga0307508_10031672 3300031616 Bacteria 4779
84 Ga0307508_10035172 3300031616 Bacteria 4515
85 Ga0265314_10001317 3300031711 Bacteria 28131
86 Ga0265314_10005930 3300031711 Bacteria 10921
87 Ga0265314_10067440 3300031711 Bacteria 2410
88 Ga0265314_10157373 3300031711 Bacteria 1386
89 Ga0265342_10134465 3300031712 Bacteria 1383
90 Ga0307412_10110748 3300031911 Bacteria 1960
91 Ga0373929_0000001 3300035085 Bacteria 956023
92 Ga0395899_0077459 3300037312 Bacteria 2425
93 Ga0395900_0028634 3300037418 Bacteria 5710
94 Ga0395905_0144943 3300037471 Bacteria 2234
95 Ga0395901_0579932 3300038443 Bacteria 1133
96 Ga0450911_000027 3300042115 Bacteria 82476
97 Ga0450904_000112 3300042139 Bacteria 18033
98 Ga0439459_0000801 3300042438 Bacteria 4364
99 Ga0451577_0009084 3300042876 Bacteria 9593
100 Ga0451577_0009167 3300042876 Bacteria 9546
101 Ga0451577_0264528 3300042876 Bacteria 1557
102 Ga0466972_0003275 3300044658 Bacteria 8027
103 Ga0466972_0111462 3300044658 Bacteria 1293
104 Ga0466965_0003398 3300044683 Bacteria 6972
105 Ga0466966_0005589 3300044684 Bacteria 8264
106 Ga0466966_0010030 3300044684 Bacteria 6278
107 Ga0466961_0014395 3300044693 Bacteria 5077
108 Ga0466961_0032203 3300044693 Bacteria 3368
109 Ga0453684_0062444 3300044712 Bacteria 4772
110 Ga0453684_0435883 3300044712 Bacteria 1461
111 Ga0466968_0000373 3300044735 Bacteria 14641
112 Ga0466957_0002309 3300044842 Bacteria 10215
113 Ga0466960_0033503 3300044901 Bacteria 2388
114 Ga0466959_0003434 3300045049 Bacteria 10363
115 Ga0451576_0002774 3300045051 Bacteria 25285
116 Ga0466958_0031699 3300045836 Bacteria 3142
117 Ga0495617_000030 3300046452 Bacteria 152392
118 Ga0495617_000228 3300046452 Bacteria 34074
119 Ga0495627_000317 3300046453 Bacteria 47238
120 Ga0495603_0029429 3300046455 Bacteria 3311
121 Ga0495590_0001797 3300046457 Bacteria 9085
122 Ga0495590_0059075 3300046457 Bacteria 1341
123 Ga0495629_0234951 3300046459 Bacteria 1263
124 Ga0495638_0015708 3300046460 Bacteria 5077
125 Ga0495638_0060430 3300046460 Bacteria 2344
126 Ga0495653_0010683 3300046463 Bacteria 7517
127 Ga0495650_0000459 3300046471 Bacteria 63575
128 Ga0495650_0007914 3300046471 Bacteria 6303
129 Ga0495582_0025022 3300046473 Bacteria 3270
130 Ga0495582_0031782 3300046473 Bacteria 2902
131 Ga0495605_0000029 3300046474 Bacteria 215329
132 Ga0495605_0000046 3300046474 Bacteria 175985
133 Ga0495605_0007660 3300046474 Bacteria 6122
134 Ga0495605_0051895 3300046474 Bacteria 1995
135 Ga0495605_0100364 3300046474 Bacteria 1331
136 Ga0495584_0000003 3300046491 Bacteria 323768
137 Ga0495584_0000127 3300046491 Bacteria 52530
138 Ga0495584_0000973 3300046491 Bacteria 17970
139 Ga0495584_0064935 3300046491 Bacteria 1835
140 Ga0495584_0102470 3300046491 Bacteria 1447
141 Ga0495584_0119347 3300046491 Bacteria 1335
142 Ga0495585_0000010 3300046492 Bacteria 229958
143 Ga0495585_0000133 3300046492 Bacteria 80839
144 Ga0495585_0000610 3300046492 Bacteria 33395
145 Ga0495585_0001536 3300046492 Bacteria 17921
146 Ga0495585_0035343 3300046492 Bacteria 2824
147 Ga0495585_0044576 3300046492 Bacteria 2477
148 Ga0495585_0169764 3300046492 Bacteria 1127
149 Ga0495594_0000959 3300046499 Bacteria 14991
150 Ga0495594_0023635 3300046499 Bacteria 3295
151 Ga0495596_0000672 3300046500 Bacteria 21261
152 Ga0495596_0000905 3300046500 Bacteria 17766
153 Ga0495596_0003307 3300046500 Bacteria 8212
154 Ga0495596_0003398 3300046500 Bacteria 8077
155 Ga0495596_0005701 3300046500 Bacteria 5844
156 Ga0495596_0009102 3300046500 Bacteria 4387
157 Ga0495607_0000532 3300046501 Bacteria 37423
158 Ga0495607_0001454 3300046501 Bacteria 21090
159 Ga0495607_0001491 3300046501 Bacteria 20779
160 Ga0495607_0002490 3300046501 Bacteria 14918
161 Ga0495583_0000157 3300046506 Bacteria 113758
162 Ga0495583_0000176 3300046506 Bacteria 108802
163 Ga0495583_0000580 3300046506 Bacteria 50178
164 Ga0495583_0001564 3300046506 Bacteria 22613
165 Ga0495583_0006062 3300046506 Bacteria 7998
166 Ga0495583_0079959 3300046506 Bacteria 1421
167 Ga0495606_0069565 3300046507 Bacteria 2222
168 Ga0495616_0000250 3300046513 Bacteria 43443
169 Ga0495616_0022771 3300046513 Bacteria 3379
170 Ga0495616_0052607 3300046513 Bacteria 2027
171 Ga0495616_0064978 3300046513 Bacteria 1779
172 Ga0495616_0120971 3300046513 Bacteria 1208
173 Ga0495620_0041232 3300046515 Bacteria 2026
174 Ga0495631_0000008 3300046518 Bacteria 121368
175 Ga0495631_0002094 3300046518 Bacteria 11586
