F416744

General Info

Members Datasets Scaffolds Average Seq Length
346 236 346 111

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10980500|Ga0114129_109805002
Length 134
Sequence MISSLGGANAEQSCATSVAGKESRMAAKYEVKKASDGQYFFNLKAGNGEIILTSERYKAKASATNGIESVRKNAPIDARYDRRVSSNNKPYFVLRAGNNEVIGQSELYSSAAAMENGITAVKAAAPTTTVEDLA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
207 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
208 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
209 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
213 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
214 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
215 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
216 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
217 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
220 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
221 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
222 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
223 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
224 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
225 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
226 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0
Rhizoplane 5.49
Rhizosphere 88.44
Stem 0
Stem Tuber 0
Unclassified 3.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10023705 3300001979 Bacteria 2092
2 JGI24739J22299_10008336 3300001989 Bacteria 3869
3 JGI24739J22299_10014272 3300001989 Bacteria 2891
4 JGI24735J21928_10018298 3300002067 Bacteria 2160
5 JGI25151J46595_10001123 3300003187 Bacteria 19523
6 Ga0055527_1000575 3300003760 Bacteria 11999
7 Ga0065712_10770429 3300005290 Unclassified 522
8 Ga0070658_10007409 3300005327 Bacteria 8862
9 Ga0070658_10095808 3300005327 Bacteria 2450
10 Ga0070658_10221957 3300005327 Bacteria 1599
11 Ga0070676_10717646 3300005328 Bacteria 731
12 Ga0070690_101370246 3300005330 Bacteria 568
13 Ga0070670_100002335 3300005331 Bacteria 15629
14 Ga0070670_100779597 3300005331 Bacteria 863
15 Ga0070677_10010344 3300005333 Bacteria 3189
16 Ga0070677_10033103 3300005333 Bacteria 1988
17 Ga0070677_10936749 3300005333 Unclassified 502
18 Ga0068869_100701927 3300005334 Unclassified 863
19 Ga0070666_10238272 3300005335 Unclassified 1286
20 Ga0070680_100215926 3300005336 Bacteria 1618
21 Ga0068868_100430715 3300005338 Unclassified 1144
22 Ga0068868_100818508 3300005338 Bacteria 841
23 Ga0070660_100769250 3300005339 Unclassified 809
24 Ga0070689_101449911 3300005340 Bacteria 621
25 Ga0070661_100184008 3300005344 Bacteria 1591
26 Ga0070692_10338594 3300005345 Unclassified 931
27 Ga0070668_100519200 3300005347 Bacteria 1033
28 Ga0070669_100852791 3300005353 Bacteria 776
29 Ga0070675_100021742 3300005354 Bacteria 5125
30 Ga0070675_100358970 3300005354 Unclassified 1293
31 Ga0070675_101083599 3300005354 Bacteria 736
32 Ga0070671_100037920 3300005355 Bacteria 3999
33 Ga0070671_100629094 3300005355 Unclassified 928
34 Ga0070673_100019032 3300005364 Bacteria 4924
35 Ga0070673_100048700 3300005364 Bacteria 3306
36 Ga0070688_100447125 3300005365 Unclassified 965
37 Ga0070667_100033853 3300005367 Bacteria 4274
38 Ga0070667_100034489 3300005367 Bacteria 4234
39 Ga0070667_101107548 3300005367 Bacteria 740
40 Ga0070667_101682330 3300005367 Bacteria 597
41 Ga0070709_10420551 3300005434 Bacteria 1001
42 Ga0070709_11548921 3300005434 Bacteria 539
43 Ga0070711_101156078 3300005439 Bacteria 668
44 Ga0070708_101259521 3300005445 Bacteria 691
45 Ga0070663_100011991 3300005455 Bacteria 5469
46 Ga0070678_100034462 3300005456 Bacteria 3526
47 Ga0070662_101056502 3300005457 Unclassified 696
48 Ga0070681_10076907 3300005458 Bacteria 3295
49 Ga0068867_100384907 3300005459 Unclassified 1179
50 Ga0068867_100508989 3300005459 Bacteria 1036
51 Ga0070685_10631870 3300005466 Unclassified 774
52 Ga0070699_100394684 3300005518 Bacteria 1250
53 Ga0070679_100086708 3300005530 Unclassified 3117
54 Ga0070679_101100203 3300005530 Bacteria 739
55 Ga0070684_100513042 3300005535 Bacteria 1111
56 Ga0070684_100649335 3300005535 Unclassified 982
57 Ga0068853_100207561 3300005539 Bacteria 1785
58 Ga0068853_100685974 3300005539 Unclassified 976
59 Ga0068853_101126248 3300005539 Unclassified 757
60 Ga0070672_100045692 3300005543 Bacteria 3389
61 Ga0070695_100123534 3300005545 Bacteria 1774
62 Ga0070693_100408721 3300005547 Unclassified 943
63 Ga0070665_100001053 3300005548 Bacteria 34528
64 Ga0068855_100051676 3300005563 Bacteria 4841
65 Ga0070664_100186817 3300005564 Bacteria 1845
66 Ga0068857_100004884 3300005577 Bacteria 11372
67 Ga0068857_100049619 3300005577 Bacteria 3723
68 Ga0068854_100363655 3300005578 Bacteria 1188
69 Ga0068856_100508278 3300005614 Bacteria 1226
70 Ga0068856_102420058 3300005614 Bacteria 532
71 Ga0068852_101297375 3300005616 Unclassified 750
72 Ga0068859_100092219 3300005617 Bacteria 3081
73 Ga0068859_100122815 3300005617 Bacteria 2664
74 Ga0068864_100007152 3300005618 Bacteria 9166
75 Ga0068864_100020106 3300005618 Bacteria 5584
76 Ga0068861_101884374 3300005719 Unclassified 594
77 Ga0068851_10016297 3300005834 Bacteria 3553
78 Ga0068851_10093152 3300005834 Bacteria 1589
79 Ga0068870_10271015 3300005840 Unclassified 1060
80 Ga0068863_102566178 3300005841 Unclassified 519
81 Ga0068858_100093352 3300005842 Bacteria 2802
82 Ga0068858_100147282 3300005842 Bacteria 2212
83 Ga0068858_100808776 3300005842 Bacteria 914
84 Ga0068858_102221439 3300005842 Unclassified 542
85 Ga0068860_101681981 3300005843 Unclassified 656
86 Ga0068862_100048507 3300005844 Bacteria 3625
87 Ga0068862_100269916 3300005844 Bacteria 1555
