F416808

General Info

Members Datasets Scaffolds Average Seq Length
346 231 692 100

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_101467011|Ga0307408_1014670112
Length 101
Sequence MRRLAQAPNLAIATLWADALREEGIDVSVQREYLAGVAGELPPDQCLPEVWVRDDSQLPRAERLLMALRQPPQRRWHCAACGELVEGGFEQCWSCGAMMAP

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
127 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
128 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
129 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
132 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
133 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
140 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
141 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
142 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
143 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
144 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
145 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
148 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
153 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
204 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
205 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
206 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
210 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 2842747753 Variovorax sp. R-72060 Isolate Unclassified
226 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
227 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
228 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
229 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
230 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
231 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.08
Nodule 0.29
Rhizoplane 5.49
Rhizosphere 73.12
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_101467011 3300031548 Bacteria 644
2 JGI25150J39212_1015850 3300002774 Bacteria 1247
3 JGI25159J45721_1003798 3300002987 Bacteria 5203
4 Ga0055526_1014440 3300003771 Bacteria 3248
5 Ga0055537_1000328 3300003773 Bacteria 32405
6 Ga0055524_1000101 3300003775 Bacteria 106527
7 Ga0055536_1021446 3300003781 Bacteria 1960
8 Ga0055534_1008375 3300003784 Bacteria 2346
9 Ga0055528_1001455 3300003790 Bacteria 14428
10 Ga0055530_10000251 3300003791 Bacteria 48732
11 Ga0055530_10093848 3300003791 Bacteria 611
12 Ga0055540_1000099 3300003792 Bacteria 96187
13 Ga0055531_10015479 3300003794 Bacteria 3356
14 Ga0065165_1029004 3300005262 Bacteria 1778
15 Ga0065165_1142907 3300005262 Bacteria 564
16 Ga0070658_10058674 3300005327 Bacteria 3133
17 Ga0070658_10080760 3300005327 Bacteria 2671
18 Ga0070676_11139548 3300005328 Bacteria 591
19 Ga0070683_102275154 3300005329 Bacteria 520
20 Ga0070670_100067909 3300005331 Bacteria 3059
21 Ga0070670_100230273 3300005331 Bacteria 1613
22 Ga0070677_10149052 3300005333 Bacteria 1087
23 Ga0068869_100148735 3300005334 Bacteria 1815
24 Ga0068869_100395352 3300005334 Bacteria 1136
25 Ga0068868_100027085 3300005338 Bacteria 4371
26 Ga0068868_100086250 3300005338 Bacteria 2524
27 Ga0068868_100217253 3300005338 Bacteria 1599
28 Ga0070660_100097503 3300005339 Bacteria 2326
29 Ga0070660_101264554 3300005339 Bacteria 626
30 Ga0070660_101293460 3300005339 Bacteria 619
31 Ga0070669_100012863 3300005353 Bacteria 5944
32 Ga0070671_101860065 3300005355 Bacteria 535
33 Ga0070673_100088644 3300005364 Bacteria 2524
34 Ga0070659_100115689 3300005366 Bacteria 2168