176 Ga0495631_0006213 3300046518 Bacteria 6186
177 Ga0495631_0023205 3300046518 Bacteria 2878
178 Ga0495631_0027029 3300046518 Bacteria 2629
179 Ga0495632_0000140 3300046519 Bacteria 74068
180 Ga0495632_0000398 3300046519 Bacteria 40867
181 Ga0495637_0005549 3300046520 Bacteria 6403
182 Ga0495637_0022834 3300046520 Bacteria 2848
183 Ga0495643_0001791 3300046522 Bacteria 18381
184 Ga0495643_0017951 3300046522 Bacteria 4123
185 Ga0495643_0019030 3300046522 Bacteria 3976
186 Ga0495643_0067659 3300046522 Bacteria 1881
187 Ga0495643_0099646 3300046522 Bacteria 1490
188 Ga0495644_0004490 3300046523 Bacteria 5482
189 Ga0495648_0000003 3300046524 Bacteria 386817
190 Ga0495648_0000309 3300046524 Bacteria 54245
191 Ga0495648_0000853 3300046524 Bacteria 32161
192 Ga0495648_0003035 3300046524 Bacteria 15033
193 Ga0495666_0000377 3300046526 Bacteria 19610
194 Ga0495666_0050791 3300046526 Bacteria 1993
195 Ga0495642_0000013 3300046528 Bacteria 123896
196 Ga0495642_0000070 3300046528 Bacteria 61042
197 Ga0495642_0000161 3300046528 Bacteria 38994
198 Ga0495642_0001063 3300046528 Bacteria 12731
199 Ga0495642_0011630 3300046528 Bacteria 3386
200 Ga0495642_0038301 3300046528 Bacteria 1942
201 Ga0495642_0039114 3300046528 Bacteria 1923
202 Ga0495642_0059857 3300046528 Bacteria 1579
203 Ga0495654_0021448 3300046530 Bacteria 3359
204 Ga0495665_0013553 3300046531 Bacteria 4406
205 Ga0495586_0002863 3300046535 Bacteria 9321
206 Ga0495586_0040924 3300046535 Bacteria 2495
207 Ga0495586_0080929 3300046535 Bacteria 1785
208 Ga0495609_0000105 3300046538 Bacteria 98586
209 Ga0495609_0002698 3300046538 Bacteria 10715
210 Ga0495609_0005084 3300046538 Bacteria 7010
211 Ga0495609_0005285 3300046538 Bacteria 6846
212 Ga0495609_0007781 3300046538 Bacteria 5311
213 Ga0495609_0036774 3300046538 Bacteria 2210
214 Ga0495597_0000113 3300046542 Bacteria 72390
215 Ga0495597_0000307 3300046542 Bacteria 43960
216 Ga0495597_0005903 3300046542 Bacteria 6395
217 Ga0495597_0014400 3300046542 Bacteria 3767
218 Ga0495597_0060711 3300046542 Bacteria 1648
219 Ga0495645_0084883 3300046543 Bacteria 2267
220 Ga0495622_0008555 3300046557 Bacteria 4742
221 Ga0495633_0001158 3300046558 Bacteria 21178
222 Ga0495633_0004368 3300046558 Bacteria 9023
223 Ga0495633_0014508 3300046558 Bacteria 4116
224 Ga0495633_0043586 3300046558 Bacteria 2128
225 Ga0495668_0000607 3300046616 Bacteria 43408
226 Ga0495668_0000755 3300046616 Bacteria 38152
227 Ga0495668_0000855 3300046616 Bacteria 34381
228 Ga0495668_0004080 3300046616 Bacteria 10588
229 Ga0495668_0007691 3300046616 Bacteria 6851
230 Ga0495668_0190021 3300046616 Bacteria 1125
231 Ga0495611_0008839 3300046648 Bacteria 4259
232 Ga0495635_0006137 3300046663 Bacteria 8381
233 Ga0495659_0021705 3300046664 Bacteria 2166
234 Ga0495661_0000081 3300046665 Bacteria 116927
235 Ga0495661_0000248 3300046665 Bacteria 62330
236 Ga0495661_0001485 3300046665 Bacteria 19558
237 Ga0495661_0002806 3300046665 Bacteria 13190
238 Ga0495661_0007888 3300046665 Bacteria 7395
239 Ga0495661_0011504 3300046665 Bacteria 6003
240 Ga0495661_0040446 3300046665 Bacteria 2890
241 Ga0495588_0000086 3300046674 Bacteria 193241
242 Ga0495588_0015776 3300046674 Bacteria 3642
243 Ga0495588_0027656 3300046674 Bacteria 2835
244 Ga0495588_0070077 3300046674 Bacteria 1822
245 Ga0495623_0139027 3300046679 Bacteria 1447
246 Ga0495669_0000025 3300046684 Bacteria 112395
247 Ga0495669_0136008 3300046684 Bacteria 1158
248 Ga0495613_0038915 3300046689 Bacteria 3526
249 Ga0495624_0019747 3300046690 Bacteria 4492
250 Ga0495670_0005186 3300046691 Bacteria 6410
251 Ga0495670_0009807 3300046691 Bacteria 4708
252 Ga0495670_0010995 3300046691 Bacteria 4448
253 Ga0495671_0000869 3300046692 Bacteria 21668
254 Ga0495671_0057163 3300046692 Bacteria 1930
255 Ga0495671_0097646 3300046692 Bacteria 1436
256 Ga0495649_0065411 3300046694 Bacteria 1951
257 Ga0495649_0070802 3300046694 Bacteria 1869
258 Ga0495589_0000135 3300046794 Bacteria 67821
259 Ga0495589_0000157 3300046794 Bacteria 62544
260 Ga0495589_0000170 3300046794 Bacteria 59283
261 Ga0495589_0001377 3300046794 Bacteria 14146
262 Ga0495589_0018008 3300046794 Bacteria 3625
263 Ga0495589_0023800 3300046794 Bacteria 3117
264 Ga0495660_0000127 3300046810 Bacteria 84034
265 Ga0495660_0051812 3300046810 Bacteria 2232
266 Ga0495636_0101875 3300047318 Bacteria 1256
267 Ga0495674_0004869 3300047319 Bacteria 12909
268 Ga0495672_0000475 3300047320 Bacteria 47536