88 Ga0081539_10125605 3300005985 Unclassified 1268
89 Ga0070716_100335810 3300006173 Unclassified 1064
90 Ga0075366_10019680 3300006195 Bacteria 3911
91 Ga0097621_100013662 3300006237 Bacteria 6061
92 Ga0097621_100094524 3300006237 Bacteria 2506
93 Ga0097621_101355108 3300006237 Bacteria 673
94 Ga0068871_100003621 3300006358 Bacteria 10614
95 Ga0075431_100550955 3300006847 Bacteria 1141
96 Ga0075434_100163845 3300006871 Bacteria 2243
97 Ga0097620_100092216 3300006931 Bacteria 3081
98 Ga0097620_100122816 3300006931 Bacteria 2664
99 Ga0105240_10121150 3300009093 Bacteria 3150
100 Ga0105240_10620245 3300009093 Bacteria 1189
101 Ga0111539_12822737 3300009094 Unclassified 563
102 Ga0105247_10157472 3300009101 Bacteria 1501
103 Ga0105247_10559356 3300009101 Bacteria 842
104 Ga0105247_11018395 3300009101 Unclassified 648
105 Ga0114129_10980500 3300009147 Bacteria 1066
106 Ga0114129_12529869 3300009147 Unclassified 613
107 Ga0105241_10332283 3300009174 Unclassified 1314
108 Ga0105241_10882660 3300009174 Unclassified 829
109 Ga0105241_11245250 3300009174 Unclassified 706
110 Ga0105248_10026192 3300009177 Bacteria 6488
111 Ga0105248_10441176 3300009177 Unclassified 1466
112 Ga0105248_10475515 3300009177 Bacteria 1408
113 Ga0105237_10000292 3300009545 Bacteria 69307
114 Ga0105237_10049106 3300009545 Bacteria 4243
115 Ga0105237_10468173 3300009545 Bacteria 1266
116 Ga0105238_10006405 3300009551 Bacteria 11711
117 Ga0105238_11164944 3300009551 Unclassified 795
118 Ga0105238_11400223 3300009551 Bacteria 726
119 Ga0105249_10064430 3300009553 Bacteria 3369
120 Ga0105249_10392610 3300009553 Bacteria 1416
121 Ga0105239_10252637 3300010375 Bacteria 1980
122 Ga0105239_10526562 3300010375 Bacteria 1345
123 Ga0105239_10573789 3300010375 Bacteria 1286
124 Ga0157314_1000450 3300012500 Bacteria 4042
125 Ga0157373_10132486 3300013100 Bacteria 1753
126 Ga0157370_10037820 3300013104 Bacteria 4673
127 Ga0157370_10131448 3300013104 Bacteria 2335
128 Ga0157370_10890830 3300013104 Unclassified 808
129 Ga0157369_10154931 3300013105 Unclassified 2421
130 Ga0157369_10264698 3300013105 Unclassified 1793
131 Ga0157369_10642928 3300013105 Bacteria 1094
132 Ga0157374_10145132 3300013296 Bacteria 2305
133 Ga0163162_10000956 3300013306 Bacteria 26818
134 Ga0163162_10786678 3300013306 Bacteria 1069
135 Ga0163162_10878718 3300013306 Bacteria 1010
136 Ga0163162_11178721 3300013306 Bacteria 869
137 Ga0163162_11643999 3300013306 Bacteria 733
138 Ga0163162_11902594 3300013306 Unclassified 681
139 Ga0157372_10304704 3300013307 Bacteria 1853
140 Ga0157372_10633722 3300013307 Unclassified 1245
141 Ga0157372_11284585 3300013307 Bacteria 845
142 Ga0157375_10033883 3300013308 Bacteria 4858
143 Ga0157375_10110902 3300013308 Unclassified 2842
144 Ga0157375_10715605 3300013308 Bacteria 1154
145 Ga0163163_10102895 3300014325 Bacteria 2880
146 Ga0157380_11363389 3300014326 Unclassified 758
147 Ga0182008_10011072 3300014497 Bacteria 4811
148 Ga0157377_10188620 3300014745 Unclassified 1302
149 Ga0157379_10074224 3300014968 Bacteria 3045
150 Ga0157379_10077231 3300014968 Bacteria 2982
151 Ga0157379_12224019 3300014968 Unclassified 545
152 Ga0157376_10002018 3300014969 Bacteria 13608
153 Ga0157376_10021951 3300014969 Bacteria 4966
154 Ga0157376_10318712 3300014969 Bacteria 1477
155 Ga0182006_1021768 3300015261 Bacteria 2670
156 Ga0182007_10011542 3300015262 Bacteria 3435
157 Ga0163161_11715403 3300017792 Unclassified 557
158 Ga0206349_1001390 3300020075 Unclassified 506
159 Ga0206351_10470756 3300020077 Unclassified 1083
160 Ga0207425_1001667 3300025245 Bacteria 8899
161 Ga0209148_1021740 3300025254 Bacteria 1039
162 Ga0209025_1000023 3300025294 Bacteria 541307
163 Ga0209758_1004849 3300025297 Bacteria 10854
164 Ga0207697_10185059 3300025315 Unclassified 914
165 Ga0207656_10081837 3300025321 Unclassified 1452
166 Ga0207682_10170118 3300025893 Bacteria 991
167 Ga0207710_10071688 3300025900 Bacteria 1590
168 Ga0207710_10271708 3300025900 Bacteria 851
169 Ga0207680_10031961 3300025903 Bacteria 2986
170 Ga0207680_10148910 3300025903 Bacteria 1559
171 Ga0207647_10002464 3300025904 Bacteria 14022
172 Ga0207645_10185426 3300025907 Bacteria 1366
173 Ga0207645_10452181 3300025907 Bacteria 867
174 Ga0207705_10090275 3300025909 Bacteria 2243
175 Ga0207705_10102121 3300025909 Bacteria 2110
176 Ga0207705_10116806 3300025909 Bacteria 1976
177 Ga0207654_10247397 3300025911 Bacteria 1194
178 Ga0207654_11287312 3300025911 Unclassified 533
179 Ga0207707_10004836 3300025912 Bacteria 11813
180 Ga0207695_10457341 3300025913 Unclassified 1159
181 Ga0207671_10000011 3300025914 Bacteria 530349
182 Ga0207671_10078228 3300025914 Bacteria 2477
183 Ga0207671_11372053 3300025914 Unclassified 549
184 Ga0207663_11151604 3300025916 Bacteria 624
185 Ga0207662_10040465 3300025918 Bacteria 2740
186 Ga0207649_10509451 3300025920 Bacteria 916
187 Ga0207652_10179050 3300025921 Bacteria 1904
188 Ga0207681_10000107 3300025923 Bacteria 71564
189 Ga0207694_10003847 3300025924 Bacteria 11867
190 Ga0207694_10773430 3300025924 Unclassified 811
191 Ga0207650_10036365 3300025925 Bacteria 3582
192 Ga0207650_10478399 3300025925 Bacteria 1039
193 Ga0207650_11220490 3300025925 Unclassified 640
194 Ga0207659_10030242 3300025926 Bacteria 3698
195 Ga0207659_10048100 3300025926 Bacteria 3020
196 Ga0207644_10255299 3300025931 Unclassified 1400
197 Ga0207670_10369121 3300025936 Bacteria 1140
198 Ga0207665_10219046 3300025939 Unclassified 1394
199 Ga0207691_10019970 3300025940 Bacteria 6338
200 Ga0207711_10093755 3300025941 Bacteria 2645
201 Ga0207679_10562588 3300025945 Unclassified 1024
