F416673

General Info

Members Datasets Scaffolds Average Seq Length
346 205 692 125

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10197092|Ga0070681_101970922
Length 149
Sequence MRLPDVGARTLGQGSSPAVSWYRRAMTLERPEVDPPEGDIPFELGIDDLTVGDGDEATAGKKVAVHYVGVSFSTGEQFDASWDRGQPFEFKLGKGQVIPGWDQGVAGMKVGGRRRLTIPSAMAYGARGAGGVIKPHEPLIFVVDLLAVD

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
134 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 2867319477 Micromonospora musae MS1-9 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 3.76
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 4.34
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10197092 3300005458 Bacteria 1933
2 Ga0070658_10018190 3300005327 Bacteria 5622
3 Ga0070683_100003014 3300005329 Bacteria 13523
4 Ga0070683_100120056 3300005329 Bacteria 2483
5 Ga0070683_100132780 3300005329 Bacteria 2357
6 Ga0070683_100216177 3300005329 Bacteria 1821
7 Ga0068869_100414695 3300005334 Bacteria 1110
8 Ga0070680_100001050 3300005336 Bacteria 19754
9 Ga0070680_100020957 3300005336 Bacteria 5190
10 Ga0070680_100104297 3300005336 Bacteria 2356
11 Ga0070680_100276653 3300005336 Bacteria 1422
12 Ga0070680_100296200 3300005336 Bacteria 1371
13 Ga0070682_100284029 3300005337 Bacteria 1207
14 Ga0070682_100397229 3300005337 Bacteria 1042
15 Ga0070660_100030923 3300005339 Bacteria 4018
16 Ga0070660_100046811 3300005339 Bacteria 3316
17 Ga0070660_100085206 3300005339 Bacteria 2485
18 Ga0070660_100344202 3300005339 Bacteria 1227
19 Ga0070660_101202071 3300005339 Bacteria 643
20 Ga0070661_100029051 3300005344 Bacteria 3989
21 Ga0070661_100233720 3300005344 Bacteria 1413
22 Ga0070661_100285698 3300005344 Bacteria 1281
23 Ga0070675_100119339 3300005354 Bacteria 2240
24 Ga0070659_100043366 3300005366 Bacteria 3518
25 Ga0070659_100198717 3300005366 Bacteria 1650
26 Ga0070659_100458936 3300005366 Bacteria 1082
27 Ga0070659_100520957 3300005366 Bacteria 1015
28 Ga0070659_101289071 3300005366 Bacteria 648
29 Ga0070709_10787666 3300005434 Bacteria 745
30 Ga0070714_100247909 3300005435 Bacteria 1646
31 Ga0070714_102029380 3300005435 Bacteria 561
32 Ga0070701_10242323 3300005438 Bacteria 1085
33 Ga0070708_102118798 3300005445 Bacteria 520
34 Ga0070663_101999652 3300005455 Bacteria 521
35 Ga0070678_100292653 3300005456 Bacteria 1381
36 Ga0070681_10011277 3300005458 Bacteria 8840
37 Ga0070681_10011931 3300005458 Bacteria 8616
38 Ga0070681_10126627 3300005458 Bacteria 2487
39 Ga0070681_10249349 3300005458 Bacteria 1688
40 Ga0074259_11931221 3300005507 Bacteria 526
41 Ga0070679_100011160 3300005530 Bacteria 8558
42 Ga0070679_100019792 3300005530 Bacteria 6553
43 Ga0070679_100567934 3300005530 Bacteria 1078
44 Ga0070679_100594834 3300005530 Bacteria 1049
45 Ga0070684_100004862 3300005535 Bacteria 10270
46 Ga0070684_100545344 3300005535 Bacteria 1076
47 Ga0068853_100062918 3300005539 Bacteria 3213
48 Ga0068853_100524824 3300005539 Bacteria 1120
49 Ga0070665_100009628 3300005548 Bacteria 9774
50 Ga0068855_100211891 3300005563 Bacteria 2177
51 Ga0068857_100051356 3300005577 Bacteria 3658