269 Ga0495672_0004442 3300047320 Bacteria 11485
270 Ga0495672_0013888 3300047320 Bacteria 5537
271 Ga0495676_0000140 3300047321 Bacteria 55144
272 Ga0495676_0032670 3300047321 Bacteria 4390
273 Ga0495680_0013449 3300047322 Bacteria 7138
274 Ga0495683_0000046 3300047323 Bacteria 129843
275 Ga0495683_0055523 3300047323 Bacteria 1971
276 Ga0495687_000033 3300047443 Bacteria 263788
277 Ga0495687_000102 3300047443 Bacteria 129228
278 Ga0495687_000184 3300047443 Bacteria 91103
279 Ga0495687_000349 3300047443 Bacteria 59074
280 Ga0495687_000565 3300047443 Bacteria 43614
281 Ga0495687_000797 3300047443 Bacteria 33934
282 Ga0495687_004837 3300047443 Bacteria 8861
283 Ga0495675_0016162 3300047444 Bacteria 4719
284 Ga0495677_0000002 3300047445 Bacteria 346767
285 Ga0495677_0001300 3300047445 Bacteria 9978
286 Ga0495677_0052706 3300047445 Bacteria 1499
287 Ga0495679_052017 3300047446 Bacteria 1226
288 Ga0495685_001514 3300047447 Bacteria 7120
289 Ga0495681_0000100 3300047470 Bacteria 75759
290 Ga0495681_0000391 3300047470 Bacteria 34074
291 Ga0495681_0007087 3300047470 Bacteria 7233
292 Ga0495681_0028982 3300047470 Bacteria 2839
293 Ga0495681_0046248 3300047470 Bacteria 2076
294 Ga0495593_0003715 3300047673 Bacteria 9112
295 Ga0495614_0002159 3300048089 Bacteria 8710
296 Ga0495614_0002958 3300048089 Bacteria 7571
297 Ga0495626_0000004 3300048091 Bacteria 356599
298 Ga0495626_0000097 3300048091 Bacteria 113925
299 Ga0495626_0007287 3300048091 Bacteria 6170
300 Ga0495626_0015685 3300048091 Bacteria 3873
301 Ga0495626_0046627 3300048091 Bacteria 2018
302 Ga0496100_0050351 3300048903 Bacteria 2698
303 Ga0496100_0163143 3300048903 Bacteria 1599
304 Ga0496102_0000140 3300048905 Bacteria 98196
305 Ga0496102_0000406 3300048905 Bacteria 50075
306 Ga0496102_0029652 3300048905 Bacteria 4896
307 Ga0496103_0013526 3300048906 Bacteria 4840
308 Ga0496108_0189932 3300048911 Bacteria 1780
309 Ga0496109_0003323 3300048912 Bacteria 13448
310 Ga0496110_0000027 3300048913 Bacteria 71164
311 Ga0496110_0023004 3300048913 Bacteria 5298
312 Ga0496111_0019056 3300048914 Bacteria 4760
313 Ga0496113_0234237 3300048916 Bacteria 1464
314 Ga0496115_0119175 3300048918 Bacteria 2171
315 Ga0496121_0222370 3300048924 Bacteria 1329
316 Ga0496122_0000674 3300048925 Bacteria 68775
317 Ga0496123_0000492 3300048926 Bacteria 68380
318 Ga0496123_0003183 3300048926 Bacteria 18738
319 Ga0496124_0000807 3300048927 Bacteria 50885
320 Ga0496124_0008126 3300048927 Bacteria 11018
321 Ga0496124_0022007 3300048927 Bacteria 5860
322 Ga0496124_0232085 3300048927 Bacteria 1379
323 Ga0496125_0000657 3300048928 Bacteria 57617
324 Ga0495678_000107 3300049459 Bacteria 100130
325 Ga0495678_000184 3300049459 Bacteria 72485
326 Ga0495682_0000363 3300049460 Bacteria 33063
327 Ga0501034_0462586 3300049571 Bacteria 1185
328 Ga0501036_0183769 3300049572 Bacteria 1760
329 Ga0501047_0293110 3300049581 Bacteria 1471
330 Ga0501068_0000124 3300049584 Bacteria 34247
331 Ga0501070_0058236 3300049586 Bacteria 3202
332 Ga0501073_0000399 3300049589 Bacteria 29561
333 Ga0501080_0000192 3300049742 Bacteria 44688
334 Ga0501044_0316773 3300049823 Bacteria 1485
335 nmdc:mga0qj67_384662_c1 3300050509 Bacteria 1133
336 Ga0500555_000025 3300053103 Bacteria 119960
337 Ga0500616_0080252 3300053153 Bacteria 1641
338 Ga0500622_0000002 3300053156 Bacteria 646442
339 Ga0501084_0034804 3300054114 Bacteria 4212
340 Ga0466962_0173847 3300061719 Bacteria 1049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042139 Ga0450904_000112 Ga0450904_000112_11_829 272
2 3300014326 Ga0157380_10011787 Ga0157380_100117872 284
3 3300031616 Ga0307508_10031672 Ga0307508_100316724 284
4 3300005366 Ga0070659_100072054 Ga0070659_1000720542 287
5 3300025932 Ga0207690_10117424 Ga0207690_101174242 287
6 3300044658 Ga0466972_0111462 Ga0466972_0111462_259_1281 288
7 3300044684 Ga0466966_0010030 Ga0466966_0010030_5003_6025 288
8 3300046457 Ga0495590_0001797 Ga0495590_0001797_4226_5248 288
9 3300046460 Ga0495638_0015708 Ga0495638_0015708_658_1680 288
10 3300046518 Ga0495631_0000008 Ga0495631_0000008_28724_29746 288
11 3300046520 Ga0495637_0022834 Ga0495637_0022834_998_2008 288
12 3300046522 Ga0495643_0099646 Ga0495643_0099646_82_1104 288
13 3300046542 Ga0495597_0005903 Ga0495597_0005903_5098_6120 288
14 3300046616 Ga0495668_0000607 Ga0495668_0000607_5239_6261 288
15 3300047447 Ga0495685_001514 Ga0495685_001514_5557_6579 288
16 3300049459 Ga0495678_000184 Ga0495678_000184_37531_38541 288