35 Ga0070667_100206270 3300005367 Bacteria 1745
36 Ga0070685_10490347 3300005466 Bacteria 868
37 Ga0070679_100051090 3300005530 Bacteria 4118
38 Ga0070679_101368362 3300005530 Bacteria 654
39 Ga0068853_100570705 3300005539 Bacteria 1073
40 Ga0070672_100598487 3300005543 Bacteria 960
41 Ga0070665_101602766 3300005548 Bacteria 659
42 Ga0068855_100008747 3300005563 Bacteria 12243
43 Ga0068855_100736025 3300005563 Bacteria 1053
44 Ga0068857_100045886 3300005577 Bacteria 3878
45 Ga0068857_100277951 3300005577 Bacteria 1540
46 Ga0068852_100641160 3300005616 Bacteria 1069
47 Ga0068859_100641616 3300005617 Bacteria 1154
48 Ga0068864_100014557 3300005618 Bacteria 6536
49 Ga0068863_100039361 3300005841 Bacteria 4499
50 Ga0068863_100712556 3300005841 Bacteria 998
51 Ga0075365_10057242 3300006038 Bacteria 2593
52 Ga0075365_10382108 3300006038 Bacteria 993
53 Ga0075368_10244465 3300006042 Bacteria 766
54 Ga0075363_100056825 3300006048 Bacteria 2099
55 Ga0075363_100101850 3300006048 Bacteria 1590
56 Ga0075363_100698223 3300006048 Bacteria 612
57 Ga0075364_10408197 3300006051 Bacteria 927
58 Ga0075362_10688283 3300006177 Bacteria 533
59 Ga0075362_10740415 3300006177 Bacteria 514
60 Ga0075367_10764153 3300006178 Bacteria 615
61 Ga0075366_10045361 3300006195 Bacteria 2605
62 Ga0075366_10056479 3300006195 Bacteria 2332
63 Ga0075366_10081823 3300006195 Bacteria 1929
64 Ga0075366_10146990 3300006195 Bacteria 1426
65 Ga0075366_10636299 3300006195 Bacteria 662
66 Ga0075370_10010011 3300006353 Bacteria 4943
67 Ga0075370_10343507 3300006353 Bacteria 891
68 Ga0097620_100641715 3300006931 Bacteria 1154
69 Ga0105240_10012435 3300009093 Bacteria 11750
70 Ga0105243_12401309 3300009148 Bacteria 565
71 Ga0105241_11802697 3300009174 Bacteria 597
72 Ga0105248_10834135 3300009177 Bacteria 1040
73 Ga0105238_10650444 3300009551 Bacteria 1064
74 Ga0105249_13076186 3300009553 Bacteria 536
75 Ga0105239_11214456 3300010375 Bacteria 869
76 Ga0157374_11711709 3300013296 Bacteria 654
77 Ga0157378_11180656 3300013297 Bacteria 804
78 Ga0163162_10249748 3300013306 Bacteria 1906
79 Ga0163162_12899122 3300013306 Bacteria 552
80 Ga0157375_10852306 3300013308 Bacteria 1058
81 Ga0163163_11101279 3300014325 Bacteria 857
82 Ga0157376_10113947 3300014969 Bacteria 2385
83 Ga0157376_10265624 3300014969 Bacteria 1610
84 Ga0182006_1155042 3300015261 Bacteria 775
85 Ga0183362_10004 3300015683 Bacteria 569303
86 Ga0213876_10462779 3300021384 Bacteria 675
87 Ga0207425_1012153 3300025245 Bacteria 2030
88 Ga0209565_1000041 3300025263 Bacteria 251081
89 Ga0209673_1000012 3300025273 Bacteria 579480
90 Ga0209673_1070107 3300025273 Bacteria 838
91 Ga0209130_1000694 3300025284 Bacteria 30085
92 Ga0209130_1001639 3300025284 Bacteria 13731
93 Ga0209675_1000483 3300025291 Bacteria 30258
94 Ga0209675_1003365 3300025291 Bacteria 7648
95 Ga0209676_1000013 3300025292 Bacteria 816080
96 Ga0209676_1037388 3300025292 Bacteria 1401
97 Ga0209025_1072586 3300025294 Bacteria 1212
98 Ga0209564_1000363 3300025295 Bacteria 84210
99 Ga0209564_1071927 3300025295 Bacteria 714
100 Ga0209050_1000008 3300025298 Bacteria 1144179
101 Ga0209050_1065517 3300025298 Bacteria 836
102 Ga0209256_1000003 3300025299 Bacteria 1661127
103 Ga0207426_1014564 3300025302 Bacteria 2877
104 Ga0209051_1000005 3300025303 Bacteria 1142353
105 Ga0209051_1004497 3300025303 Bacteria 8564
106 Ga0209257_1000048 3300025304 Bacteria 455536
107 Ga0209257_1006617 3300025304 Bacteria 7376