52 Ga0068857_100051660 3300005577 Bacteria 3648
53 Ga0068854_100198408 3300005578 Bacteria 1576
54 Ga0068854_101031209 3300005578 Bacteria 730
55 Ga0068856_100086285 3300005614 Bacteria 3118
56 Ga0068856_100935114 3300005614 Bacteria 886
57 Ga0068852_100846570 3300005616 Bacteria 930
58 Ga0081455_10093650 3300005937 Bacteria 2428
59 Ga0081538_10039224 3300005981 Bacteria 3041
60 Ga0070717_11258350 3300006028 Bacteria 673
61 Ga0075364_10379609 3300006051 Bacteria 964
62 Ga0070712_100229723 3300006175 Bacteria 1473
63 Ga0070712_100613088 3300006175 Bacteria 922
64 Ga0097621_100512619 3300006237 Bacteria 1088
65 Ga0068871_100157016 3300006358 Bacteria 1943
66 Ga0075431_101207774 3300006847 Bacteria 719
67 Ga0105240_10183768 3300009093 Bacteria 2465
68 Ga0105240_11694926 3300009093 Bacteria 660
69 Ga0111539_10387870 3300009094 Bacteria 1626
70 Ga0105245_10607204 3300009098 Bacteria 1121
71 Ga0105245_10626484 3300009098 Bacteria 1104
72 Ga0105241_10735327 3300009174 Bacteria 903
73 Ga0105241_11700178 3300009174 Bacteria 613
74 Ga0105242_11573170 3300009176 Bacteria 690
75 Ga0105248_10904514 3300009177 Bacteria 996
76 Ga0105237_10144100 3300009545 Bacteria 2377
77 Ga0105237_11995308 3300009545 Bacteria 589
78 Ga0105238_10024233 3300009551 Bacteria 6186
79 Ga0105238_10469018 3300009551 Bacteria 1257
80 Ga0105239_10097033 3300010375 Bacteria 3257
81 Ga0105239_10541927 3300010375 Bacteria 1325
82 Ga0105239_11004371 3300010375 Bacteria 959
83 Ga0105239_12248162 3300010375 Bacteria 634
84 Ga0105246_10969827 3300011119 Bacteria 767
85 Ga0105246_11143304 3300011119 Bacteria 713
86 Ga0157326_1090349 3300012513 Bacteria 514
87 Ga0157373_10163287 3300013100 Bacteria 1567
88 Ga0157371_10128144 3300013102 Bacteria 1805
89 Ga0157370_10080731 3300013104 Bacteria 3062
90 Ga0157370_10612663 3300013104 Bacteria 996
91 Ga0157370_11272982 3300013104 Bacteria 663
92 Ga0157369_10165964 3300013105 Bacteria 2329
93 Ga0157369_10196088 3300013105 Bacteria 2121
94 Ga0157369_10210106 3300013105 Bacteria 2040
95 Ga0157374_10029337 3300013296 Bacteria 4981
96 Ga0157372_10084713 3300013307 Bacteria 3594
97 Ga0157372_10309231 3300013307 Bacteria 1839
98 Ga0157372_10350474 3300013307 Bacteria 1720
99 Ga0157372_10681019 3300013307 Bacteria 1197
100 Ga0157372_11150941 3300013307 Bacteria 897
101 Ga0163163_11214511 3300014325 Bacteria 816
102 Ga0182008_10139099 3300014497 Bacteria 1214
103 Ga0182008_10640875 3300014497 Bacteria 601
104 Ga0157377_10366825 3300014745 Bacteria 971
105 Ga0157379_11534785 3300014968 Bacteria 649
106 Ga0182007_10328653 3300015262 Bacteria 568
107 Ga0197907_10970788 3300020069 Bacteria 1084
108 Ga0197907_11225509 3300020069 Bacteria 2034
109 Ga0206356_10164471 3300020070 Bacteria 578
110 Ga0206356_10482171 3300020070 Bacteria 2006
111 Ga0206356_10618549 3300020070 Bacteria 1394
112 Ga0206356_11158822 3300020070 Bacteria 506
113 Ga0206354_10166484 3300020081 Bacteria 2989
114 Ga0206354_10323914 3300020081 Bacteria 727
115 Ga0206354_10703893 3300020081 Bacteria 2974
116 Ga0206353_11182390 3300020082 Bacteria 6192