202 Ga0207679_11030564 3300025945 Bacteria 754
203 Ga0207667_10000446 3300025949 Bacteria 55443
204 Ga0207651_10019426 3300025960 Bacteria 4072
205 Ga0207651_10796674 3300025960 Unclassified 837
206 Ga0207651_11202696 3300025960 Unclassified 680
207 Ga0207712_10017955 3300025961 Bacteria 4604
208 Ga0207712_10184015 3300025961 Bacteria 1644
209 Ga0207712_10298647 3300025961 Bacteria 1321
210 Ga0207712_11560115 3300025961 Unclassified 592
211 Ga0207640_10872348 3300025981 Bacteria 784
212 Ga0207640_11159982 3300025981 Unclassified 685
213 Ga0207640_11471191 3300025981 Bacteria 611
214 Ga0207658_10054266 3300025986 Bacteria 2965
215 Ga0207658_10515080 3300025986 Bacteria 1067
216 Ga0207658_11752802 3300025986 Bacteria 567
217 Ga0207677_10755711 3300026023 Bacteria 867
218 Ga0207703_10248002 3300026035 Bacteria 1604
219 Ga0207703_10281179 3300026035 Bacteria 1511
220 Ga0207703_10319280 3300026035 Unclassified 1422
221 Ga0207703_10764847 3300026035 Bacteria 921
222 Ga0207639_10292720 3300026041 Bacteria 1436
223 Ga0207678_10034881 3300026067 Bacteria 4381
224 Ga0207708_10371982 3300026075 Unclassified 1177
225 Ga0207702_12525317 3300026078 Bacteria 500
226 Ga0207641_10076370 3300026088 Bacteria 2896
227 Ga0207648_10376559 3300026089 Bacteria 1283
228 Ga0207676_10090141 3300026095 Bacteria 2515
229 Ga0207674_10008336 3300026116 Bacteria 11991
230 Ga0207674_10031852 3300026116 Bacteria 5535
231 Ga0207675_101502806 3300026118 Unclassified 694
232 Ga0207698_11275919 3300026142 Unclassified 749
233 Ga0268266_10001056 3300028379 Bacteria 34542
234 Ga0268266_10392515 3300028379 Bacteria 1311
235 Ga0268265_10099523 3300028380 Bacteria 2344
236 Ga0268265_10208970 3300028380 Bacteria 1699
237 Ga0268264_10043607 3300028381 Unclassified 3718
238 Ga0268264_10046621 3300028381 Bacteria 3600
239 Ga0307408_100203728 3300031548 Bacteria 1603
240 Ga0307508_10327271 3300031616 Bacteria 1124
241 Ga0316576_10067395 3300031727 Bacteria 2635
242 Ga0316578_10672058 3300031728 Unclassified 604
243 Ga0307516_10961532 3300031730 Bacteria 524
244 Ga0316577_10022388 3300031733 Bacteria 3509
245 Ga0307413_10137084 3300031824 Bacteria 1684
246 Ga0307410_10026234 3300031852 Unclassified 3665
247 Ga0307406_10037568 3300031901 Unclassified 2992
248 Ga0307407_10000475 3300031903 Bacteria 12326
249 Ga0307416_100158394 3300032002 Unclassified 2088
250 Ga0307414_10007616 3300032004 Bacteria 6092
251 Ga0307414_10260566 3300032004 Bacteria 1447
252 Ga0307411_10055006 3300032005 Unclassified 2616
253 Ga0307415_100197663 3300032126 Bacteria 1592
254 Ga0307510_10000038 3300033180 Bacteria 106256
255 Ga0307510_10658164 3300033180 Bacteria 506
256 Ga0373932_0148147 3300035112 Bacteria 803
257 Ga0373936_0422453 3300035113 Bacteria 614
258 Ga0373943_0096235 3300035170 Bacteria 1541
259 Ga0373935_0003012 3300035692 Bacteria 9720
260 Ga0316584_0242022 3300036712 Bacteria 1320
261 Ga0451793_0529491 3300041452 Unclassified 750
262 Ga0451797_0255522 3300041453 Unclassified 621
263 Ga0439460_0246484 3300042461 Unclassified 617
264 Ga0451577_0002650 3300042876 Bacteria 20962
265 Ga0466969_0033176 3300044656 Bacteria 2623
266 Ga0466969_0162294 3300044656 Bacteria 1027
267 Ga0466977_0060617 3300044666 Bacteria 2484
268 Ga0453683_0057644 3300044673 Bacteria 2429
269 Ga0466961_0074755 3300044693 Bacteria 2148
270 Ga0466963_0069616 3300044694 Bacteria 2365
271 Ga0453684_0010997 3300044712 Bacteria 15295
272 Ga0453684_0015728 3300044712 Bacteria 11915
273 Ga0453684_0091746 3300044712 Bacteria 3748
274 Ga0453684_0231866 3300044712 Bacteria 2131
275 Ga0453684_1601058 3300044712 Bacteria 668
276 Ga0451576_0180457 3300045051 Bacteria 2204
277 Ga0451576_2249690 3300045051 Unclassified 559
278 Ga0466958_0521690 3300045836 Bacteria 771
279 Ga0495616_0253802 3300046513 Unclassified 754
280 Ga0495648_0000406 3300046524 Bacteria 47413
281 Ga0495686_0016914 3300047472 Bacteria 4928
282 Ga0496101_0341174 3300048904 Bacteria 1177
283 Ga0496103_0808754 3300048906 Bacteria 591
284 Ga0496104_0646580 3300048907 Bacteria 966
285 Ga0496104_0885649 3300048907 Unclassified 798
286 Ga0496105_0213465 3300048908 Bacteria 1572
287 Ga0496105_0330826 3300048908 Bacteria 1219
288 Ga0496105_0554373 3300048908 Unclassified 897
289 Ga0496106_1025921 3300048909 Unclassified 648
290 Ga0496108_0059097 3300048911 Bacteria 3224
291 Ga0496109_0245988 3300048912 Unclassified 1684
292 Ga0496109_0454138 3300048912 Unclassified 1210
293 Ga0496110_0933707 3300048913 Bacteria 774
294 Ga0496111_0676233 3300048914 Unclassified 752
295 Ga0496112_0713313 3300048915 Bacteria 930
296 Ga0496113_0130851 3300048916 Bacteria 1969
297 Ga0496113_0580915 3300048916 Unclassified 898
298 Ga0496114_0000018 3300048917 Bacteria 251239
299 Ga0496116_0099899 3300048919 Bacteria 1736
300 Ga0496118_0120444 3300048921 Bacteria 1712
301 Ga0496121_0011002 3300048924 Bacteria 10100
302 Ga0496121_0128736 3300048924 Bacteria 1899
303 Ga0496121_0285821 3300048924 Bacteria 1126
304 Ga0496122_0120201 3300048925 Bacteria 1696
305 Ga0495682_0047139 3300049460 Unclassified 1572
306 Ga0501032_0457739 3300049569 Bacteria 817
307 Ga0501033_0069976 3300049570 Bacteria 2578
308 Ga0501033_0790155 3300049570 Bacteria 642
309 Ga0501036_0317519 3300049572 Bacteria 1302
310 Ga0501037_0103474 3300049573 Bacteria 2054
311 Ga0501038_0049145 3300049574 Bacteria 3648
312 Ga0501039_0595442 3300049575 Bacteria 867
313 Ga0501043_0337214 3300049579 Bacteria 1147
314 Ga0501047_0593124 3300049581 Bacteria 930
315 Ga0501223_020283 3300049663 Bacteria 1303
316 Ga0501224_004965 3300049664 Bacteria 1896