108 Ga0207705_10047488 3300025909 Bacteria 3087
109 Ga0207705_10302673 3300025909 Bacteria 1226
110 Ga0207695_10023681 3300025913 Bacteria 6929
111 Ga0207660_11527867 3300025917 Unclassified 539
112 Ga0207662_10911853 3300025918 Bacteria 622
113 Ga0207652_10036041 3300025921 Bacteria 4180
114 Ga0207652_11405110 3300025921 Bacteria 601
115 Ga0207681_10009797 3300025923 Bacteria 5861
116 Ga0207694_11317322 3300025924 Bacteria 611
117 Ga0207650_10047479 3300025925 Bacteria 3164
118 Ga0207687_10876408 3300025927 Bacteria 768
119 Ga0207690_10600293 3300025932 Bacteria 898
120 Ga0207711_10893932 3300025941 Bacteria 826
121 Ga0207689_10013615 3300025942 Bacteria 6936
122 Ga0207689_10138967 3300025942 Bacteria 2001
123 Ga0207667_10062358 3300025949 Bacteria 3898
124 Ga0207667_10542602 3300025949 Bacteria 1177
125 Ga0207651_10125449 3300025960 Bacteria 1955
126 Ga0207640_12083397 3300025981 Bacteria 514
127 Ga0207658_10048581 3300025986 Bacteria 3112
128 Ga0207677_10006997 3300026023 Bacteria 6206
129 Ga0207677_10014144 3300026023 Bacteria 4650
130 Ga0207677_10178064 3300026023 Bacteria 1670
131 Ga0207639_10619780 3300026041 Bacteria 999
132 Ga0207702_10445664 3300026078 Bacteria 1255
133 Ga0207641_10603159 3300026088 Bacteria 1075
134 Ga0207676_10006627 3300026095 Bacteria 8188
135 Ga0207683_10019483 3300026121 Bacteria 5794
136 Ga0207698_10342857 3300026142 Bacteria 1408
137 Ga0207698_12142342 3300026142 Bacteria 572
138 Ga0209813_10340450 3300027866 Bacteria 592
139 Ga0268266_11233831 3300028379 Bacteria 723
140 Ga0265332_10013175 3300031238 Bacteria 3665
141 Ga0265328_10429661 3300031239 Bacteria 520
142 Ga0265329_10013449 3300031242 Bacteria 2917
143 Ga0265327_10519145 3300031251 Bacteria 513
144 Ga0307408_100081634 3300031548 Bacteria 2417
145 Ga0307408_100183570 3300031548 Bacteria 1679
146 Ga0307408_100488420 3300031548 Bacteria 1076
147 Ga0307408_100553051 3300031548 Bacteria 1016
148 Ga0307408_100959491 3300031548 Bacteria 786
149 Ga0307408_100963288 3300031548 Bacteria 784
150 Ga0307408_100980025 3300031548 Bacteria 778
151 Ga0307408_101142976 3300031548 Bacteria 724
152 Ga0265314_10014690 3300031711 Bacteria 6249
153 Ga0265342_10126580 3300031712 Bacteria 1434
154 Ga0307516_10096032 3300031730 Bacteria 2785
155 Ga0307405_10043917 3300031731 Bacteria 2730
156 Ga0307405_10872098 3300031731 Bacteria 759
157 Ga0307405_11500190 3300031731 Bacteria 592
158 Ga0307413_11427450 3300031824 Bacteria 610
159 Ga0307410_10384060 3300031852 Bacteria 1131
160 Ga0307406_11200845 3300031901 Bacteria 659
161 Ga0307412_10075264 3300031911 Bacteria 2315
162 Ga0307412_10187232 3300031911 Bacteria 1562
163 Ga0307412_10191626 3300031911 Bacteria 1546
164 Ga0307412_10261464 3300031911 Bacteria 1349
165 Ga0307412_11068464 3300031911 Bacteria 717
166 Ga0307412_11978662 3300031911 Bacteria 539
167 Ga0307412_12182485 3300031911 Bacteria 515
168 Ga0307409_100297966 3300031995 Bacteria 1499
169 Ga0307409_101512592 3300031995 Bacteria 699
170 Ga0307416_100218781 3300032002 Bacteria 1824
171 Ga0307416_101239679 3300032002 Bacteria 851
172 Ga0307416_101643886 3300032002 Bacteria 747
173 Ga0307416_101819309 3300032002 Bacteria 713
174 Ga0307416_102106050 3300032002 Bacteria 666
175 Ga0307414_10167894 3300032004 Bacteria 1751
176 Ga0307411_10183306 3300032005 Bacteria 1591
177 Ga0307415_101877313 3300032126 Bacteria 581
178 Ga0373931_0167391 3300035691 Bacteria 1292
179 Ga0373931_0414939 3300035691 Bacteria 855
