F416729

General Info

Members Datasets Scaffolds Average Seq Length
346 185 692 134

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100254745|Ga0075436_1002547452
Length 152
Sequence MSRDGSRARPDGARRLRNMAKVTGVGGVFFKSTGDHAALAAWYRKHLGIALEDWGGAILRWPDDKAEDRGLTVWHVAGKDSKWFSPSKSSFMINYRVDNLGELLEQLRAADVAIVQGPESAENGKFAWIMDPDGNKVELWEPKIWDDKNKGA

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
163 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
164 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
165 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
166 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
172 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
173 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
174 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
175 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
176 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0.29
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100254745 3300006914 Bacteria 1251
2 Ga0065704_10009106 3300005289 Unclassified 3020
3 Ga0065715_10110541 3300005293 Unclassified 2616
4 Ga0065715_10410036 3300005293 Bacteria 871
5 Ga0065707_10014032 3300005295 Bacteria 2591
6 Ga0065707_10401293 3300005295 Bacteria 852
7 Ga0065707_10437671 3300005295 Unclassified 809
8 Ga0070676_10066450 3300005328 Bacteria 2154
9 Ga0070676_10133350 3300005328 Bacteria 1573
10 Ga0070683_100055220 3300005329 Bacteria 3685
11 Ga0070690_100045728 3300005330 Bacteria 2781
12 Ga0070690_100152534 3300005330 Bacteria 1578
13 Ga0070677_10082761 3300005333 Bacteria 1377
14 Ga0068869_101360348 3300005334 Bacteria 628
15 Ga0070666_10169458 3300005335 Bacteria 1529
16 Ga0070666_11067097 3300005335 Bacteria 600
17 Ga0070680_100005747 3300005336 Bacteria 9412
18 Ga0070682_100007394 3300005337 Bacteria 6196
19 Ga0068868_100329040 3300005338 Bacteria 1304
20 Ga0070689_100025212 3300005340 Bacteria 4466
21 Ga0070689_100036104 3300005340 Bacteria 3779
22 Ga0070689_100312954 3300005340 Bacteria 1309
23 Ga0070691_10171105 3300005341 Bacteria 1126
24 Ga0070691_10597727 3300005341 Bacteria 651
25 Ga0070687_100009035 3300005343 Bacteria 4250
26 Ga0070687_100049793 3300005343 Bacteria 2161
27 Ga0070692_10021141 3300005345 Bacteria 3163
28 Ga0070668_100068202 3300005347 Bacteria 2765
29 Ga0070668_100299287 3300005347 Bacteria 1349
30 Ga0070669_100009559 3300005353 Bacteria 6904
31 Ga0070669_100567323 3300005353 Bacteria 948
32 Ga0070675_100095188 3300005354 Bacteria 2500
33 Ga0070675_100130072 3300005354 Bacteria 2144
34 Ga0070674_100142984 3300005356 Bacteria 1798
35 Ga0070673_100016962 3300005364 Bacteria 5165
36 Ga0070673_101669658 3300005364 Bacteria 603
37 Ga0070673_102384069 3300005364 Unclassified 503
38 Ga0070667_100186732 3300005367 Bacteria 1835
39 Ga0070667_100277584 3300005367 Bacteria 1504
40 Ga0070667_100902480 3300005367 Bacteria 823
41 Ga0070705_100013240 3300005440 Bacteria 4213
42 Ga0070705_100100209 3300005440 Bacteria 1827
43 Ga0070705_100464479 3300005440 Bacteria 953
44 Ga0070705_100695836 3300005440 Bacteria 798
45 Ga0070705_100798321 3300005440 Unclassified 751
46 Ga0070700_100061018 3300005441 Bacteria 2378
47 Ga0070700_100145143 3300005441 Bacteria 1617
48 Ga0070700_100719522 3300005441 Bacteria 796
49 Ga0070694_100023836 3300005444 Bacteria 3942
50 Ga0070694_100027490 3300005444 Bacteria 3694
51 Ga0070694_100072293 3300005444 Bacteria 2379