17 3300009176 Ga0105242_10117822 Ga0105242_101178222 289
18 3300025934 Ga0207686_10003938 Ga0207686_100039385 289
19 3300037312 Ga0395899_0077459 Ga0395899_0077459_856_1872 289
20 3300037471 Ga0395905_0144943 Ga0395905_0144943_568_1572 289
21 3300046491 Ga0495584_0119347 Ga0495584_0119347_108_1118 289
22 3300046528 Ga0495642_0059857 Ga0495642_0059857_412_1419 289
23 3300046542 Ga0495597_0060711 Ga0495597_0060711_423_1433 289
24 3300046679 Ga0495623_0139027 Ga0495623_0139027_17_1012 289
25 3300047443 Ga0495687_000184 Ga0495687_000184_51806_52816 289
26 3300048903 Ga0496100_0163143 Ga0496100_0163143_266_1288 289
27 3300005563 Ga0068855_100398129 Ga0068855_1003981291 290
28 3300005616 Ga0068852_100047849 Ga0068852_1000478494 290
29 3300009174 Ga0105241_10008431 Ga0105241_100084313 290
30 3300025909 Ga0207705_10005475 Ga0207705_100054752 290
31 3300025911 Ga0207654_10002614 Ga0207654_100026147 290
32 3300025949 Ga0207667_10279037 Ga0207667_102790372 290
33 3300026078 Ga0207702_10327217 Ga0207702_103272172 290
34 3300044693 Ga0466961_0032203 Ga0466961_0032203_2313_3335 290
35 3300046457 Ga0495590_0059075 Ga0495590_0059075_57_1091 290
36 3300046474 Ga0495605_0000029 Ga0495605_0000029_174885_175919 290
37 3300046491 Ga0495584_0000973 Ga0495584_0000973_5248_6270 290
38 3300046501 Ga0495607_0001491 Ga0495607_0001491_3151_4170 290
39 3300046501 Ga0495607_0002490 Ga0495607_0002490_10446_11480 290
40 3300046513 Ga0495616_0022771 Ga0495616_0022771_1007_2026 290
41 3300046522 Ga0495643_0001791 Ga0495643_0001791_10223_11257 290
42 3300046524 Ga0495648_0003035 Ga0495648_0003035_4136_5155 290
43 3300046665 Ga0495661_0007888 Ga0495661_0007888_2962_3984 290
44 3300046794 Ga0495589_0000170 Ga0495589_0000170_24455_25489 290
45 3300046810 Ga0495660_0000127 Ga0495660_0000127_35604_36638 290
46 3300047320 Ga0495672_0004442 Ga0495672_0004442_5510_6544 290
47 3300047443 Ga0495687_000797 Ga0495687_000797_25776_26810 290
48 3300048091 Ga0495626_0000097 Ga0495626_0000097_109870_110904 290
49 3300048927 Ga0496124_0022007 Ga0496124_0022007_136_1155 290
50 3300038443 Ga0395901_0579932 Ga0395901_0579932_35_1057 291
51 3300046542 Ga0495597_0000113 Ga0495597_0000113_38484_39506 291
52 3300048927 Ga0496124_0000807 Ga0496124_0000807_37127_38128 291
53 3300042876 Ga0451577_0009167 Ga0451577_0009167_83_1123 292
54 3300045051 Ga0451576_0002774 Ga0451576_0002774_14907_15947 292
55 3300045836 Ga0466958_0031699 Ga0466958_0031699_266_1288 292
56 3300046459 Ga0495629_0234951 Ga0495629_0234951_117_1133 292
57 3300046463 Ga0495653_0010683 Ga0495653_0010683_1880_2902 292
58 3300046535 Ga0495586_0002863 Ga0495586_0002863_5048_6070 292
59 3300046663 Ga0495635_0006137 Ga0495635_0006137_651_1673 292
60 3300046689 Ga0495613_0038915 Ga0495613_0038915_635_1657 292
61 3300047322 Ga0495680_0013449 Ga0495680_0013449_3415_4437 292
62 3300047444 Ga0495675_0016162 Ga0495675_0016162_1942_2964 292
63 3300047673 Ga0495593_0003715 Ga0495593_0003715_4372_5394 292
64 3300048089 Ga0495614_0002159 Ga0495614_0002159_7165_8187 292
65 3300048918 Ga0496115_0119175 Ga0496115_0119175_829_1851 292
66 3300046471 Ga0495650_0000459 Ga0495650_0000459_37908_38918 293
67 3300046500 Ga0495596_0003307 Ga0495596_0003307_5288_6298 293
68 3300046524 Ga0495648_0000853 Ga0495648_0000853_58_1068 293
69 3300046538 Ga0495609_0002698 Ga0495609_0002698_9488_10498 293
70 3300047320 Ga0495672_0000475 Ga0495672_0000475_37734_38744 293
71 3300053103 Ga0500555_000025 Ga0500555_000025_96607_97665 293
72 3300053153 Ga0500616_0080252 Ga0500616_0080252_22_909 293
73 3300044712 Ga0453684_0435883 Ga0453684_0435883_42_1013 294
74 3300028800 Ga0265338_10008893 Ga0265338_100088936 296
75 3300013297 Ga0157378_10481575 Ga0157378_104815752 297
76 3300025303 Ga0209051_1000856 Ga0209051_100085615 297
77 3300028563 Ga0265319_1000516 Ga0265319_100051621 297
78 3300028800 Ga0265338_10022827 Ga0265338_100228277 297
79 3300028800 Ga0265338_10152833 Ga0265338_101528333 297
80 3300031240 Ga0265320_10025642 Ga0265320_100256424 297
81 3300031251 Ga0265327_10000213 Ga0265327_1000021349 297
82 3300049581 Ga0501047_0293110 Ga0501047_0293110_448_1452 297
83 3300049584 Ga0501068_0000124 Ga0501068_0000124_18545_19531 297
84 3300049586 Ga0501070_0058236 Ga0501070_0058236_1009_1995 297
85 3300049589 Ga0501073_0000399 Ga0501073_0000399_17370_18356 297
86 3300049742 Ga0501080_0000192 Ga0501080_0000192_24418_25404 297