117 Ga0206353_11454782 3300020082 Bacteria 1421
118 Ga0206353_11568503 3300020082 Bacteria 1193
119 Ga0206353_11810766 3300020082 Bacteria 4469
120 Ga0207656_10261426 3300025321 Bacteria 850
121 Ga0207705_10668555 3300025909 Bacteria 808
122 Ga0207707_10008292 3300025912 Bacteria 9016
123 Ga0207707_10264359 3300025912 Bacteria 1492
124 Ga0207707_10346067 3300025912 Bacteria 1281
125 Ga0207695_10066259 3300025913 Bacteria 3710
126 Ga0207695_10399887 3300025913 Bacteria 1258
127 Ga0207695_11119447 3300025913 Bacteria 667
128 Ga0207671_10212995 3300025914 Bacteria 1512
129 Ga0207671_10723752 3300025914 Bacteria 791
130 Ga0207693_10263170 3300025915 Bacteria 1352
131 Ga0207663_10241248 3300025916 Bacteria 1326
132 Ga0207660_10007206 3300025917 Bacteria 7198
133 Ga0207660_10132181 3300025917 Bacteria 1901
134 Ga0207660_10252758 3300025917 Bacteria 1391
135 Ga0207660_11166195 3300025917 Bacteria 627
136 Ga0207657_10007262 3300025919 Bacteria 11379
137 Ga0207657_10024919 3300025919 Bacteria 5528
138 Ga0207657_10172374 3300025919 Bacteria 1752
139 Ga0207657_10441785 3300025919 Bacteria 1021
140 Ga0207649_10030383 3300025920 Bacteria 3199
141 Ga0207649_10273533 3300025920 Bacteria 1225
142 Ga0207652_10008408 3300025921 Bacteria 8305
143 Ga0207652_10041654 3300025921 Bacteria 3905
144 Ga0207652_10152532 3300025921 Bacteria 2069
145 Ga0207652_10233434 3300025921 Bacteria 1658
146 Ga0207652_10369109 3300025921 Bacteria 1295
147 Ga0207652_10413716 3300025921 Bacteria 1216
148 Ga0207694_10164656 3300025924 Bacteria 1792
149 Ga0207694_10183787 3300025924 Bacteria 1696
150 Ga0207659_10135114 3300025926 Bacteria 1908
151 Ga0207687_10416697 3300025927 Bacteria 1108
152 Ga0207664_10440217 3300025929 Bacteria 1162
153 Ga0207690_10020079 3300025932 Bacteria 4122
154 Ga0207690_10381275 3300025932 Bacteria 1121
155 Ga0207709_11102009 3300025935 Bacteria 652
156 Ga0207665_10175374 3300025939 Bacteria 1550
157 Ga0207711_10635733 3300025941 Bacteria 996
158 Ga0207661_10031672 3300025944 Bacteria 4088
159 Ga0207661_10092677 3300025944 Bacteria 2519
160 Ga0207661_10101314 3300025944 Bacteria 2419
161 Ga0207661_10176697 3300025944 Bacteria 1862
162 Ga0207679_10343184 3300025945 Bacteria 1299
163 Ga0207667_10206943 3300025949 Bacteria 2012
164 Ga0207640_10621815 3300025981 Bacteria 917
165 Ga0207640_11047816 3300025981 Bacteria 719
166 Ga0207639_11407994 3300026041 Bacteria 654
167 Ga0207678_10049369 3300026067 Bacteria 3637
168 Ga0207678_11227909 3300026067 Bacteria 664
169 Ga0207702_10167885 3300026078 Bacteria 2009
170 Ga0207702_10177116 3300026078 Bacteria 1960
171 Ga0207702_10500174 3300026078 Bacteria 1185
172 Ga0207702_11777635 3300026078 Bacteria 609
173 Ga0207674_10046975 3300026116 Bacteria 4430
174 Ga0207674_10065186 3300026116 Bacteria 3672
175 Ga0207683_10310115 3300026121 Bacteria 1444
176 Ga0207698_10078321 3300026142 Bacteria 2653
177 Ga0207698_10284349 3300026142 Bacteria 1531
178 Ga0268266_11704491 3300028379 Bacteria 605
179 Ga0265334_10310386 3300028573 Bacteria 540
180 Ga0265322_10012673 3300028654 Bacteria 2441