317 Ga0501227_057845 3300049665 Bacteria 989
318 Ga0501230_141029 3300049667 Unclassified 543
319 Ga0501233_077263 3300049668 Unclassified 852
320 Ga0501235_016813 3300049669 Bacteria 1617
321 Ga0501239_014715 3300049672 Unclassified 908
322 Ga0501242_002307 3300049674 Unclassified 1998
323 Ga0501247_000510 3300049677 Unclassified 3110
324 Ga0501258_062076 3300049687 Unclassified 541
325 Ga0501260_040054 3300049689 Unclassified 566
326 Ga0501261_067140 3300049690 Unclassified 622
327 Ga0501225_0037472 3300049705 Unclassified 1336
328 Ga0501229_084245 3300049706 Unclassified 512
329 Ga0501245_009630 3300049708 Unclassified 1388
330 Ga0501263_000374 3300049760 Unclassified 3207
331 Ga0501268_000275 3300049765 Bacteria 5250
332 Ga0501270_002547 3300049767 Unclassified 1878
333 Ga0501271_067363 3300049768 Unclassified 512
334 Ga0501272_008570 3300049769 Bacteria 1123
335 Ga0501273_016416 3300049770 Bacteria 969
336 Ga0501035_0587971 3300049822 Bacteria 908
337 Ga0501044_0048103 3300049823 Bacteria 4407
338 nmdc:mga0k408_18029_c1 3300050493 Bacteria 3936
339 nmdc:mga05p37_700766_c1 3300050507 Bacteria 1125
340 nmdc:mga05p37_915000_c1 3300050507 Bacteria 944
341 nmdc:mga06r32_364143_c1 3300050510 Bacteria 1429
342 nmdc:mga0n895_49172_c1 3300050512 Bacteria 4130
343 nmdc:mga0rr50_970100_c1 3300050513 Bacteria 724
344 nmdc:mga0a205_298666_c1 3300050515 Bacteria 1484
345 Ga0500646_0040513 3300053090 Bacteria 1310
346 Ga0500645_001357 3300053730 Bacteria 12603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005719 Ga0068861_101884374 Ga0068861_1018843742 107
2 3300014497 Ga0182008_10011072 Ga0182008_100110729 107
3 3300026118 Ga0207675_101502806 Ga0207675_1015028062 107
4 3300025925 Ga0207650_11220490 Ga0207650_112204902 108
5 3300031548 Ga0307408_100203728 Ga0307408_1002037282 108
6 3300031824 Ga0307413_10137084 Ga0307413_101370842 108
7 3300031852 Ga0307410_10026234 Ga0307410_100262342 108
8 3300031901 Ga0307406_10037568 Ga0307406_100375682 108
9 3300031903 Ga0307407_10000475 Ga0307407_100004755 108
10 3300032002 Ga0307416_100158394 Ga0307416_1001583942 108
11 3300032004 Ga0307414_10007616 Ga0307414_100076165 108
12 3300032004 Ga0307414_10260566 Ga0307414_102605662 108
13 3300032005 Ga0307411_10055006 Ga0307411_100550062 108
14 3300032126 Ga0307415_100197663 Ga0307415_1001976632 108
15 3300049569 Ga0501032_0457739 Ga0501032_0457739_134_463 108
16 3300049570 Ga0501033_0069976 Ga0501033_0069976_2195_2524 108
17 3300049572 Ga0501036_0317519 Ga0501036_0317519_299_628 108
18 3300049573 Ga0501037_0103474 Ga0501037_0103474_164_493 108
19 3300049574 Ga0501038_0049145 Ga0501038_0049145_37_366 108
20 3300049575 Ga0501039_0595442 Ga0501039_0595442_119_448 108
21 3300049579 Ga0501043_0337214 Ga0501043_0337214_713_1042 108
22 3300049581 Ga0501047_0593124 Ga0501047_0593124_582_911 108
23 3300049663 Ga0501223_020283 Ga0501223_020283_799_1128 108
24 3300049664 Ga0501224_004965 Ga0501224_004965_142_471 108
25 3300049665 Ga0501227_057845 Ga0501227_057845_197_526 108
26 3300049667 Ga0501230_141029 Ga0501230_141029_173_502 108
27 3300049668 Ga0501233_077263 Ga0501233_077263_84_413 108
28 3300049669 Ga0501235_016813 Ga0501235_016813_108_437 108
29 3300049672 Ga0501239_014715 Ga0501239_014715_56_385 108
30 3300049674 Ga0501242_002307 Ga0501242_002307_998_1327 108
31 3300049677 Ga0501247_000510 Ga0501247_000510_1359_1688 108
32 3300049687 Ga0501258_062076 Ga0501258_062076_166_495 108
33 3300049689 Ga0501260_040054 Ga0501260_040054_109_438 108
34 3300049690 Ga0501261_067140 Ga0501261_067140_26_355 108
35 3300049705 Ga0501225_0037472 Ga0501225_0037472_894_1223 108
36 3300049706 Ga0501229_084245 Ga0501229_084245_128_457 108
37 3300049708 Ga0501245_009630 Ga0501245_009630_564_893 108
38 3300049760 Ga0501263_000374 Ga0501263_000374_89_418 108
39 3300049765 Ga0501268_000275 Ga0501268_000275_2427_2756 108
40 3300049767 Ga0501270_002547 Ga0501270_002547_879_1208 108
41 3300049768 Ga0501271_067363 Ga0501271_067363_27_356 108
42 3300049769 Ga0501272_008570 Ga0501272_008570_70_399 108
43 3300049770 Ga0501273_016416 Ga0501273_016416_568_897 108
44 3300049822 Ga0501035_0587971 Ga0501035_0587971_362_691 108
45 3300049823 Ga0501044_0048103 Ga0501044_0048103_81_410 108
46 3300001979 JGI24740J21852_10023705 JGI24740J21852_100237053 109
47 3300001989 JGI24739J22299_10008336 JGI24739J22299_100083363 109
48 3300001989 JGI24739J22299_10014272 JGI24739J22299_100142723 109
49 3300002067 JGI24735J21928_10018298 JGI24735J21928_100182983 109
50 3300003187 JGI25151J46595_10001123 JGI25151J46595_100011238 109
51 3300003760 Ga0055527_1000575 Ga0055527_10005755 109
52 3300005290 Ga0065712_10770429 Ga0065712_107704291 109
53 3300005327 Ga0070658_10007409 Ga0070658_100074096 109
54 3300005327 Ga0070658_10095808 Ga0070658_100958081 109
55 3300005327 Ga0070658_10221957 Ga0070658_102219573 109
56 3300005328 Ga0070676_10717646 Ga0070676_107176462 109
57 3300005330 Ga0070690_101370246 Ga0070690_1013702461 109
58 3300005331 Ga0070670_100002335 Ga0070670_10000233513 109
59 3300005331 Ga0070670_100779597 Ga0070670_1007795972 109
60 3300005333 Ga0070677_10010344 Ga0070677_100103444 109
61 3300005333 Ga0070677_10033103 Ga0070677_100331032 109
62 3300005333 Ga0070677_10936749 Ga0070677_109367491 109
63 3300005334 Ga0068869_100701927 Ga0068869_1007019271 109
64 3300005335 Ga0070666_10238272 Ga0070666_102382722 109
65 3300005336 Ga0070680_100215926 Ga0070680_1002159262 109
66 3300005338 Ga0068868_100430715 Ga0068868_1004307152 109
67 3300005338 Ga0068868_100818508 Ga0068868_1008185082 109
68 3300005339 Ga0070660_100769250 Ga0070660_1007692502 109