180 Ga0395899_0003555 3300037312 Bacteria 12338
181 Ga0395899_0684636 3300037312 Bacteria 645
182 Ga0395900_0005229 3300037418 Bacteria 13619
183 Ga0395900_0363019 3300037418 Bacteria 1419
184 Ga0395900_0654253 3300037418 Bacteria 987
185 Ga0395900_0853014 3300037418 Bacteria 836
186 Ga0395898_0008110 3300037466 Bacteria 11117
187 Ga0395898_0022034 3300037466 Bacteria 6454
188 Ga0395898_1022336 3300037466 Bacteria 762
189 Ga0395898_1280171 3300037466 Bacteria 663
190 Ga0395905_0000047 3300037471 Bacteria 237582
191 Ga0395905_0001133 3300037471 Bacteria 33350
192 Ga0395905_0008913 3300037471 Bacteria 9850
193 Ga0395905_0015524 3300037471 Bacteria 7238
194 Ga0395905_0050884 3300037471 Bacteria 3880
195 Ga0395905_0068943 3300037471 Bacteria 3312
196 Ga0395905_0079675 3300037471 Bacteria 3070
197 Ga0395905_0969974 3300037471 Bacteria 753
198 Ga0395901_0009451 3300038443 Bacteria 9892
199 Ga0395901_0010842 3300038443 Bacteria 9242
200 Ga0395901_0011724 3300038443 Bacteria 8885
201 Ga0395901_0042343 3300038443 Bacteria 4721
202 Ga0395901_0077358 3300038443 Bacteria 3472
203 Ga0395901_0080683 3300038443 Bacteria 3398
204 Ga0395901_0469440 3300038443 Bacteria 1285
205 Ga0395901_1230441 3300038443 Bacteria 713
206 Ga0436365_1907260 3300039437 Bacteria 662
207 Ga0439436_0001667 3300041404 Bacteria 6486
208 Ga0439436_0071144 3300041404 Bacteria 969
209 Ga0439439_0000779 3300041406 Bacteria 5766
210 Ga0439447_037865 3300041407 Bacteria 1187
211 Ga0439466_0006317 3300041411 Bacteria 4511
212 Ga0451791_0728623 3300041451 Bacteria 1477
213 Ga0451791_1353583 3300041451 Bacteria 757
214 Ga0439431_0071476 3300041997 Bacteria 925
215 Ga0439433_0004107 3300041999 Bacteria 3131
216 Ga0439433_0011827 3300041999 Bacteria 1913
217 Ga0439437_016882 3300042000 Bacteria 864
218 Ga0439442_046919 3300042002 Bacteria 910
219 Ga0439432_003780 3300042006 Bacteria 5586
220 Ga0439449_0000317 3300042007 Bacteria 17464
221 Ga0439449_0001644 3300042007 Bacteria 8765
222 Ga0439449_0117112 3300042007 Bacteria 988
223 Ga0439452_005260 3300042010 Bacteria 4197
224 Ga0439455_0124194 3300042012 Bacteria 725
225 Ga0439462_0000877 3300042015 Bacteria 6320
226 Ga0439462_0001045 3300042015 Bacteria 5953
227 Ga0450923_022356 3300042125 Bacteria 1239
228 Ga0450897_050498 3300042128 Bacteria 501
229 Ga0450894_007377 3300042131 Bacteria 1418
230 Ga0450898_005298 3300042134 Bacteria 1943
231 Ga0450899_005035 3300042135 Bacteria 1418
232 Ga0450906_007055 3300042145 Bacteria 2234
233 Ga0450910_007690 3300042147 Bacteria 1506
234 Ga0439446_0045064 3300042156 Bacteria 1306
235 Ga0450908_003538 3300042184 Bacteria 3043
236 Ga0450909_006443 3300042185 Bacteria 1692
237 Ga0450909_028465 3300042185 Bacteria 844
238 Ga0439434_0058469 3300042435 Bacteria 1203
239 Ga0439459_0195980 3300042438 Bacteria 549
240 Ga0439464_0171096 3300042439 Bacteria 685
241 Ga0450918_098688 3300042531 Bacteria 570
242 Ga0450893_0015611 3300042532 Bacteria 1281
243 Ga0451577_0082084 3300042876 Bacteria 2875
244 Ga0451577_0348413 3300042876 Bacteria 1343
245 Ga0466969_0008374 3300044656 Bacteria 5483
246 Ga0466969_0189532 3300044656 Bacteria 940
247 Ga0466969_0191751 3300044656 Bacteria 933
248 Ga0466972_0091950 3300044658 Bacteria 1438
249 Ga0466965_0014706 3300044683 Bacteria 3705
250 Ga0466965_0597793 3300044683 Bacteria 627
251 Ga0466966_0836530 3300044684 Bacteria 555
252 Ga0466966_0886851 3300044684 Bacteria 538