52 Ga0070694_100102723 3300005444 Bacteria 2024
53 Ga0070694_100755180 3300005444 Bacteria 794
54 Ga0070694_100933542 3300005444 Bacteria 718
55 Ga0070663_100250861 3300005455 Bacteria 1400
56 Ga0070678_100010604 3300005456 Bacteria 5640
57 Ga0070681_10930117 3300005458 Bacteria 788
58 Ga0068867_100045938 3300005459 Bacteria 3206
59 Ga0070685_10037548 3300005466 Bacteria 2744
60 Ga0070685_10173959 3300005466 Bacteria 1381
61 Ga0070707_100101538 3300005468 Bacteria 2788
62 Ga0070707_100429264 3300005468 Bacteria 1282
63 Ga0070707_100469444 3300005468 Bacteria 1219
64 Ga0070698_100005866 3300005471 Bacteria 13419
65 Ga0070698_100019285 3300005471 Bacteria 7164
66 Ga0070698_100087015 3300005471 Unclassified 3111
67 Ga0070699_100132619 3300005518 Bacteria 2196
68 Ga0070699_100164361 3300005518 Bacteria 1966
69 Ga0070679_100033621 3300005530 Bacteria 5078
70 Ga0070679_100243982 3300005530 Bacteria 1753
71 Ga0070684_100400068 3300005535 Bacteria 1266
72 Ga0070697_100074851 3300005536 Bacteria 2782
73 Ga0070697_100092901 3300005536 Bacteria 2497
74 Ga0070697_100103430 3300005536 Bacteria 2367
75 Ga0070697_100859604 3300005536 Bacteria 804
76 Ga0068853_100157105 3300005539 Bacteria 2049
77 Ga0068853_101020125 3300005539 Unclassified 797
78 Ga0070672_100014121 3300005543 Bacteria 5653
79 Ga0070672_100053721 3300005543 Bacteria 3150
80 Ga0070686_100064656 3300005544 Bacteria 2374
81 Ga0070686_100108272 3300005544 Bacteria 1889
82 Ga0070695_100004108 3300005545 Bacteria 8513
83 Ga0070695_100029457 3300005545 Bacteria 3411
84 Ga0070695_100251069 3300005545 Bacteria 1288
85 Ga0070695_100257239 3300005545 Bacteria 1273
86 Ga0070695_100287723 3300005545 Bacteria 1210
87 Ga0070695_100663255 3300005545 Unclassified 825
88 Ga0070696_100014048 3300005546 Bacteria 5376
89 Ga0070696_100015950 3300005546 Bacteria 5053
90 Ga0070696_100068995 3300005546 Bacteria 2483
91 Ga0070696_100201044 3300005546 Bacteria 1488
92 Ga0070696_101073921 3300005546 Bacteria 675
93 Ga0070665_101762808 3300005548 Bacteria 626
94 Ga0070704_100001591 3300005549 Bacteria 12264
95 Ga0070704_100144537 3300005549 Bacteria 1862
96 Ga0070704_100149261 3300005549 Bacteria 1836
97 Ga0070704_100188926 3300005549 Bacteria 1654
98 Ga0070704_100219471 3300005549 Bacteria 1545
99 Ga0070704_100430219 3300005549 Bacteria 1132
100 Ga0070704_100548428 3300005549 Bacteria 1010
101 Ga0070704_100944416 3300005549 Bacteria 778
102 Ga0068854_100247903 3300005578 Unclassified 1421
103 Ga0070702_100007205 3300005615 Bacteria 5313
104 Ga0068859_100228114 3300005617 Bacteria 1950
105 Ga0068866_10116723 3300005718 Bacteria 1498
106 Ga0068866_10340165 3300005718 Bacteria 950
107 Ga0068866_11117845 3300005718 Bacteria 565
108 Ga0068861_100011074 3300005719 Bacteria 6267
109 Ga0068861_100975109 3300005719 Bacteria 807
110 Ga0068861_102330131 3300005719 Bacteria 538
111 Ga0068863_100463463 3300005841 Bacteria 1245
112 Ga0068863_100699165 3300005841 Bacteria 1008
113 Ga0068858_100105115 3300005842 Bacteria 2635
114 Ga0068858_100483202 3300005842 Bacteria 1196
115 Ga0068860_100027600 3300005843 Bacteria 5466
116 Ga0068860_100050048 3300005843 Bacteria 3979
117 Ga0068862_100497491 3300005844 Bacteria 1157
118 Ga0075432_10296420 3300006058 Bacteria 670
119 Ga0075366_10098099 3300006195 Bacteria 1758
120 Ga0097621_100005077 3300006237 Bacteria 9250
121 Ga0097621_101078583 3300006237 Bacteria 753