69 3300005340 Ga0070689_101449911 Ga0070689_1014499112 109
70 3300005344 Ga0070661_100184008 Ga0070661_1001840082 109
71 3300005345 Ga0070692_10338594 Ga0070692_103385941 109
72 3300005347 Ga0070668_100519200 Ga0070668_1005192002 109
73 3300005353 Ga0070669_100852791 Ga0070669_1008527912 109
74 3300005354 Ga0070675_100021742 Ga0070675_1000217425 109
75 3300005354 Ga0070675_100358970 Ga0070675_1003589702 109
76 3300005354 Ga0070675_101083599 Ga0070675_1010835992 109
77 3300005355 Ga0070671_100037920 Ga0070671_1000379204 109
78 3300005355 Ga0070671_100629094 Ga0070671_1006290941 109
79 3300005364 Ga0070673_100019032 Ga0070673_1000190324 109
80 3300005364 Ga0070673_100048700 Ga0070673_1000487005 109
81 3300005365 Ga0070688_100447125 Ga0070688_1004471251 109
82 3300005367 Ga0070667_100033853 Ga0070667_1000338532 109
83 3300005367 Ga0070667_100034489 Ga0070667_1000344893 109
84 3300005367 Ga0070667_101107548 Ga0070667_1011075482 109
85 3300005367 Ga0070667_101682330 Ga0070667_1016823301 109
86 3300005434 Ga0070709_10420551 Ga0070709_104205512 109
87 3300005434 Ga0070709_11548921 Ga0070709_115489211 109
88 3300005439 Ga0070711_101156078 Ga0070711_1011560781 109
89 3300005445 Ga0070708_101259521 Ga0070708_1012595212 109
90 3300005455 Ga0070663_100011991 Ga0070663_1000119913 109
91 3300005456 Ga0070678_100034462 Ga0070678_1000344621 109
92 3300005457 Ga0070662_101056502 Ga0070662_1010565021 109
93 3300005458 Ga0070681_10076907 Ga0070681_100769074 109
94 3300005459 Ga0068867_100384907 Ga0068867_1003849071 109
95 3300005459 Ga0068867_100508989 Ga0068867_1005089892 109
96 3300005466 Ga0070685_10631870 Ga0070685_106318701 109
97 3300005518 Ga0070699_100394684 Ga0070699_1003946842 109
98 3300005530 Ga0070679_100086708 Ga0070679_1000867084 109
99 3300005530 Ga0070679_101100203 Ga0070679_1011002032 109
100 3300005535 Ga0070684_100513042 Ga0070684_1005130421 109
101 3300005535 Ga0070684_100649335 Ga0070684_1006493351 109
102 3300005539 Ga0068853_100207561 Ga0068853_1002075612 109
103 3300005539 Ga0068853_100685974 Ga0068853_1006859741 109
104 3300005539 Ga0068853_101126248 Ga0068853_1011262481 109
105 3300005543 Ga0070672_100045692 Ga0070672_1000456926 109
106 3300005545 Ga0070695_100123534 Ga0070695_1001235342 109
107 3300005547 Ga0070693_100408721 Ga0070693_1004087212 109
108 3300005548 Ga0070665_100001053 Ga0070665_1000010532 109
109 3300005563 Ga0068855_100051676 Ga0068855_1000516764 109
110 3300005564 Ga0070664_100186817 Ga0070664_1001868172 109
111 3300005577 Ga0068857_100004884 Ga0068857_10000488413 109
112 3300005577 Ga0068857_100049619 Ga0068857_1000496195 109
113 3300005578 Ga0068854_100363655 Ga0068854_1003636552 109
114 3300005614 Ga0068856_100508278 Ga0068856_1005082783 109
115 3300005614 Ga0068856_102420058 Ga0068856_1024200582 109
116 3300005616 Ga0068852_101297375 Ga0068852_1012973751 109
117 3300005617 Ga0068859_100092219 Ga0068859_1000922192 109
118 3300005617 Ga0068859_100122815 Ga0068859_1001228152 109
119 3300005618 Ga0068864_100007152 Ga0068864_1000071524 109
120 3300005618 Ga0068864_100020106 Ga0068864_1000201063 109
121 3300005834 Ga0068851_10016297 Ga0068851_100162972 109
122 3300005834 Ga0068851_10093152 Ga0068851_100931522 109
123 3300005840 Ga0068870_10271015 Ga0068870_102710151 109
124 3300005841 Ga0068863_102566178 Ga0068863_1025661781 109
125 3300005842 Ga0068858_100093352 Ga0068858_1000933523 109
126 3300005842 Ga0068858_100147282 Ga0068858_1001472822 109
127 3300005842 Ga0068858_100808776 Ga0068858_1008087761 109
128 3300005842 Ga0068858_102221439 Ga0068858_1022214391 109
129 3300005843 Ga0068860_101681981 Ga0068860_1016819811 109
130 3300005844 Ga0068862_100048507 Ga0068862_1000485073 109
131 3300005844 Ga0068862_100269916 Ga0068862_1002699162 109
132 3300005985 Ga0081539_10125605 Ga0081539_101256052 109
133 3300006173 Ga0070716_100335810 Ga0070716_1003358101 109
134 3300006195 Ga0075366_10019680 Ga0075366_100196804 109
135 3300006237 Ga0097621_100013662 Ga0097621_1000136625 109
136 3300006237 Ga0097621_100094524 Ga0097621_1000945242 109
137 3300006237 Ga0097621_101355108 Ga0097621_1013551081 109
138 3300006358 Ga0068871_100003621 Ga0068871_10000362115 109
139 3300006847 Ga0075431_100550955 Ga0075431_1005509553 109
140 3300006871 Ga0075434_100163845 Ga0075434_1001638455 109
141 3300006931 Ga0097620_100092216 Ga0097620_1000922162 109
142 3300006931 Ga0097620_100122816 Ga0097620_1001228164 109
143 3300009093 Ga0105240_10121150 Ga0105240_101211506 109
144 3300009093 Ga0105240_10620245 Ga0105240_106202451 109
145 3300009094 Ga0111539_12822737 Ga0111539_128227371 109
146 3300009101 Ga0105247_10157472 Ga0105247_101574722 109
147 3300009101 Ga0105247_10559356 Ga0105247_105593562 109
148 3300009101 Ga0105247_11018395 Ga0105247_110183952 109
149 3300009147 Ga0114129_10980500 Ga0114129_109805002 109
150 3300009147 Ga0114129_12529869 Ga0114129_125298691 109
151 3300009174 Ga0105241_10332283 Ga0105241_103322832 109
152 3300009174 Ga0105241_10882660 Ga0105241_108826602 109
153 3300009174 Ga0105241_11245250 Ga0105241_112452502 109
154 3300009177 Ga0105248_10026192 Ga0105248_100261923 109
155 3300009177 Ga0105248_10441176 Ga0105248_104411762 109
156 3300009177 Ga0105248_10475515 Ga0105248_104755151 109
157 3300009545 Ga0105237_10000292 Ga0105237_1000029254 109
158 3300009545 Ga0105237_10049106 Ga0105237_100491065 109
159 3300009545 Ga0105237_10468173 Ga0105237_104681732 109
160 3300009551 Ga0105238_10006405 Ga0105238_100064052 109
161 3300009551 Ga0105238_11164944 Ga0105238_111649441 109
162 3300009551 Ga0105238_11400223 Ga0105238_114002231 109