253 Ga0466961_0046867 3300044693 Bacteria 2764
254 Ga0466964_0056207 3300044706 Bacteria 1627
255 Ga0453684_0075122 3300044712 Bacteria 4250
256 Ga0466971_0231911 3300044719 Bacteria 877
257 Ga0466971_0238569 3300044719 Bacteria 864
258 Ga0466971_0543405 3300044719 Bacteria 576
259 Ga0466970_0063547 3300044765 Bacteria 1979
260 Ga0466957_0100011 3300044842 Bacteria 1827
261 Ga0466957_0675174 3300044842 Bacteria 728
262 Ga0466960_0177261 3300044901 Bacteria 1153
263 Ga0466960_0432710 3300044901 Bacteria 762
264 Ga0466959_0002391 3300045049 Bacteria 11968
265 Ga0466959_0025103 3300045049 Bacteria 4414
266 Ga0466959_0291166 3300045049 Bacteria 1119
267 Ga0495629_0105557 3300046459 Bacteria 1965
268 Ga0495639_0095408 3300046475 Bacteria 1399
269 Ga0495663_0126494 3300046525 Bacteria 859
270 Ga0495663_0244218 3300046525 Bacteria 636
271 Ga0495642_0043622 3300046528 Bacteria 1829
272 Ga0495642_0098159 3300046528 Bacteria 1244
273 Ga0495621_0371344 3300046539 Bacteria 603
274 Ga0495633_0058965 3300046558 Bacteria 1801
275 Ga0495633_0201810 3300046558 Bacteria 913
276 Ga0495656_0009809 3300046615 Bacteria 3457
277 Ga0495656_0035117 3300046615 Bacteria 2058
278 Ga0495656_0810906 3300046615 Bacteria 506
279 Ga0495588_0199423 3300046674 Bacteria 1057
280 Ga0495669_0079213 3300046684 Bacteria 1506
281 Ga0495670_0082991 3300046691 Bacteria 1634
282 Ga0495636_0020094 3300047318 Bacteria 2690
283 Ga0495677_0089296 3300047445 Bacteria 1160
284 Ga0495681_0077033 3300047470 Bacteria 1498
285 Ga0495615_0010383 3300048090 Bacteria 1859
286 Ga0495615_0081848 3300048090 Bacteria 886
287 Ga0496100_0015598 3300048903 Bacteria 4438
288 Ga0496101_0077449 3300048904 Bacteria 2450
289 Ga0496102_0039273 3300048905 Bacteria 4276
290 Ga0496103_0030060 3300048906 Bacteria 3304
291 Ga0496105_0004083 3300048908 Bacteria 10932
292 Ga0496106_0833533 3300048909 Bacteria 730
293 Ga0496107_0344542 3300048910 Bacteria 1109
294 Ga0496109_0503568 3300048912 Bacteria 1143
295 Ga0496109_1912975 3300048912 Bacteria 526
296 Ga0496110_0096682 3300048913 Bacteria 2647
297 Ga0496110_0252954 3300048913 Bacteria 1603
298 Ga0496111_0235412 3300048914 Bacteria 1360
299 Ga0496111_0735064 3300048914 Bacteria 716
300 Ga0496112_1021026 3300048915 Bacteria 747
301 Ga0496113_0058668 3300048916 Bacteria 2897
302 Ga0496114_0045448 3300048917 Bacteria 3648
303 Ga0496114_1309710 3300048917 Bacteria 611
304 Ga0496118_0294453 3300048921 Bacteria 895
305 Ga0496124_0051000 3300048927 Bacteria 3522
306 Ga0501032_0413578 3300049569 Bacteria 866
307 Ga0501034_0541264 3300049571 Bacteria 1074
308 Ga0501036_0232901 3300049572 Bacteria 1545
309 Ga0501038_0073916 3300049574 Bacteria 2885
310 Ga0501043_0433124 3300049579 Bacteria 990
311 Ga0501046_0578767 3300049580 Bacteria 798
312 Ga0501047_0048996 3300049581 Bacteria 4079
313 Ga0501238_022289 3300049671 Bacteria 900
314 Ga0501258_070833 3300049687 Bacteria 518
315 Ga0501221_100086 3300049704 Bacteria 719
316 Ga0501245_066936 3300049708 Bacteria 669
317 Ga0501080_0165738 3300049742 Bacteria 2039
318 Ga0501083_0958563 3300049744 Bacteria 557
319 Ga0501268_180687 3300049765 Bacteria 502
320 Ga0501270_143012 3300049767 Bacteria 539
321 Ga0501035_1098219 3300049822 Bacteria 621
322 Ga0501044_0009247 3300049823 Bacteria 10761
323 nmdc:mga03683_277924_c1 3300050489 Bacteria 782
324 nmdc:mga03683_355236_c1 3300050489 Bacteria 694
325 nmdc:mga03n38_161622_c1 3300050490 Bacteria 1134
326 nmdc:mga03n38_203363_c1 3300050490 Bacteria 1026