122 Ga0068871_100001915 3300006358 Bacteria 14079
123 Ga0068871_100625337 3300006358 Bacteria 981
124 Ga0075428_100025760 3300006844 Bacteria 6513
125 Ga0075428_100148050 3300006844 Bacteria 2552
126 Ga0075428_100492598 3300006844 Bacteria 1312
127 Ga0075428_101024050 3300006844 Bacteria 874
128 Ga0075428_101414481 3300006844 Unclassified 730
129 Ga0075428_101774543 3300006844 Bacteria 643
130 Ga0075430_100025571 3300006846 Bacteria 5024
131 Ga0075430_101280671 3300006846 Unclassified 603
132 Ga0075431_100041310 3300006847 Bacteria 4754
133 Ga0075431_100221453 3300006847 Bacteria 1930
134 Ga0075431_100231254 3300006847 Bacteria 1883
135 Ga0075431_100488344 3300006847 Unclassified 1224
136 Ga0075431_100956237 3300006847 Bacteria 825
137 Ga0075433_10001683 3300006852 Bacteria 16463
138 Ga0075433_10004167 3300006852 Bacteria 11223
139 Ga0075433_10105994 3300006852 Bacteria 2491
140 Ga0075434_100000681 3300006871 Bacteria 26437
141 Ga0075434_100138707 3300006871 Bacteria 2451
142 Ga0075434_101104875 3300006871 Bacteria 806
143 Ga0075434_101208966 3300006871 Unclassified 768
144 Ga0075429_100016031 3300006880 Bacteria 6491
145 Ga0075429_100150760 3300006880 Bacteria 2036
146 Ga0075429_100377785 3300006880 Bacteria 1241
147 Ga0075429_100910282 3300006880 Bacteria 770
148 Ga0068865_100782745 3300006881 Bacteria 822
149 Ga0075436_100010674 3300006914 Bacteria 6300
150 Ga0097620_100228091 3300006931 Bacteria 1950
151 Ga0075435_100061898 3300007076 Bacteria 3037
152 Ga0105240_11653139 3300009093 Bacteria 669
153 Ga0111539_10001336 3300009094 Bacteria 32835
154 Ga0111539_10007257 3300009094 Bacteria 14195
155 Ga0111539_10024773 3300009094 Bacteria 7359
156 Ga0111539_10170903 3300009094 Bacteria 2539
157 Ga0111539_10336535 3300009094 Unclassified 1757
158 Ga0111539_11265853 3300009094 Bacteria 856
159 Ga0105245_10880611 3300009098 Bacteria 936
160 Ga0114129_10047118 3300009147 Bacteria 6058
161 Ga0114129_10203842 3300009147 Bacteria 2677
162 Ga0114129_10232082 3300009147 Unclassified 2485
163 Ga0114129_10700613 3300009147 Bacteria 1301
164 Ga0114129_11116677 3300009147 Bacteria 986
165 Ga0114129_12461774 3300009147 Unclassified 623
166 Ga0105243_10013441 3300009148 Bacteria 6190
167 Ga0105243_11561356 3300009148 Bacteria 685
168 Ga0105241_10094665 3300009174 Unclassified 2363
169 Ga0105241_10944022 3300009174 Bacteria 804
170 Ga0105242_10139419 3300009176 Bacteria 2103
171 Ga0105242_10987578 3300009176 Bacteria 849
172 Ga0105248_10123170 3300009177 Bacteria 2925
173 Ga0105249_10879615 3300009553 Bacteria 962
174 Ga0105239_11002598 3300010375 Bacteria 960
175 Ga0105239_12970980 3300010375 Bacteria 553
176 Ga0105246_10083210 3300011119 Bacteria 2286
177 Ga0157374_12706010 3300013296 Bacteria 524
178 Ga0157378_10029806 3300013297 Bacteria 4819
179 Ga0157378_10272666 3300013297 Bacteria 1628
180 Ga0163162_10080864 3300013306 Bacteria 3319
181 Ga0157372_10470820 3300013307 Bacteria 1464
182 Ga0157375_10646523 3300013308 Bacteria 1214
183 Ga0157380_10305972 3300014326 Unclassified 1466
184 Ga0157380_10539623 3300014326 Bacteria 1142
185 Ga0157377_10072464 3300014745 Bacteria 1994
186 Ga0157379_10114732 3300014968 Bacteria 2421
187 Ga0163161_10075148 3300017792 Bacteria 2479
188 Ga0213876_10102073 3300021384 Bacteria 1520
189 Ga0207682_10216335 3300025893 Unclassified 885
190 Ga0207642_10692923 3300025899 Bacteria 641
191 Ga0207680_10012411 3300025903 Bacteria 4338