163 3300009553 Ga0105249_10064430 Ga0105249_100644304 109
164 3300009553 Ga0105249_10392610 Ga0105249_103926102 109
165 3300010375 Ga0105239_10252637 Ga0105239_102526372 109
166 3300010375 Ga0105239_10526562 Ga0105239_105265622 109
167 3300010375 Ga0105239_10573789 Ga0105239_105737892 109
168 3300012500 Ga0157314_1000450 Ga0157314_10004504 109
169 3300013100 Ga0157373_10132486 Ga0157373_101324863 109
170 3300013104 Ga0157370_10037820 Ga0157370_100378202 109
171 3300013104 Ga0157370_10131448 Ga0157370_101314482 109
172 3300013104 Ga0157370_10890830 Ga0157370_108908301 109
173 3300013105 Ga0157369_10154931 Ga0157369_101549313 109
174 3300013105 Ga0157369_10264698 Ga0157369_102646982 109
175 3300013105 Ga0157369_10642928 Ga0157369_106429281 109
176 3300013296 Ga0157374_10145132 Ga0157374_101451323 109
177 3300013306 Ga0163162_10000956 Ga0163162_1000095611 109
178 3300013306 Ga0163162_10786678 Ga0163162_107866782 109
179 3300013306 Ga0163162_10878718 Ga0163162_108787181 109
180 3300013306 Ga0163162_11178721 Ga0163162_111787212 109
181 3300013306 Ga0163162_11643999 Ga0163162_116439991 109
182 3300013306 Ga0163162_11902594 Ga0163162_119025941 109
183 3300013307 Ga0157372_10304704 Ga0157372_103047042 109
184 3300013307 Ga0157372_10633722 Ga0157372_106337222 109
185 3300013307 Ga0157372_11284585 Ga0157372_112845852 109
186 3300013308 Ga0157375_10033883 Ga0157375_100338834 109
187 3300013308 Ga0157375_10110902 Ga0157375_101109023 109
188 3300013308 Ga0157375_10715605 Ga0157375_107156052 109
189 3300014325 Ga0163163_10102895 Ga0163163_101028952 109
190 3300014326 Ga0157380_11363389 Ga0157380_113633892 109
191 3300014745 Ga0157377_10188620 Ga0157377_101886202 109
192 3300014968 Ga0157379_10074224 Ga0157379_100742242 109
193 3300014968 Ga0157379_10077231 Ga0157379_100772311 109
194 3300014968 Ga0157379_12224019 Ga0157379_122240191 109
195 3300014969 Ga0157376_10002018 Ga0157376_100020189 109
196 3300014969 Ga0157376_10021951 Ga0157376_100219515 109
197 3300014969 Ga0157376_10318712 Ga0157376_103187123 109
198 3300015261 Ga0182006_1021768 Ga0182006_10217683 109
199 3300015262 Ga0182007_10011542 Ga0182007_100115422 109
200 3300017792 Ga0163161_11715403 Ga0163161_117154031 109
201 3300020075 Ga0206349_1001390 Ga0206349_10013901 109
202 3300020077 Ga0206351_10470756 Ga0206351_104707563 109
203 3300025245 Ga0207425_1001667 Ga0207425_10016675 109
204 3300025254 Ga0209148_1021740 Ga0209148_10217402 109
205 3300025294 Ga0209025_1000023 Ga0209025_1000023258 109
206 3300025297 Ga0209758_1004849 Ga0209758_10048493 109
207 3300025315 Ga0207697_10185059 Ga0207697_101850592 109
208 3300025321 Ga0207656_10081837 Ga0207656_100818372 109
209 3300025893 Ga0207682_10170118 Ga0207682_101701182 109
210 3300025900 Ga0207710_10071688 Ga0207710_100716882 109
211 3300025900 Ga0207710_10271708 Ga0207710_102717082 109
212 3300025903 Ga0207680_10031961 Ga0207680_100319612 109
213 3300025903 Ga0207680_10148910 Ga0207680_101489103 109
214 3300025904 Ga0207647_10002464 Ga0207647_1000246410 109
215 3300025907 Ga0207645_10185426 Ga0207645_101854262 109
216 3300025907 Ga0207645_10452181 Ga0207645_104521812 109
217 3300025909 Ga0207705_10090275 Ga0207705_100902752 109
218 3300025909 Ga0207705_10102121 Ga0207705_101021213 109
219 3300025909 Ga0207705_10116806 Ga0207705_101168062 109
220 3300025911 Ga0207654_10247397 Ga0207654_102473972 109
221 3300025911 Ga0207654_11287312 Ga0207654_112873121 109
222 3300025912 Ga0207707_10004836 Ga0207707_100048362 109
223 3300025913 Ga0207695_10457341 Ga0207695_104573411 109
224 3300025914 Ga0207671_10000011 Ga0207671_10000011411 109
225 3300025914 Ga0207671_10078228 Ga0207671_100782283 109
226 3300025914 Ga0207671_11372053 Ga0207671_113720531 109
227 3300025916 Ga0207663_11151604 Ga0207663_111516041 109
228 3300025918 Ga0207662_10040465 Ga0207662_100404653 109
229 3300025920 Ga0207649_10509451 Ga0207649_105094512 109
230 3300025921 Ga0207652_10179050 Ga0207652_101790503 109
231 3300025923 Ga0207681_10000107 Ga0207681_1000010718 109
232 3300025924 Ga0207694_10003847 Ga0207694_100038472 109
233 3300025924 Ga0207694_10773430 Ga0207694_107734302 109
234 3300025925 Ga0207650_10036365 Ga0207650_100363651 109
235 3300025925 Ga0207650_10478399 Ga0207650_104783992 109
236 3300025926 Ga0207659_10030242 Ga0207659_100302425 109
237 3300025926 Ga0207659_10048100 Ga0207659_100481003 109
238 3300025931 Ga0207644_10255299 Ga0207644_102552992 109
239 3300025936 Ga0207670_10369121 Ga0207670_103691212 109
240 3300025939 Ga0207665_10219046 Ga0207665_102190462 109
241 3300025940 Ga0207691_10019970 Ga0207691_100199705 109
242 3300025941 Ga0207711_10093755 Ga0207711_100937551 109
243 3300025945 Ga0207679_10562588 Ga0207679_105625882 109
244 3300025945 Ga0207679_11030564 Ga0207679_110305642 109
245 3300025949 Ga0207667_10000446 Ga0207667_1000044645 109
246 3300025960 Ga0207651_10019426 Ga0207651_100194265 109
247 3300025960 Ga0207651_10796674 Ga0207651_107966742 109
248 3300025960 Ga0207651_11202696 Ga0207651_112026961 109
249 3300025961 Ga0207712_10017955 Ga0207712_100179553 109
250 3300025961 Ga0207712_10184015 Ga0207712_101840152 109
251 3300025961 Ga0207712_10298647 Ga0207712_102986472 109
252 3300025961 Ga0207712_11560115 Ga0207712_115601152 109
253 3300025981 Ga0207640_10872348 Ga0207640_108723482 109
254 3300025981 Ga0207640_11159982 Ga0207640_111599822 109
255 3300025981 Ga0207640_11471191 Ga0207640_114711911 109
256 3300025986 Ga0207658_10054266 Ga0207658_100542663 109
257 3300025986 Ga0207658_10515080 Ga0207658_105150801 109
258 3300025986 Ga0207658_11752802 Ga0207658_117528021 109