87 3300049823 Ga0501044_0316773 Ga0501044_0316773_117_1109 297
88 3300054114 Ga0501084_0034804 Ga0501084_0034804_2923_3909 297
89 iso_pu_bacteria 2952252522 2952256235 297
90 3300003316 rootH1_10179806 rootH1_101798062 298
91 3300003320 rootH2_10002624 rootH2_100026243 298
92 3300003322 rootL2_10217873 rootL2_102178732 298
93 3300003323 rootH1_10199924 rootH1_101999242 298
94 3300005577 Ga0068857_100368597 Ga0068857_1003685972 298
95 3300005719 Ga0068861_100251685 Ga0068861_1002516851 298
96 3300009093 Ga0105240_10070615 Ga0105240_100706152 298
97 3300009545 Ga0105237_10307333 Ga0105237_103073331 298
98 3300009551 Ga0105238_10178547 Ga0105238_101785472 298
99 3300013306 Ga0163162_10000043 Ga0163162_1000004311 298
100 3300025913 Ga0207695_10010158 Ga0207695_1001015813 298
101 3300025914 Ga0207671_10186111 Ga0207671_101861112 298
102 3300028573 Ga0265334_10043696 Ga0265334_100436962 298
103 3300028653 Ga0265323_10013678 Ga0265323_100136783 298
104 3300028800 Ga0265338_10000008 Ga0265338_10000008420 298
105 3300028800 Ga0265338_10000593 Ga0265338_1000059341 298
106 3300028800 Ga0265338_10007764 Ga0265338_100077646 298
107 3300029957 Ga0265324_10007861 Ga0265324_100078615 298
108 3300031249 Ga0265339_10114886 Ga0265339_101148862 298
109 3300031251 Ga0265327_10002332 Ga0265327_1000233215 298
110 3300031251 Ga0265327_10003389 Ga0265327_100033899 298
111 3300031344 Ga0265316_10002265 Ga0265316_1000226512 298
112 3300031344 Ga0265316_10005611 Ga0265316_100056117 298
113 3300031344 Ga0265316_10024926 Ga0265316_100249264 298
114 3300031616 Ga0307508_10000183 Ga0307508_1000018343 298
115 3300031616 Ga0307508_10035172 Ga0307508_100351722 298
116 3300031711 Ga0265314_10157373 Ga0265314_101573732 298
117 3300031712 Ga0265342_10134465 Ga0265342_101344652 298
118 3300035085 Ga0373929_0000001 Ga0373929_0000001_780339_781364 298
119 3300037418 Ga0395900_0028634 Ga0395900_0028634_818_1837 298
120 3300042876 Ga0451577_0009084 Ga0451577_0009084_7150_8169 298
121 3300044658 Ga0466972_0003275 Ga0466972_0003275_3831_4850 298
122 3300044683 Ga0466965_0003398 Ga0466965_0003398_5724_6743 298
123 3300044684 Ga0466966_0005589 Ga0466966_0005589_4322_5344 298
124 3300044693 Ga0466961_0014395 Ga0466961_0014395_3306_4292 298
125 3300044735 Ga0466968_0000373 Ga0466968_0000373_12905_13924 298
126 3300044842 Ga0466957_0002309 Ga0466957_0002309_5522_6544 298
127 3300044901 Ga0466960_0033503 Ga0466960_0033503_698_1717 298
128 3300045049 Ga0466959_0003434 Ga0466959_0003434_5201_6223 298
129 3300046452 Ga0495617_000030 Ga0495617_000030_52071_53081 298
130 3300046452 Ga0495617_000228 Ga0495617_000228_18747_19757 298
131 3300046453 Ga0495627_000317 Ga0495627_000317_13849_14859 298
132 3300046455 Ga0495603_0029429 Ga0495603_0029429_1587_2597 298
133 3300046460 Ga0495638_0060430 Ga0495638_0060430_553_1563 298
134 3300046471 Ga0495650_0007914 Ga0495650_0007914_5268_6290 298
135 3300046473 Ga0495582_0025022 Ga0495582_0025022_489_1499 298
136 3300046473 Ga0495582_0031782 Ga0495582_0031782_1180_2190 298
137 3300046474 Ga0495605_0000046 Ga0495605_0000046_75664_76674 298
138 3300046474 Ga0495605_0007660 Ga0495605_0007660_4832_5860 298
139 3300046474 Ga0495605_0051895 Ga0495605_0051895_594_1604 298
140 3300046474 Ga0495605_0100364 Ga0495605_0100364_33_1043 298
141 3300046491 Ga0495584_0000003 Ga0495584_0000003_46293_47303 298
142 3300046491 Ga0495584_0000127 Ga0495584_0000127_23821_24831 298
143 3300046491 Ga0495584_0064935 Ga0495584_0064935_82_1110 298
144 3300046491 Ga0495584_0102470 Ga0495584_0102470_267_1277 298
145 3300046492 Ga0495585_0000010 Ga0495585_0000010_195027_196037 298
146 3300046492 Ga0495585_0000133 Ga0495585_0000133_44859_45869 298
147 3300046492 Ga0495585_0000610 Ga0495585_0000610_29351_30358 298
148 3300046492 Ga0495585_0001536 Ga0495585_0001536_3104_4126 298
149 3300046492 Ga0495585_0035343 Ga0495585_0035343_1761_2771 298
150 3300046492 Ga0495585_0044576 Ga0495585_0044576_541_1551 298
151 3300046492 Ga0495585_0169764 Ga0495585_0169764_54_1064 298
152 3300046499 Ga0495594_0000959 Ga0495594_0000959_3454_4464 298
153 3300046499 Ga0495594_0023635 Ga0495594_0023635_601_1623 298
154 3300046500 Ga0495596_0000672 Ga0495596_0000672_11873_12883 298
155 3300046500 Ga0495596_0000905 Ga0495596_0000905_8564_9574 298
156 3300046500 Ga0495596_0003398 Ga0495596_0003398_2561_3571 298
157 3300046500 Ga0495596_0005701 Ga0495596_0005701_3072_4082 298
158 3300046500 Ga0495596_0009102 Ga0495596_0009102_51_1061 298