192 Ga0207647_10027665 3300025904 Bacteria 3694
193 Ga0207645_10074564 3300025907 Bacteria 2172
194 Ga0207645_10326868 3300025907 Bacteria 1024
195 Ga0207645_11210470 3300025907 Unclassified 507
196 Ga0207643_10150688 3300025908 Bacteria 1394
197 Ga0207684_10423302 3300025910 Bacteria 1144
198 Ga0207654_10089466 3300025911 Unclassified 1873
199 Ga0207660_10004233 3300025917 Bacteria 9349
200 Ga0207662_10020984 3300025918 Bacteria 3729
201 Ga0207662_10697645 3300025918 Bacteria 711
202 Ga0207652_10136354 3300025921 Unclassified 2192
203 Ga0207646_10019449 3300025922 Bacteria 6312
204 Ga0207646_10102738 3300025922 Bacteria 2563
205 Ga0207646_10649428 3300025922 Bacteria 945
206 Ga0207646_11075497 3300025922 Bacteria 709
207 Ga0207681_10000957 3300025923 Bacteria 18856
208 Ga0207681_10171700 3300025923 Bacteria 1644
209 Ga0207694_10168746 3300025924 Bacteria 1771
210 Ga0207650_10894750 3300025925 Bacteria 754
211 Ga0207659_10103357 3300025926 Bacteria 2153
212 Ga0207659_10200769 3300025926 Bacteria 1592
213 Ga0207659_11014249 3300025926 Bacteria 714
214 Ga0207687_10406977 3300025927 Bacteria 1120
215 Ga0207686_10028452 3300025934 Bacteria 3286
216 Ga0207686_11452676 3300025934 Bacteria 565
217 Ga0207709_10059565 3300025935 Bacteria 2377
218 Ga0207709_10556399 3300025935 Bacteria 903
219 Ga0207670_10106454 3300025936 Bacteria 2012
220 Ga0207670_10239189 3300025936 Bacteria 1398
221 Ga0207670_11178398 3300025936 Bacteria 648
222 Ga0207669_10714936 3300025937 Bacteria 824
223 Ga0207669_11308217 3300025937 Bacteria 616
224 Ga0207704_10658967 3300025938 Bacteria 863
225 Ga0207691_10005881 3300025940 Bacteria 11847
226 Ga0207691_10008327 3300025940 Bacteria 9959
227 Ga0207711_10118241 3300025941 Bacteria 2364
228 Ga0207689_10195644 3300025942 Bacteria 1669
229 Ga0207689_10869143 3300025942 Bacteria 761
230 Ga0207661_10039357 3300025944 Bacteria 3711
231 Ga0207651_10129876 3300025960 Bacteria 1926
232 Ga0207651_10135560 3300025960 Bacteria 1893
233 Ga0207651_10359697 3300025960 Bacteria 1228
234 Ga0207651_11863726 3300025960 Unclassified 541
235 Ga0207712_10827765 3300025961 Bacteria 815
236 Ga0207668_10041018 3300025972 Bacteria 3126
237 Ga0207668_10175579 3300025972 Bacteria 1685
238 Ga0207640_10173547 3300025981 Bacteria 1609
239 Ga0207640_12089121 3300025981 Bacteria 514
240 Ga0207658_10167461 3300025986 Bacteria 1807
241 Ga0207677_10047627 3300026023 Bacteria 2880
242 Ga0207703_10042731 3300026035 Bacteria 3636
243 Ga0207703_10222470 3300026035 Bacteria 1688
244 Ga0207639_10025694 3300026041 Bacteria 4273
245 Ga0207678_10188732 3300026067 Bacteria 1761
246 Ga0207708_10013337 3300026075 Bacteria 6139
247 Ga0207708_10091558 3300026075 Bacteria 2345
248 Ga0207708_10128274 3300026075 Bacteria 1981
249 Ga0207708_11208183 3300026075 Bacteria 661
250 Ga0207648_10035711 3300026089 Bacteria 4380
251 Ga0207648_10425234 3300026089 Bacteria 1207
252 Ga0207676_11783107 3300026095 Bacteria 614
253 Ga0207676_12586298 3300026095 Bacteria 504
254 Ga0207675_100022794 3300026118 Bacteria 5827
255 Ga0207675_100063271 3300026118 Bacteria 3457
256 Ga0207683_10027656 3300026121 Bacteria 4900
257 Ga0207683_10326001 3300026121 Bacteria 1407
258 Ga0209996_1032046 3300027395 Bacteria 766
259 Ga0209971_1055932 3300027682 Bacteria 954
260 Ga0207428_10004852 3300027907 Bacteria 12684
261 Ga0207428_10148727 3300027907 Bacteria 1784
262 Ga0268265_10020328 3300028380 Bacteria 4633