259 3300026023 Ga0207677_10755711 Ga0207677_107557111 109
260 3300026035 Ga0207703_10248002 Ga0207703_102480022 109
261 3300026035 Ga0207703_10281179 Ga0207703_102811792 109
262 3300026035 Ga0207703_10319280 Ga0207703_103192801 109
263 3300026035 Ga0207703_10764847 Ga0207703_107648471 109
264 3300026041 Ga0207639_10292720 Ga0207639_102927203 109
265 3300026067 Ga0207678_10034881 Ga0207678_100348814 109
266 3300026075 Ga0207708_10371982 Ga0207708_103719822 109
267 3300026078 Ga0207702_12525317 Ga0207702_125253171 109
268 3300026088 Ga0207641_10076370 Ga0207641_100763705 109
269 3300026089 Ga0207648_10376559 Ga0207648_103765591 109
270 3300026095 Ga0207676_10090141 Ga0207676_100901413 109
271 3300026116 Ga0207674_10008336 Ga0207674_100083365 109
272 3300026116 Ga0207674_10031852 Ga0207674_100318523 109
273 3300026142 Ga0207698_11275919 Ga0207698_112759191 109
274 3300028379 Ga0268266_10001056 Ga0268266_100010562 109
275 3300028379 Ga0268266_10392515 Ga0268266_103925152 109
276 3300028380 Ga0268265_10099523 Ga0268265_100995232 109
277 3300028380 Ga0268265_10208970 Ga0268265_102089702 109
278 3300028381 Ga0268264_10043607 Ga0268264_100436073 109
279 3300028381 Ga0268264_10046621 Ga0268264_100466216 109
280 3300031616 Ga0307508_10327271 Ga0307508_103272712 109
281 3300031727 Ga0316576_10067395 Ga0316576_100673952 109
282 3300031728 Ga0316578_10672058 Ga0316578_106720582 109
283 3300031730 Ga0307516_10961532 Ga0307516_109615321 109
284 3300031733 Ga0316577_10022388 Ga0316577_100223882 109
285 3300033180 Ga0307510_10000038 Ga0307510_1000003863 109
286 3300033180 Ga0307510_10658164 Ga0307510_106581642 109
287 3300035112 Ga0373932_0148147 Ga0373932_0148147_398_730 109
288 3300035113 Ga0373936_0422453 Ga0373936_0422453_28_363 109
289 3300035170 Ga0373943_0096235 Ga0373943_0096235_1016_1354 109
290 3300035692 Ga0373935_0003012 Ga0373935_0003012_5887_6219 109
291 3300036712 Ga0316584_0242022 Ga0316584_0242022_795_1127 109
292 3300041452 Ga0451793_0529491 Ga0451793_0529491_236_574 109
293 3300041453 Ga0451797_0255522 Ga0451797_0255522_96_434 109
294 3300042461 Ga0439460_0246484 Ga0439460_0246484_110_457 109
295 3300042876 Ga0451577_0002650 Ga0451577_0002650_18023_18355 109
296 3300044656 Ga0466969_0033176 Ga0466969_0033176_1423_1758 109
297 3300044656 Ga0466969_0162294 Ga0466969_0162294_78_410 109
298 3300044666 Ga0466977_0060617 Ga0466977_0060617_1186_1521 109
299 3300044673 Ga0453683_0057644 Ga0453683_0057644_1705_2043 109
300 3300044693 Ga0466961_0074755 Ga0466961_0074755_1284_1616 109
301 3300044694 Ga0466963_0069616 Ga0466963_0069616_1064_1402 109
302 3300044712 Ga0453684_0010997 Ga0453684_0010997_1479_1811 109
303 3300044712 Ga0453684_0015728 Ga0453684_0015728_9658_9993 109
304 3300044712 Ga0453684_0091746 Ga0453684_0091746_309_659 109
305 3300044712 Ga0453684_0231866 Ga0453684_0231866_1146_1484 109
306 3300044712 Ga0453684_1601058 Ga0453684_1601058_98_436 109
307 3300045051 Ga0451576_0180457 Ga0451576_0180457_657_995 109
308 3300045051 Ga0451576_2249690 Ga0451576_2249690_29_379 109
309 3300045836 Ga0466958_0521690 Ga0466958_0521690_142_474 109
310 3300046513 Ga0495616_0253802 Ga0495616_0253802_249_578 109
311 3300046524 Ga0495648_0000406 Ga0495648_0000406_432_761 109
312 3300047472 Ga0495686_0016914 Ga0495686_0016914_1656_1994 109
313 3300048904 Ga0496101_0341174 Ga0496101_0341174_398_730 109
314 3300048906 Ga0496103_0808754 Ga0496103_0808754_226_558 109
315 3300048907 Ga0496104_0646580 Ga0496104_0646580_453_785 109
316 3300048907 Ga0496104_0885649 Ga0496104_0885649_398_727 109
317 3300048908 Ga0496105_0213465 Ga0496105_0213465_857_1189 109
318 3300048908 Ga0496105_0330826 Ga0496105_0330826_770_1129 109
319 3300048908 Ga0496105_0554373 Ga0496105_0554373_10_360 109
320 3300048909 Ga0496106_1025921 Ga0496106_1025921_23_352 109
321 3300048911 Ga0496108_0059097 Ga0496108_0059097_104_433 109
322 3300048912 Ga0496109_0245988 Ga0496109_0245988_1087_1416 109
323 3300048912 Ga0496109_0454138 Ga0496109_0454138_329_664 109
324 3300048913 Ga0496110_0933707 Ga0496110_0933707_308_637 109
325 3300048914 Ga0496111_0676233 Ga0496111_0676233_257_586 109
326 3300048915 Ga0496112_0713313 Ga0496112_0713313_496_828 109
327 3300048916 Ga0496113_0130851 Ga0496113_0130851_309_641 109
328 3300048916 Ga0496113_0580915 Ga0496113_0580915_537_872 109
329 3300048917 Ga0496114_0000018 Ga0496114_0000018_114306_114665 109
330 3300048919 Ga0496116_0099899 Ga0496116_0099899_906_1238 109
331 3300048921 Ga0496118_0120444 Ga0496118_0120444_942_1274 109
332 3300048924 Ga0496121_0011002 Ga0496121_0011002_8437_8766 109
333 3300048924 Ga0496121_0128736 Ga0496121_0128736_1025_1354 109
334 3300048924 Ga0496121_0285821 Ga0496121_0285821_421_753 109
335 3300048925 Ga0496122_0120201 Ga0496122_0120201_48_380 109
336 3300049460 Ga0495682_0047139 Ga0495682_0047139_1073_1402 109
337 3300049570 Ga0501033_0790155 Ga0501033_0790155_60_395 109
338 3300050493 nmdc:mga0k408_18029_c1 nmdc:mga0k408_18029_c1_1840_2169 109
339 3300050507 nmdc:mga05p37_700766_c1 nmdc:mga05p37_700766_c1_539_886 109
340 3300050507 nmdc:mga05p37_915000_c1 nmdc:mga05p37_915000_c1_321_725 109
341 3300050510 nmdc:mga06r32_364143_c1 nmdc:mga06r32_364143_c1_917_1264 109
342 3300050512 nmdc:mga0n895_49172_c1 nmdc:mga0n895_49172_c1_1674_2078 109
343 3300050513 nmdc:mga0rr50_970100_c1 nmdc:mga0rr50_970100_c1_39_371 109
344 3300050515 nmdc:mga0a205_298666_c1 nmdc:mga0a205_298666_c1_967_1371 109
345 3300053090 Ga0500646_0040513 Ga0500646_0040513_797_1126 109
346 3300053730 Ga0500645_001357 Ga0500645_001357_1451_1780 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07411