181 Ga0265336_10179540 3300028666 Bacteria 630
182 Ga0265338_10076099 3300028800 Bacteria 2844
183 Ga0265330_10149005 3300031235 Bacteria 994
184 Ga0265325_10072485 3300031241 Bacteria 1726
185 Ga0265329_10055321 3300031242 Bacteria 1259
186 Ga0265340_10192058 3300031247 Bacteria 920
187 Ga0265340_10364960 3300031247 Bacteria 638
188 Ga0265339_10141700 3300031249 Bacteria 1222
189 Ga0265331_10239769 3300031250 Bacteria 814
190 Ga0265327_10039368 3300031251 Bacteria 2568
191 Ga0265327_10129674 3300031251 Bacteria 1187
192 Ga0265316_10063090 3300031344 Bacteria 2874
193 Ga0265316_10708548 3300031344 Bacteria 709
194 Ga0265313_10041891 3300031595 Bacteria 2253
195 Ga0265314_10047188 3300031711 Bacteria 3033
196 Ga0265314_10093305 3300031711 Bacteria 1954
197 Ga0265342_10133264 3300031712 Bacteria 1390
198 Ga0307410_11226168 3300031852 Bacteria 654
199 Ga0307409_100035894 3300031995 Bacteria 3637
200 Ga0307416_100169516 3300032002 Bacteria 2030
201 Ga0307415_100705554 3300032126 Bacteria 911
202 Ga0373926_0276095 3300035083 Bacteria 654
203 Ga0373923_0107995 3300035111 Bacteria 1233
204 Ga0373936_0009201 3300035113 Bacteria 3723
205 Ga0373936_0627308 3300035113 Bacteria 506
206 Ga0373953_0100612 3300035117 Bacteria 1216
207 Ga0373956_0111220 3300035119 Bacteria 1275
208 Ga0373943_0004337 3300035170 Bacteria 6437
209 Ga0373955_0033908 3300035172 Bacteria 2691
210 Ga0373924_0111947 3300035410 Bacteria 1180
211 Ga0373935_0158129 3300035692 Bacteria 1543
212 Ga0373947_0074708 3300035725 Bacteria 2086
213 Ga0373937_0157455 3300036401 Bacteria 2129
214 Ga0373925_0126296 3300037068 Bacteria 1990
215 Ga0395899_0117958 3300037312 Bacteria 1903
216 Ga0395900_0085042 3300037418 Bacteria 3251
217 Ga0395900_0945660 3300037418 Bacteria 783
218 Ga0395898_0136534 3300037466 Bacteria 2348
219 Ga0395898_0352346 3300037466 Bacteria 1404
220 Ga0395905_0229683 3300037471 Bacteria 1735
221 Ga0395905_1403388 3300037471 Bacteria 602
222 Ga0395901_0066509 3300038443 Bacteria 3754
223 Ga0395901_0129338 3300038443 Bacteria 2654
224 Ga0395901_0168139 3300038443 Bacteria 2301
225 Ga0395901_0689630 3300038443 Bacteria 1020
226 Ga0436365_0483999 3300039437 Bacteria 1886
227 Ga0436365_0742578 3300039437 Bacteria 2119
228 Ga0436365_1312404 3300039437 Bacteria 1345
229 Ga0436363_0614380 3300039450 Bacteria 1580
230 Ga0436362_0270015 3300039453 Bacteria 966
231 Ga0451839_1474157 3300041496 Bacteria 797
232 Ga0451849_1529007 3300041505 Bacteria 580
233 Ga0439448_0084801 3300042005 Bacteria 1067
234 Ga0450923_139311 3300042125 Bacteria 582
235 Ga0450907_045595 3300042146 Bacteria 752
236 Ga0466965_0074942 3300044683 Bacteria 1706
237 Ga0466966_0006477 3300044684 Bacteria 7749
238 Ga0466966_0280490 3300044684 Bacteria 1002
239 Ga0466961_0001212 3300044693 Bacteria 15858
240 Ga0466963_0003774 3300044694 Bacteria 8730
241 Ga0466963_0055616 3300044694 Bacteria 2632
242 Ga0466963_0198767 3300044694 Bacteria 1402
243 Ga0466963_0301808 3300044694 Bacteria 1126
244 Ga0466964_0002191 3300044706 Bacteria 6914
245 Ga0466964_0018326 3300044706 Bacteria 2686