263 Ga0268265_10484871 3300028380 Bacteria 1162
264 Ga0268264_10141210 3300028381 Bacteria 2148
265 Ga0265338_10009561 3300028800 Bacteria 11532
266 Ga0265316_10197534 3300031344 Bacteria 1492
267 Ga0307408_100361517 3300031548 Bacteria 1235
268 Ga0307516_10450115 3300031730 Bacteria 944
269 Ga0307413_10577045 3300031824 Bacteria 917
270 Ga0307407_10639474 3300031903 Unclassified 796
271 Ga0307412_10971914 3300031911 Bacteria 749
272 Ga0307409_102037747 3300031995 Bacteria 604
273 Ga0307416_101354611 3300032002 Unclassified 817
274 Ga0307414_10324378 3300032004 Bacteria 1312
275 Ga0307414_10849530 3300032004 Bacteria 835
276 Ga0307415_101097135 3300032126 Unclassified 745
277 Ga0373934_0441929 3300035086 Bacteria 545
278 Ga0436365_0715042 3300039437 Bacteria 6821
279 Ga0451789_0778423 3300041443 Bacteria 704
280 Ga0453683_0166441 3300044673 Bacteria 1396
281 Ga0453684_1405900 3300044712 Bacteria 723
282 Ga0495638_0056797 3300046460 Bacteria 2429
283 Ga0495580_0195404 3300046472 Unclassified 1395
284 Ga0495584_0130906 3300046491 Bacteria 1273
285 Ga0495587_0366321 3300046536 Unclassified 802
286 Ga0495621_0142956 3300046539 Bacteria 937
287 Ga0495645_0877439 3300046543 Bacteria 534
288 Ga0495656_0415127 3300046615 Bacteria 706
289 Ga0495656_0541981 3300046615 Bacteria 620
290 Ga0495659_0107685 3300046664 Bacteria 1086
291 Ga0495659_0323287 3300046664 Bacteria 655
292 Ga0495669_0215784 3300046684 Unclassified 919
293 Ga0495669_0296733 3300046684 Bacteria 779
294 Ga0495674_0475688 3300047319 Bacteria 1002
295 Ga0501298_018655 3300049521 Unclassified 1278
296 Ga0501300_080247 3300049523 Bacteria 537
297 Ga0501072_0361466 3300049588 Bacteria 1152
298 Ga0501072_0582149 3300049588 Bacteria 883
299 Ga0501209_123325 3300049656 Bacteria 770
300 Ga0501217_017868 3300049661 Unclassified 1640
301 Ga0501217_067932 3300049661 Bacteria 965
302 Ga0501224_030080 3300049664 Bacteria 813
303 Ga0501259_161705 3300049688 Unclassified 559
304 Ga0501260_023558 3300049689 Unclassified 679
305 Ga0501225_0042548 3300049705 Bacteria 1255
306 Ga0501234_011966 3300049707 Bacteria 1358
307 Ga0501079_1158528 3300049741 Bacteria 609
308 Ga0501080_0013006 3300049742 Bacteria 7641
309 Ga0501272_014419 3300049769 Unclassified 913
310 Ga0501274_017413 3300049771 Unclassified 720
311 Ga0501279_095894 3300049775 Unclassified 529
312 Ga0501280_024004 3300049776 Unclassified 923
313 Ga0501204_020774 3300049850 Bacteria 856
314 Ga0501212_016608 3300049851 Bacteria 1107
315 nmdc:mga05p37_1183_c1 3300050507 Bacteria 30129
316 nmdc:mga05p37_14953_c1 3300050507 Bacteria 9317
317 nmdc:mga05p37_1952308_c1 3300050507 Unclassified 558
318 nmdc:mga05p37_238091_c1 3300050507 Bacteria 2190
319 nmdc:mga05p37_925893_c1 3300050507 Bacteria 936
320 nmdc:mga09592_30258_c1 3300050508 Bacteria 4505
321 nmdc:mga09592_4687_c1 3300050508 Bacteria 11067
322 nmdc:mga0qj67_1455764_c1 3300050509 Unclassified 528
323 nmdc:mga0qj67_256809_c1 3300050509 Bacteria 1418
324 nmdc:mga0qj67_9116_c1 3300050509 Bacteria 7363
325 nmdc:mga06r32_10201_c1 3300050510 Bacteria 8480
326 nmdc:mga06r32_237564_c1 3300050510 Bacteria 1810
327 nmdc:mga06r32_638384_c1 3300050510 Bacteria 1034
328 nmdc:mga06r32_757417_c1 3300050510 Bacteria 934
329 nmdc:mga08y16_601984_c1 3300050511 Bacteria 1108
330 nmdc:mga08y16_7231_c1 3300050511 Bacteria 11651
331 nmdc:mga0n895_1364_c1 3300050512 Bacteria 18165