159 3300046501 Ga0495607_0000532 Ga0495607_0000532_11204_12232 298
160 3300046501 Ga0495607_0001454 Ga0495607_0001454_9391_10401 298
161 3300046506 Ga0495583_0000157 Ga0495583_0000157_45741_46748 298
162 3300046506 Ga0495583_0000176 Ga0495583_0000176_12411_13421 298
163 3300046506 Ga0495583_0000580 Ga0495583_0000580_34342_35352 298
164 3300046506 Ga0495583_0006062 Ga0495583_0006062_913_1923 298
165 3300046506 Ga0495583_0079959 Ga0495583_0079959_80_1102 298
166 3300046507 Ga0495606_0069565 Ga0495606_0069565_763_1773 298
167 3300046513 Ga0495616_0000250 Ga0495616_0000250_12107_13117 298
168 3300046513 Ga0495616_0052607 Ga0495616_0052607_599_1645 298
169 3300046513 Ga0495616_0064978 Ga0495616_0064978_491_1501 298
170 3300046513 Ga0495616_0120971 Ga0495616_0120971_179_1189 298
171 3300046515 Ga0495620_0041232 Ga0495620_0041232_679_1689 298
172 3300046518 Ga0495631_0002094 Ga0495631_0002094_21_1043 298
173 3300046518 Ga0495631_0006213 Ga0495631_0006213_620_1630 298
174 3300046518 Ga0495631_0023205 Ga0495631_0023205_1730_2740 298
175 3300046518 Ga0495631_0027029 Ga0495631_0027029_1587_2597 298
176 3300046519 Ga0495632_0000140 Ga0495632_0000140_47867_48877 298
177 3300046519 Ga0495632_0000398 Ga0495632_0000398_24415_25437 298
178 3300046522 Ga0495643_0017951 Ga0495643_0017951_1346_2353 298
179 3300046522 Ga0495643_0019030 Ga0495643_0019030_2524_3546 298
180 3300046522 Ga0495643_0067659 Ga0495643_0067659_525_1532 298
181 3300046523 Ga0495644_0004490 Ga0495644_0004490_86_1096 298
182 3300046524 Ga0495648_0000003 Ga0495648_0000003_33922_34932 298
183 3300046524 Ga0495648_0000309 Ga0495648_0000309_45508_46518 298
184 3300046526 Ga0495666_0000377 Ga0495666_0000377_4158_5168 298
185 3300046526 Ga0495666_0050791 Ga0495666_0050791_333_1343 298
186 3300046528 Ga0495642_0000013 Ga0495642_0000013_95932_96942 298
187 3300046528 Ga0495642_0000070 Ga0495642_0000070_27056_28078 298
188 3300046528 Ga0495642_0000161 Ga0495642_0000161_21009_22043 298
189 3300046528 Ga0495642_0001063 Ga0495642_0001063_45_1055 298
190 3300046528 Ga0495642_0011630 Ga0495642_0011630_1818_2828 298
191 3300046528 Ga0495642_0038301 Ga0495642_0038301_749_1759 298
192 3300046528 Ga0495642_0039114 Ga0495642_0039114_310_1320 298
193 3300046531 Ga0495665_0013553 Ga0495665_0013553_795_1805 298
194 3300046535 Ga0495586_0040924 Ga0495586_0040924_508_1524 298
195 3300046535 Ga0495586_0080929 Ga0495586_0080929_339_1352 298
196 3300046538 Ga0495609_0000105 Ga0495609_0000105_73344_74372 298
197 3300046538 Ga0495609_0005084 Ga0495609_0005084_126_1148 298
198 3300046538 Ga0495609_0005285 Ga0495609_0005285_2979_3989 298
199 3300046538 Ga0495609_0007781 Ga0495609_0007781_1759_2769 298
200 3300046538 Ga0495609_0036774 Ga0495609_0036774_27_1037 298
201 3300046542 Ga0495597_0000307 Ga0495597_0000307_18216_19238 298
202 3300046542 Ga0495597_0014400 Ga0495597_0014400_643_1653 298
203 3300046543 Ga0495645_0084883 Ga0495645_0084883_466_1500 298
204 3300046557 Ga0495622_0008555 Ga0495622_0008555_1997_3019 298
205 3300046558 Ga0495633_0001158 Ga0495633_0001158_2976_3986 298
206 3300046558 Ga0495633_0004368 Ga0495633_0004368_7734_8756 298
207 3300046558 Ga0495633_0014508 Ga0495633_0014508_1304_2314 298
208 3300046558 Ga0495633_0043586 Ga0495633_0043586_1146_2114 298
209 3300046616 Ga0495668_0000755 Ga0495668_0000755_5878_6888 298
210 3300046616 Ga0495668_0000855 Ga0495668_0000855_4445_5455 298
211 3300046616 Ga0495668_0004080 Ga0495668_0004080_7966_8976 298
212 3300046616 Ga0495668_0007691 Ga0495668_0007691_2540_3550 298
213 3300046616 Ga0495668_0190021 Ga0495668_0190021_101_1108 298
214 3300046648 Ga0495611_0008839 Ga0495611_0008839_1264_2274 298
215 3300046664 Ga0495659_0021705 Ga0495659_0021705_290_1297 298
216 3300046665 Ga0495661_0000081 Ga0495661_0000081_73344_74372 298
217 3300046665 Ga0495661_0000248 Ga0495661_0000248_22392_23402 298
218 3300046665 Ga0495661_0001485 Ga0495661_0001485_8469_9491 298
219 3300046665 Ga0495661_0002806 Ga0495661_0002806_1587_2597 298
220 3300046665 Ga0495661_0011504 Ga0495661_0011504_3279_4286 298
221 3300046665 Ga0495661_0040446 Ga0495661_0040446_821_1843 298
222 3300046674 Ga0495588_0000086 Ga0495588_0000086_7924_8970 298
223 3300046674 Ga0495588_0015776 Ga0495588_0015776_2096_3106 298
224 3300046674 Ga0495588_0027656 Ga0495588_0027656_143_1150 298
225 3300046674 Ga0495588_0070077 Ga0495588_0070077_173_1183 298
226 3300046684 Ga0495669_0000025 Ga0495669_0000025_75012_76022 298