327 nmdc:mga00v17_392189_c1 3300050491 Bacteria 902
328 nmdc:mga0yw44_126063_c1 3300050492 Bacteria 1654
329 nmdc:mga0k408_42911_c1 3300050493 Bacteria 2605
330 nmdc:mga0k408_69745_c1 3300050493 Bacteria 2052
331 nmdc:mga06z11_841171_c1 3300050494 Bacteria 559
332 nmdc:mga04h51_375147_c1 3300050495 Bacteria 592
333 nmdc:mga04h51_491038_c1 3300050495 Bacteria 523
334 nmdc:mga07m45_222382_c1 3300050496 Bacteria 1098
335 nmdc:mga07m45_2593_c1 3300050496 Bacteria 8517
336 Ga0495612_0333079 3300053078 Bacteria 684
337 Ga0590075_007683 3300059424 Bacteria 2567
338 Ga0590077_054983 3300059426 Bacteria 897
339 Ga0466962_0729616 3300061719 Bacteria 509
340 2842750198 2842747753 Bacteria 5578255
341 2885194438 2885192300 Bacteria 5882526
342 2894027775 2894023352 Bacteria 5167372
343 2904542836 2904541872 Bacteria 8915136
344 2928116713 2928115317 Bacteria 6477646
345 2929166256 2929160207 Bacteria 9075316
346 2939634663 2939631187 Bacteria 6118131
347 Ga0307408_101467011
348 JGI25150J39212_1015850
349 JGI25159J45721_1003798
350 Ga0055526_1014440
351 Ga0055537_1000328
352 Ga0055524_1000101
353 Ga0055536_1021446
354 Ga0055534_1008375
355 Ga0055528_1001455
356 Ga0055530_10000251
357 Ga0055530_10093848
358 Ga0055540_1000099
359 Ga0055531_10015479
360 Ga0065165_1029004
361 Ga0065165_1142907
362 Ga0070658_10058674
363 Ga0070658_10080760
364 Ga0070676_11139548
365 Ga0070683_102275154
366 Ga0070670_100067909
367 Ga0070670_100230273
368 Ga0070677_10149052
369 Ga0068869_100148735
370 Ga0068869_100395352
371 Ga0068868_100027085
372 Ga0068868_100086250
373 Ga0068868_100217253
374 Ga0070660_100097503
375 Ga0070660_101264554
376 Ga0070660_101293460
377 Ga0070669_100012863
378 Ga0070671_101860065
379 Ga0070673_100088644
380 Ga0070659_100115689
381 Ga0070667_100206270
382 Ga0070685_10490347
383 Ga0070679_100051090
384 Ga0070679_101368362
385 Ga0068853_100570705
386 Ga0070672_100598487
387 Ga0070665_101602766
388 Ga0068855_100008747
389 Ga0068855_100736025
390 Ga0068857_100045886
391 Ga0068857_100277951
392 Ga0068852_100641160
393 Ga0068859_100641616
394 Ga0068864_100014557
395 Ga0068863_100039361
396 Ga0068863_100712556
397 Ga0075365_10057242
398 Ga0075365_10382108
399 Ga0075368_10244465
400 Ga0075363_100056825
401 Ga0075363_100101850
402 Ga0075363_100698223
403 Ga0075364_10408197
404 Ga0075362_10688283
405 Ga0075362_10740415
406 Ga0075367_10764153
407 Ga0075366_10045361
408 Ga0075366_10056479
409 Ga0075366_10081823
410 Ga0075366_10146990
411 Ga0075366_10636299
412 Ga0075370_10010011
413 Ga0075370_10343507
414 Ga0097620_100641715
415 Ga0105240_10012435
416 Ga0105243_12401309
417 Ga0105241_11802697
418 Ga0105248_10834135
419 Ga0105238_10650444
420 Ga0105249_13076186
421 Ga0105239_11214456
422 Ga0157374_11711709
423 Ga0157378_11180656
424 Ga0163162_10249748
425 Ga0163162_12899122
426 Ga0157375_10852306
427 Ga0163163_11101279
428 Ga0157376_10113947
429 Ga0157376_10265624
430 Ga0182006_1155042
431 Ga0183362_10004
432 Ga0213876_10462779
433 Ga0207425_1012153
434 Ga0209565_1000041
435 Ga0209673_1000012
436 Ga0209673_1070107
437 Ga0209130_1000694
438 Ga0209130_1001639
439 Ga0209675_1000483
440 Ga0209675_1003365
441 Ga0209676_1000013
442 Ga0209676_1037388
443 Ga0209025_1072586
444 Ga0209564_1000363
445 Ga0209564_1071927
446 Ga0209050_1000008
447 Ga0209050_1065517
448 Ga0209256_1000003
449 Ga0207426_1014564
450 Ga0209051_1000005
451 Ga0209051_1004497
452 Ga0209257_1000048