332 nmdc:mga0n895_6813_c1 3300050512 Bacteria 9755
333 nmdc:mga0n895_729151_c1 3300050512 Bacteria 985
334 nmdc:mga0n895_764346_c1 3300050512 Unclassified 959
335 nmdc:mga0rr50_170592_c1 3300050513 Bacteria 1773
336 nmdc:mga0rr50_298158_c1 3300050513 Unclassified 1348
337 nmdc:mga08x19_450445_c1 3300050514 Bacteria 906
338 nmdc:mga0a205_1057751_c1 3300050515 Bacteria 659
339 nmdc:mga0a205_1106626_c1 3300050515 Bacteria 640
340 nmdc:mga0a205_131445_c1 3300050515 Bacteria 2404
341 nmdc:mga0a205_166_c1 3300050515 Bacteria 44087
342 nmdc:mga0a205_17314_c2 3300050515 Bacteria 4725
343 nmdc:mga0a205_288575_c1 3300050515 Unclassified 1516
344 nmdc:mga0a205_456136_c1 3300050515 Bacteria 1138
345 nmdc:mga0a205_50738_c1 3300050515 Bacteria 4006
346 nmdc:mga0a205_635863_c1 3300050515 Bacteria 919
347 Ga0075436_100254745
348 Ga0065704_10009106
349 Ga0065715_10110541
350 Ga0065715_10410036
351 Ga0065707_10014032
352 Ga0065707_10401293
353 Ga0065707_10437671
354 Ga0070676_10066450
355 Ga0070676_10133350
356 Ga0070683_100055220
357 Ga0070690_100045728
358 Ga0070690_100152534
359 Ga0070677_10082761
360 Ga0068869_101360348
361 Ga0070666_10169458
362 Ga0070666_11067097
363 Ga0070680_100005747
364 Ga0070682_100007394
365 Ga0068868_100329040
366 Ga0070689_100025212
367 Ga0070689_100036104
368 Ga0070689_100312954
369 Ga0070691_10171105
370 Ga0070691_10597727
371 Ga0070687_100009035
372 Ga0070687_100049793
373 Ga0070692_10021141
374 Ga0070668_100068202
375 Ga0070668_100299287
376 Ga0070669_100009559
377 Ga0070669_100567323
378 Ga0070675_100095188
379 Ga0070675_100130072
380 Ga0070674_100142984
381 Ga0070673_100016962
382 Ga0070673_101669658
383 Ga0070673_102384069
384 Ga0070667_100186732
385 Ga0070667_100277584
386 Ga0070667_100902480
387 Ga0070705_100013240
388 Ga0070705_100100209
389 Ga0070705_100464479
390 Ga0070705_100695836
391 Ga0070705_100798321
392 Ga0070700_100061018
393 Ga0070700_100145143
394 Ga0070700_100719522
395 Ga0070694_100023836
396 Ga0070694_100027490
397 Ga0070694_100072293
398 Ga0070694_100102723
399 Ga0070694_100755180
400 Ga0070694_100933542
401 Ga0070663_100250861
402 Ga0070678_100010604
403 Ga0070681_10930117
404 Ga0068867_100045938
405 Ga0070685_10037548
406 Ga0070685_10173959
407 Ga0070707_100101538
408 Ga0070707_100429264
409 Ga0070707_100469444
410 Ga0070698_100005866
411 Ga0070698_100019285
412 Ga0070698_100087015
413 Ga0070699_100132619
414 Ga0070699_100164361
415 Ga0070679_100033621
416 Ga0070679_100243982
417 Ga0070684_100400068
418 Ga0070697_100074851
419 Ga0070697_100092901
420 Ga0070697_100103430
421 Ga0070697_100859604
422 Ga0068853_100157105
423 Ga0068853_101020125
424 Ga0070672_100014121
425 Ga0070672_100053721
426 Ga0070686_100064656
427 Ga0070686_100108272
428 Ga0070695_100004108
429 Ga0070695_100029457
430 Ga0070695_100251069
431 Ga0070695_100257239
432 Ga0070695_100287723
433 Ga0070695_100663255
434 Ga0070696_100014048
435 Ga0070696_100015950
436 Ga0070696_100068995
437 Ga0070696_100201044
438 Ga0070696_101073921
439 Ga0070665_101762808
440 Ga0070704_100001591
441 Ga0070704_100144537
442 Ga0070704_100149261
443 Ga0070704_100188926
444 Ga0070704_100219471
445 Ga0070704_100430219
446 Ga0070704_100548428
447 Ga0070704_100944416
448 Ga0068854_100247903
449 Ga0070702_100007205
450 Ga0068859_100228114
451 Ga0068866_10116723
452 Ga0068866_10340165
453 Ga0068866_11117845
454 Ga0068861_100011074
455 Ga0068861_100975109
456 Ga0068861_102330131