DUF1508

Domain of unknown function (DUF1508)

34

81

0.98

PF07411

DUF1508

Domain of unknown function (DUF1508)

85

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2k49-assembly1.cif.gz_A solution nmr structure of upf0339 protein so3888 from shewanella oneidensis. northeast structural genomics consortium target sor190 0.953 1 107
2k8e-assembly1.cif.gz_A solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102. 0.9471 1 109
2k8e-assembly1.cif.gz_A solution nmr structure of protein of unknown function yegp from e. coli. ontario center for structural proteomics target ec0640_1_123 northeast structural genomics consortium target et102. 0.9388 1 109
2k49-assembly1.cif.gz_A solution nmr structure of upf0339 protein so3888 from shewanella oneidensis. northeast structural genomics consortium target sor190 0.9279 1 107
6q2z-assembly1.cif.gz_B nmr solution structure of the hvo_2922 protein from haloferax volcanii 0.9069 2 51
ID Description Score Start End Superfamily
af_P76402_1_110_2.30.29.80 Mainly Beta;Roll;PH-domain like; 0.9969 1 109 2.30.29.80
af_P76402_1_110_2.30.29.80 Mainly Beta;Roll;PH-domain like; 0.9879 1 109 2.30.29.80
3bidE01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like 0.9533 55 94 3.30.160.160
2k7iB01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like 0.8567 55 99 3.30.160.160
3bidE01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like 0.8198 55 94 3.30.160.160
ID Description Score Start End GO Terms
AF-A0A2N9D293-F1-model_v4 deleted 1.003 46 101
AF-A0A5B8CVY3-F1-model_v4 DUF1508 domain-containing protein 1 1 109
AF-D8E5A4-F1-model_v4 deleted 0.9992 1 109
AF-A0A6B5PEU4-F1-model_v4 deleted 0.997 2 109
AF-B7RTB3-F1-model_v4 Conserved domain protein 0.9961 15 109

Feature Viewer

pLDDT pTM Quality
94.89 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map