227 3300046684 Ga0495669_0136008 Ga0495669_0136008_25_1035 298
228 3300046690 Ga0495624_0019747 Ga0495624_0019747_958_1980 298
229 3300046691 Ga0495670_0005186 Ga0495670_0005186_2543_3553 298
230 3300046691 Ga0495670_0009807 Ga0495670_0009807_1750_2772 298
231 3300046691 Ga0495670_0010995 Ga0495670_0010995_3102_4112 298
232 3300046692 Ga0495671_0000869 Ga0495671_0000869_8045_9055 298
233 3300046692 Ga0495671_0057163 Ga0495671_0057163_382_1392 298
234 3300046692 Ga0495671_0097646 Ga0495671_0097646_382_1392 298
235 3300046694 Ga0495649_0070802 Ga0495649_0070802_364_1374 298
236 3300046794 Ga0495589_0000135 Ga0495589_0000135_51248_52276 298
237 3300046794 Ga0495589_0000157 Ga0495589_0000157_23404_24426 298
238 3300046794 Ga0495589_0001377 Ga0495589_0001377_4918_5928 298
239 3300046794 Ga0495589_0018008 Ga0495589_0018008_2552_3562 298
240 3300046794 Ga0495589_0023800 Ga0495589_0023800_866_1876 298
241 3300046810 Ga0495660_0051812 Ga0495660_0051812_679_1689 298
242 3300047318 Ga0495636_0101875 Ga0495636_0101875_67_1116 298
243 3300047319 Ga0495674_0004869 Ga0495674_0004869_4357_5364 298
244 3300047320 Ga0495672_0013888 Ga0495672_0013888_3931_4941 298
245 3300047321 Ga0495676_0000140 Ga0495676_0000140_18018_19028 298
246 3300047321 Ga0495676_0032670 Ga0495676_0032670_1964_2974 298
247 3300047323 Ga0495683_0000046 Ga0495683_0000046_75974_76984 298
248 3300047323 Ga0495683_0055523 Ga0495683_0055523_405_1415 298
249 3300047443 Ga0495687_000033 Ga0495687_000033_189417_190445 298
250 3300047443 Ga0495687_000102 Ga0495687_000102_59717_60751 298
251 3300047443 Ga0495687_000349 Ga0495687_000349_40088_41110 298
252 3300047443 Ga0495687_000565 Ga0495687_000565_4251_5261 298
253 3300047443 Ga0495687_004837 Ga0495687_004837_2392_3399 298
254 3300047445 Ga0495677_0000002 Ga0495677_0000002_272396_273424 298
255 3300047445 Ga0495677_0001300 Ga0495677_0001300_2234_3244 298
256 3300047445 Ga0495677_0052706 Ga0495677_0052706_260_1294 298
257 3300047446 Ga0495679_052017 Ga0495679_052017_72_1094 298
258 3300047470 Ga0495681_0000100 Ga0495681_0000100_48401_49423 298
259 3300047470 Ga0495681_0000391 Ga0495681_0000391_27088_28110 298
260 3300047470 Ga0495681_0007087 Ga0495681_0007087_1095_2105 298
261 3300047470 Ga0495681_0028982 Ga0495681_0028982_567_1577 298
262 3300047470 Ga0495681_0046248 Ga0495681_0046248_405_1415 298
263 3300048089 Ga0495614_0002958 Ga0495614_0002958_1623_2633 298
264 3300048091 Ga0495626_0000004 Ga0495626_0000004_295264_296262 298
265 3300048091 Ga0495626_0007287 Ga0495626_0007287_4386_5414 298
266 3300048091 Ga0495626_0015685 Ga0495626_0015685_2133_3143 298
267 3300048091 Ga0495626_0046627 Ga0495626_0046627_717_1727 298
268 3300048903 Ga0496100_0050351 Ga0496100_0050351_1576_2586 298
269 3300048905 Ga0496102_0000140 Ga0496102_0000140_40126_41148 298
270 3300048905 Ga0496102_0000406 Ga0496102_0000406_16110_17222 298
271 3300048905 Ga0496102_0029652 Ga0496102_0029652_415_1437 298
272 3300048906 Ga0496103_0013526 Ga0496103_0013526_1719_2741 298
273 3300048911 Ga0496108_0189932 Ga0496108_0189932_63_1085 298
274 3300048912 Ga0496109_0003323 Ga0496109_0003323_2520_3530 298
275 3300048913 Ga0496110_0000027 Ga0496110_0000027_41505_42515 298
276 3300048913 Ga0496110_0023004 Ga0496110_0023004_3463_4485 298
277 3300048914 Ga0496111_0019056 Ga0496111_0019056_1426_2448 298
278 3300048916 Ga0496113_0234237 Ga0496113_0234237_299_1309 298
279 3300048924 Ga0496121_0222370 Ga0496121_0222370_170_1192 298
280 3300048925 Ga0496122_0000674 Ga0496122_0000674_38503_39513 298
281 3300048926 Ga0496123_0000492 Ga0496123_0000492_38636_39646 298
282 3300048926 Ga0496123_0003183 Ga0496123_0003183_11200_12219 298
283 3300048927 Ga0496124_0008126 Ga0496124_0008126_8361_9371 298
284 3300048928 Ga0496125_0000657 Ga0496125_0000657_12672_13682 298
285 3300049459 Ga0495678_000107 Ga0495678_000107_30083_31093 298
286 3300049460 Ga0495682_0000363 Ga0495682_0000363_29078_30088 298
287 3300049571 Ga0501034_0462586 Ga0501034_0462586_85_1083 298
288 3300049572 Ga0501036_0183769 Ga0501036_0183769_679_1698 298
289 3300053156 Ga0500622_0000002 Ga0500622_0000002_368505_369509 298
290 3300061719 Ga0466962_0173847 Ga0466962_0173847_10_993 298
291 iso_pu_bacteria 2643221629 2644167447 298
292 iso_pu_bacteria 2643221662 2644347210 298
293 iso_pu_bacteria 2808606418 2809142550 298
294 iso_pu_bacteria 8047673197 8047674851 298
295 2124908027 MRS2a_Contig_842 MRS2a_00693100 299