457 Ga0068863_100463463
458 Ga0068863_100699165
459 Ga0068858_100105115
460 Ga0068858_100483202
461 Ga0068860_100027600
462 Ga0068860_100050048
463 Ga0068862_100497491
464 Ga0075432_10296420
465 Ga0075366_10098099
466 Ga0097621_100005077
467 Ga0097621_101078583
468 Ga0068871_100001915
469 Ga0068871_100625337
470 Ga0075428_100025760
471 Ga0075428_100148050
472 Ga0075428_100492598
473 Ga0075428_101024050
474 Ga0075428_101414481
475 Ga0075428_101774543
476 Ga0075430_100025571
477 Ga0075430_101280671
478 Ga0075431_100041310
479 Ga0075431_100221453
480 Ga0075431_100231254
481 Ga0075431_100488344
482 Ga0075431_100956237
483 Ga0075433_10001683
484 Ga0075433_10004167
485 Ga0075433_10105994
486 Ga0075434_100000681
487 Ga0075434_100138707
488 Ga0075434_101104875
489 Ga0075434_101208966
490 Ga0075429_100016031
491 Ga0075429_100150760
492 Ga0075429_100377785
493 Ga0075429_100910282
494 Ga0068865_100782745
495 Ga0075436_100010674
496 Ga0097620_100228091
497 Ga0075435_100061898
498 Ga0105240_11653139
499 Ga0111539_10001336
500 Ga0111539_10007257
501 Ga0111539_10024773
502 Ga0111539_10170903
503 Ga0111539_10336535
504 Ga0111539_11265853
505 Ga0105245_10880611
506 Ga0114129_10047118
507 Ga0114129_10203842
508 Ga0114129_10232082
509 Ga0114129_10700613
510 Ga0114129_11116677
511 Ga0114129_12461774
512 Ga0105243_10013441
513 Ga0105243_11561356
514 Ga0105241_10094665
515 Ga0105241_10944022
516 Ga0105242_10139419
517 Ga0105242_10987578
518 Ga0105248_10123170
519 Ga0105249_10879615
520 Ga0105239_11002598
521 Ga0105239_12970980
522 Ga0105246_10083210
523 Ga0157374_12706010
524 Ga0157378_10029806
525 Ga0157378_10272666
526 Ga0163162_10080864
527 Ga0157372_10470820
528 Ga0157375_10646523
529 Ga0157380_10305972
530 Ga0157380_10539623
531 Ga0157377_10072464
532 Ga0157379_10114732
533 Ga0163161_10075148
534 Ga0213876_10102073
535 Ga0207682_10216335
536 Ga0207642_10692923
537 Ga0207680_10012411
538 Ga0207647_10027665
539 Ga0207645_10074564
540 Ga0207645_10326868
541 Ga0207645_11210470
542 Ga0207643_10150688
543 Ga0207684_10423302
544 Ga0207654_10089466
545 Ga0207660_10004233
546 Ga0207662_10020984
547 Ga0207662_10697645
548 Ga0207652_10136354
549 Ga0207646_10019449
550 Ga0207646_10102738
551 Ga0207646_10649428
552 Ga0207646_11075497
553 Ga0207681_10000957
554 Ga0207681_10171700
555 Ga0207694_10168746
556 Ga0207650_10894750
557 Ga0207659_10103357
558 Ga0207659_10200769
559 Ga0207659_11014249
560 Ga0207687_10406977
561 Ga0207686_10028452
562 Ga0207686_11452676
563 Ga0207709_10059565
564 Ga0207709_10556399
565 Ga0207670_10106454
566 Ga0207670_10239189
567 Ga0207670_11178398
568 Ga0207669_10714936
569 Ga0207669_11308217
570 Ga0207704_10658967
571 Ga0207691_10005881
572 Ga0207691_10008327
573 Ga0207711_10118241
574 Ga0207689_10195644
575 Ga0207689_10869143
576 Ga0207661_10039357
577 Ga0207651_10129876
578 Ga0207651_10135560
579 Ga0207651_10359697
580 Ga0207651_11863726
581 Ga0207712_10827765
582 Ga0207668_10041018
583 Ga0207668_10175579
584 Ga0207640_10173547
585 Ga0207640_12089121
586 Ga0207658_10167461
587 Ga0207677_10047627
588 Ga0207703_10042731
589 Ga0207703_10222470
590 Ga0207639_10025694
591 Ga0207678_10188732
592 Ga0207708_10013337
593 Ga0207708_10091558
594 Ga0207708_10128274
595 Ga0207708_11208183
596 Ga0207648_10035711
597 Ga0207648_10425234
598 Ga0207676_11783107
599 Ga0207676_12586298
600 Ga0207675_100022794
601 Ga0207675_100063271
602 Ga0207683_10027656