453 Ga0209257_1006617
454 Ga0207705_10047488
455 Ga0207705_10302673
456 Ga0207695_10023681
457 Ga0207660_11527867
458 Ga0207662_10911853
459 Ga0207652_10036041
460 Ga0207652_11405110
461 Ga0207681_10009797
462 Ga0207694_11317322
463 Ga0207650_10047479
464 Ga0207687_10876408
465 Ga0207690_10600293
466 Ga0207711_10893932
467 Ga0207689_10013615
468 Ga0207689_10138967
469 Ga0207667_10062358
470 Ga0207667_10542602
471 Ga0207651_10125449
472 Ga0207640_12083397
473 Ga0207658_10048581
474 Ga0207677_10006997
475 Ga0207677_10014144
476 Ga0207677_10178064
477 Ga0207639_10619780
478 Ga0207702_10445664
479 Ga0207641_10603159
480 Ga0207676_10006627
481 Ga0207683_10019483
482 Ga0207698_10342857
483 Ga0207698_12142342
484 Ga0209813_10340450
485 Ga0268266_11233831
486 Ga0265332_10013175
487 Ga0265328_10429661
488 Ga0265329_10013449
489 Ga0265327_10519145
490 Ga0307408_100081634
491 Ga0307408_100183570
492 Ga0307408_100488420
493 Ga0307408_100553051
494 Ga0307408_100959491
495 Ga0307408_100963288
496 Ga0307408_100980025
497 Ga0307408_101142976
498 Ga0265314_10014690
499 Ga0265342_10126580
500 Ga0307516_10096032
501 Ga0307405_10043917
502 Ga0307405_10872098
503 Ga0307405_11500190
504 Ga0307413_11427450
505 Ga0307410_10384060
506 Ga0307406_11200845
507 Ga0307412_10075264
508 Ga0307412_10187232
509 Ga0307412_10191626
510 Ga0307412_10261464
511 Ga0307412_11068464
512 Ga0307412_11978662
513 Ga0307412_12182485
514 Ga0307409_100297966
515 Ga0307409_101512592
516 Ga0307416_100218781
517 Ga0307416_101239679
518 Ga0307416_101643886
519 Ga0307416_101819309
520 Ga0307416_102106050
521 Ga0307414_10167894
522 Ga0307411_10183306
523 Ga0307415_101877313
524 Ga0373931_0167391
525 Ga0373931_0414939
526 Ga0395899_0003555
527 Ga0395899_0684636
528 Ga0395900_0005229
529 Ga0395900_0363019
530 Ga0395900_0654253
531 Ga0395900_0853014
532 Ga0395898_0008110
533 Ga0395898_0022034
534 Ga0395898_1022336
535 Ga0395898_1280171
536 Ga0395905_0000047
537 Ga0395905_0001133
538 Ga0395905_0008913
539 Ga0395905_0015524
540 Ga0395905_0050884
541 Ga0395905_0068943
542 Ga0395905_0079675
543 Ga0395905_0969974
544 Ga0395901_0009451
545 Ga0395901_0010842
546 Ga0395901_0011724
547 Ga0395901_0042343
548 Ga0395901_0077358
549 Ga0395901_0080683
550 Ga0395901_0469440
551 Ga0395901_1230441
552 Ga0436365_1907260
553 Ga0439436_0001667
554 Ga0439436_0071144
555 Ga0439439_0000779
556 Ga0439447_037865
557 Ga0439466_0006317
558 Ga0451791_0728623
559 Ga0451791_1353583
560 Ga0439431_0071476
561 Ga0439433_0004107
562 Ga0439433_0011827
563 Ga0439437_016882
564 Ga0439442_046919
565 Ga0439432_003780
566 Ga0439449_0000317
567 Ga0439449_0001644
568 Ga0439449_0117112
569 Ga0439452_005260
570 Ga0439455_0124194
571 Ga0439462_0000877
572 Ga0439462_0001045
573 Ga0450923_022356
574 Ga0450897_050498
575 Ga0450894_007377
576 Ga0450898_005298
577 Ga0450899_005035
578 Ga0450906_007055
579 Ga0450910_007690
580 Ga0439446_0045064
581 Ga0450908_003538
582 Ga0450909_006443
583 Ga0450909_028465
584 Ga0439434_0058469
585 Ga0439459_0195980
586 Ga0439464_0171096
587 Ga0450918_098688
588 Ga0450893_0015611
589 Ga0451577_0082084
590 Ga0451577_0348413
591 Ga0466969_0008374
592 Ga0466969_0189532
593 Ga0466969_0191751
594 Ga0466972_0091950
595 Ga0466965_0014706
596 Ga0466965_0597793
597 Ga0466966_0836530
598 Ga0466966_0886851
599 Ga0466961_0046867
600 Ga0466964_0056207
601 Ga0453684_0075122
602 Ga0466971_0231911
603 Ga0466971_0238569
604 Ga0466971_0543405
605 Ga0466970_0063547