296 3300006358 Ga0068871_100094509 Ga0068871_1000945092 299
297 3300006846 Ga0075430_100247839 Ga0075430_1002478391 299
298 3300009011 Ga0105251_10000060 Ga0105251_1000006088 299
299 3300013100 Ga0157373_10003330 Ga0157373_100033308 299
300 3300013104 Ga0157370_10026152 Ga0157370_100261522 299
301 3300013308 Ga0157375_10194357 Ga0157375_101943572 299
302 3300015261 Ga0182006_1017384 Ga0182006_10173842 299
303 3300026088 Ga0207641_10059480 Ga0207641_100594804 299
304 3300028556 Ga0265337_1023990 Ga0265337_10239902 299
305 3300028556 Ga0265337_1045704 Ga0265337_10457041 299
306 3300028558 Ga0265326_10006308 Ga0265326_100063083 299
307 3300028563 Ga0265319_1000001 Ga0265319_1000001450 299
308 3300028573 Ga0265334_10061505 Ga0265334_100615051 299
309 3300028653 Ga0265323_10000403 Ga0265323_1000040318 299
310 3300028654 Ga0265322_10004294 Ga0265322_100042944 299
311 3300028666 Ga0265336_10044842 Ga0265336_100448421 299
312 3300028800 Ga0265338_10003058 Ga0265338_1000305810 299
313 3300028800 Ga0265338_10006488 Ga0265338_100064888 299
314 3300028800 Ga0265338_10015530 Ga0265338_100155305 299
315 3300029957 Ga0265324_10000856 Ga0265324_1000085611 299
316 3300029957 Ga0265324_10009304 Ga0265324_100093043 299
317 3300029957 Ga0265324_10025379 Ga0265324_100253792 299
318 3300029957 Ga0265324_10052343 Ga0265324_100523432 299
319 3300031239 Ga0265328_10006716 Ga0265328_100067167 299
320 3300031240 Ga0265320_10000707 Ga0265320_100007076 299
321 3300031240 Ga0265320_10053968 Ga0265320_100539681 299
322 3300031247 Ga0265340_10001288 Ga0265340_100012886 299
323 3300031250 Ga0265331_10002575 Ga0265331_100025759 299
324 3300031250 Ga0265331_10030597 Ga0265331_100305973 299
325 3300031251 Ga0265327_10000730 Ga0265327_1000073036 299
326 3300031251 Ga0265327_10002506 Ga0265327_1000250614 299
327 3300031344 Ga0265316_10128664 Ga0265316_101286641 299
328 3300031548 Ga0307408_100037976 Ga0307408_1000379763 299
329 3300031548 Ga0307408_100136339 Ga0307408_1001363392 299
330 3300031595 Ga0265313_10002447 Ga0265313_100024478 299
331 3300031595 Ga0265313_10004624 Ga0265313_100046242 299
332 3300031711 Ga0265314_10001317 Ga0265314_1000131721 299
333 3300031711 Ga0265314_10005930 Ga0265314_1000593011 299
334 3300031711 Ga0265314_10067440 Ga0265314_100674403 299
335 3300031911 Ga0307412_10110748 Ga0307412_101107482 299
336 3300042115 Ga0450911_000027 Ga0450911_000027_43571_44566 299
337 3300042438 Ga0439459_0000801 Ga0439459_0000801_1827_2822 299
338 3300042876 Ga0451577_0264528 Ga0451577_0264528_116_1270 299
339 3300044712 Ga0453684_0062444 Ga0453684_0062444_334_1470 299
340 3300046506 Ga0495583_0001564 Ga0495583_0001564_4223_5221 299
341 3300046520 Ga0495637_0005549 Ga0495637_0005549_2786_3784 299
342 3300046530 Ga0495654_0021448 Ga0495654_0021448_14_913 299
343 3300046694 Ga0495649_0065411 Ga0495649_0065411_14_1066 299
344 3300048927 Ga0496124_0232085 Ga0496124_0232085_466_1365 299
345 3300050509 nmdc:mga0qj67_384662_c1 nmdc:mga0qj67_384662_c1_35_1066 299
346 iso_pu_bacteria 2808606373 2808905760 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

37

320

0.81

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

36

312

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9251 2 287
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9232 2 290
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9172 2 290
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9101 2 287
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.8422 8 274
ID Description Score Start End Superfamily
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9729 2 255 3.40.190.10
af_P16700_120_332_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9361 82 285 3.40.190.10
af_P16700_16_293_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9356 2 246 3.40.50.1100
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9326 82 285 3.40.190.10
af_P16700_120_332_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8943 82 285 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1H4YK23-F1-model_v4 Sulfate/thiosulfate-binding protein 0.9965 1 286 GO:0042597
GO:1902358
AF-A0A5E7GP33-F1-model_v4 deleted 0.9939 1 290
AF-A0A5E7VYV4-F1-model_v4 Sulfate-binding protein 0.9938 1 290 GO:0042597
GO:1902358
AF-A0A0P9GN89-F1-model_v4 deleted 0.9916 1 290
AF-A0A5E7GP33-F1-model_v4 deleted 0.9905 1 290

Feature Viewer

pLDDT pTM Quality
94.39 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map