603 Ga0207683_10326001
604 Ga0209996_1032046
605 Ga0209971_1055932
606 Ga0207428_10004852
607 Ga0207428_10148727
608 Ga0268265_10020328
609 Ga0268265_10484871
610 Ga0268264_10141210
611 Ga0265338_10009561
612 Ga0265316_10197534
613 Ga0307408_100361517
614 Ga0307516_10450115
615 Ga0307413_10577045
616 Ga0307407_10639474
617 Ga0307412_10971914
618 Ga0307409_102037747
619 Ga0307416_101354611
620 Ga0307414_10324378
621 Ga0307414_10849530
622 Ga0307415_101097135
623 Ga0373934_0441929
624 Ga0436365_0715042
625 Ga0451789_0778423
626 Ga0453683_0166441
627 Ga0453684_1405900
628 Ga0495638_0056797
629 Ga0495580_0195404
630 Ga0495584_0130906
631 Ga0495587_0366321
632 Ga0495621_0142956
633 Ga0495645_0877439
634 Ga0495656_0415127
635 Ga0495656_0541981
636 Ga0495659_0107685
637 Ga0495659_0323287
638 Ga0495669_0215784
639 Ga0495669_0296733
640 Ga0495674_0475688
641 Ga0501298_018655
642 Ga0501300_080247
643 Ga0501072_0361466
644 Ga0501072_0582149
645 Ga0501209_123325
646 Ga0501217_017868
647 Ga0501217_067932
648 Ga0501224_030080
649 Ga0501259_161705
650 Ga0501260_023558
651 Ga0501225_0042548
652 Ga0501234_011966
653 Ga0501079_1158528
654 Ga0501080_0013006
655 Ga0501272_014419
656 Ga0501274_017413
657 Ga0501279_095894
658 Ga0501280_024004
659 Ga0501204_020774
660 Ga0501212_016608
661 nmdc:mga05p37_1183_c1
662 nmdc:mga05p37_14953_c1
663 nmdc:mga05p37_1952308_c1
664 nmdc:mga05p37_238091_c1
665 nmdc:mga05p37_925893_c1
666 nmdc:mga09592_30258_c1
667 nmdc:mga09592_4687_c1
668 nmdc:mga0qj67_1455764_c1
669 nmdc:mga0qj67_256809_c1
670 nmdc:mga0qj67_9116_c1
671 nmdc:mga06r32_10201_c1
672 nmdc:mga06r32_237564_c1
673 nmdc:mga06r32_638384_c1
674 nmdc:mga06r32_757417_c1
675 nmdc:mga08y16_601984_c1
676 nmdc:mga08y16_7231_c1
677 nmdc:mga0n895_1364_c1
678 nmdc:mga0n895_6813_c1
679 nmdc:mga0n895_729151_c1
680 nmdc:mga0n895_764346_c1
681 nmdc:mga0rr50_170592_c1
682 nmdc:mga0rr50_298158_c1
683 nmdc:mga08x19_450445_c1
684 nmdc:mga0a205_1057751_c1
685 nmdc:mga0a205_1106626_c1
686 nmdc:mga0a205_131445_c1
687 nmdc:mga0a205_166_c1
688 nmdc:mga0a205_17314_c2
689 nmdc:mga0a205_288575_c1
690 nmdc:mga0a205_456136_c1
691 nmdc:mga0a205_50738_c1
692 nmdc:mga0a205_635863_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

139

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z47-assembly1.cif.gz_B-2 structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius 0.7179 94 124
6wf7-assembly1.cif.gz_A methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ 0.6992 3 127
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.6982 3 126
4v6w-assembly1.cif.gz_AE structure of the d. melanogaster 80s ribosome 0.6907 96 122
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.6858 3 127
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8971 74 123 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8698 74 125 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8491 74 123 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8289 74 125 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8019 74 125 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7W5TGB5-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.97 76 126 GO:0016829
AF-A0A7Y2GMW0-F1-model_v4 VOC family protein 0.9669 61 125
AF-A0A5Q2RKD2-F1-model_v4 VOC family protein 0.9616 74 128
AF-A0A519RL42-F1-model_v4 VOC family protein 0.9612 62 126
AF-A0A4Q3L5Q3-F1-model_v4 Bleomycin resistance protein 0.9596 76 129

Map