606 Ga0466957_0100011
607 Ga0466957_0675174
608 Ga0466960_0177261
609 Ga0466960_0432710
610 Ga0466959_0002391
611 Ga0466959_0025103
612 Ga0466959_0291166
613 Ga0495629_0105557
614 Ga0495639_0095408
615 Ga0495663_0126494
616 Ga0495663_0244218
617 Ga0495642_0043622
618 Ga0495642_0098159
619 Ga0495621_0371344
620 Ga0495633_0058965
621 Ga0495633_0201810
622 Ga0495656_0009809
623 Ga0495656_0035117
624 Ga0495656_0810906
625 Ga0495588_0199423
626 Ga0495669_0079213
627 Ga0495670_0082991
628 Ga0495636_0020094
629 Ga0495677_0089296
630 Ga0495681_0077033
631 Ga0495615_0010383
632 Ga0495615_0081848
633 Ga0496100_0015598
634 Ga0496101_0077449
635 Ga0496102_0039273
636 Ga0496103_0030060
637 Ga0496105_0004083
638 Ga0496106_0833533
639 Ga0496107_0344542
640 Ga0496109_0503568
641 Ga0496109_1912975
642 Ga0496110_0096682
643 Ga0496110_0252954
644 Ga0496111_0235412
645 Ga0496111_0735064
646 Ga0496112_1021026
647 Ga0496113_0058668
648 Ga0496114_0045448
649 Ga0496114_1309710
650 Ga0496118_0294453
651 Ga0496124_0051000
652 Ga0501032_0413578
653 Ga0501034_0541264
654 Ga0501036_0232901
655 Ga0501038_0073916
656 Ga0501043_0433124
657 Ga0501046_0578767
658 Ga0501047_0048996
659 Ga0501238_022289
660 Ga0501258_070833
661 Ga0501221_100086
662 Ga0501245_066936
663 Ga0501080_0165738
664 Ga0501083_0958563
665 Ga0501268_180687
666 Ga0501270_143012
667 Ga0501035_1098219
668 Ga0501044_0009247
669 nmdc:mga03683_277924_c1
670 nmdc:mga03683_355236_c1
671 nmdc:mga03n38_161622_c1
672 nmdc:mga03n38_203363_c1
673 nmdc:mga00v17_392189_c1
674 nmdc:mga0yw44_126063_c1
675 nmdc:mga0k408_42911_c1
676 nmdc:mga0k408_69745_c1
677 nmdc:mga06z11_841171_c1
678 nmdc:mga04h51_375147_c1
679 nmdc:mga04h51_491038_c1
680 nmdc:mga07m45_222382_c1
681 nmdc:mga07m45_2593_c1
682 Ga0495612_0333079
683 Ga0590075_007683
684 Ga0590077_054983
685 Ga0466962_0729616
686 2842750198
687 2885194438
688 2894027775
689 2904542836
690 2928116713
691 2929166256
692 2939634663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09413

DUF2007

Putative prokaryotic signal transducing protein

1

69

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yj7-assembly1.cif.gz_C crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.8089 1 76
2y9j-assembly1.cif.gz_Y three-dimensional model of salmonella's needle complex at subnanometer resolution 0.7884 3 76
8axn-assembly1.cif.gz_a inner membrane ring and secretin n0 n1 domains of the type 3 secretion system of shigella flexneri 0.7734 2 74
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.7339 3 75
3j6d-assembly1.cif.gz_a model of the prgh-prgk periplasmic rings 0.718 1 66
ID Description Score Start End Superfamily
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8604 1 70 3.30.70.2350
1yj7B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.7942 1 76 3.30.70.1530
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7436 1 70 3.30.70.2350
1yj7B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.7035 1 76 3.30.70.1530
2hfvA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.6923 3 67 3.30.70.790
ID Description Score Start End GO Terms
AF-A0A3N2KQT7-F1-model_v4 DUF2007 domain-containing protein 0.8953 1 70
AF-A0A535B752-F1-model_v4 DUF2007 domain-containing protein 0.8939 2 69
AF-A0A352F1E4-F1-model_v4 DUF2007 domain-containing protein 0.8938 2 64
AF-A0A350MMW8-F1-model_v4 DUF2007 domain-containing protein 0.8929 2 69
AF-A0A7C3FZP3-F1-model_v4 DUF2007 domain-containing protein 0.8888 2 70

Map