246 Ga0466971_0000164 3300044719 Bacteria 24721
247 Ga0466971_0023398 3300044719 Bacteria 2754
248 Ga0466971_0073462 3300044719 Bacteria 1554
249 Ga0466968_0173119 3300044735 Bacteria 1001
250 Ga0466968_0314503 3300044735 Bacteria 755
251 Ga0466970_0011046 3300044765 Bacteria 4598
252 Ga0466970_0543627 3300044765 Bacteria 671
253 Ga0466957_0001579 3300044842 Bacteria 11996
254 Ga0466957_0016956 3300044842 Bacteria 4262
255 Ga0466957_0022554 3300044842 Bacteria 3716
256 Ga0466960_0217085 3300044901 Bacteria 1051
257 Ga0466960_0232408 3300044901 Bacteria 1018
258 Ga0466959_0043519 3300045049 Bacteria 3310
259 Ga0466959_0098152 3300045049 Bacteria 2099
260 Ga0466958_0009724 3300045836 Bacteria 5365
261 Ga0466958_0016426 3300045836 Bacteria 4262
262 Ga0466958_0029383 3300045836 Bacteria 3262
263 Ga0466958_0177562 3300045836 Bacteria 1351
264 Ga0466967_0005671 3300045976 Bacteria 8698
265 Ga0466967_0008811 3300045976 Bacteria 7435
266 Ga0466967_0012973 3300045976 Bacteria 6411
267 Ga0466967_0018006 3300045976 Bacteria 5632
268 Ga0466967_0023088 3300045976 Bacteria 5091
269 Ga0466967_0028210 3300045976 Bacteria 4683
270 Ga0466967_0274816 3300045976 Bacteria 1615
271 Ga0495592_0059959 3300046454 Bacteria 2800
272 Ga0495641_0095028 3300046461 Bacteria 1331
273 Ga0495641_0172612 3300046461 Bacteria 967
274 Ga0495651_0031320 3300046462 Bacteria 4147
275 Ga0495653_0078383 3300046463 Bacteria 2450
276 Ga0495662_0482221 3300046476 Bacteria 608
277 Ga0495608_0028561 3300046511 Bacteria 3790
278 Ga0495608_0846397 3300046511 Bacteria 538
279 Ga0495618_0134430 3300046514 Bacteria 1582
280 Ga0495628_0387380 3300046516 Bacteria 1023
281 Ga0495630_0028660 3300046517 Bacteria 4137
282 Ga0495630_0077227 3300046517 Bacteria 2510
283 Ga0495652_0158711 3300046529 Bacteria 1758
284 Ga0495587_0013545 3300046536 Bacteria 5123
285 Ga0495667_0015837 3300046559 Bacteria 5097
286 Ga0495635_0122869 3300046663 Bacteria 1770
287 Ga0495657_0014838 3300046675 Bacteria 5716
288 Ga0495599_0107826 3300046678 Bacteria 1735
289 Ga0495623_0022529 3300046679 Bacteria 4069
290 Ga0495658_0097571 3300046683 Bacteria 1749
291 Ga0495613_0091769 3300046689 Bacteria 2200
292 Ga0495613_0455012 3300046689 Bacteria 867
293 Ga0495600_0002467 3300046809 Bacteria 10614
294 Ga0495604_0089861 3300047317 Bacteria 2282
295 Ga0495674_0046818 3300047319 Bacteria 3838
296 Ga0495676_0213446 3300047321 Bacteria 1334
297 Ga0495680_0007344 3300047322 Bacteria 10133
298 Ga0495675_0071944 3300047444 Bacteria 2182
299 Ga0495684_0168252 3300047471 Bacteria 1631
300 Ga0495602_0046738 3300048088 Bacteria 3907
301 Ga0496100_0001352 3300048903 Bacteria 12009
302 Ga0496100_0242520 3300048903 Bacteria 1330
303 Ga0496101_0017463 3300048904 Bacteria 4867
304 Ga0496101_0383769 3300048904 Bacteria 1105
305 Ga0496104_0043225 3300048907 Bacteria 4232
306 Ga0496105_0050689 3300048908 Bacteria 3429
307 Ga0496105_0275593 3300048908 Bacteria 1357
308 Ga0496105_1389029 3300048908 Bacteria 509
309 Ga0496106_0003498 3300048909 Bacteria 11702
310 Ga0496106_1217479 3300048909 Bacteria 587
311 Ga0496109_1009207 3300048912 Bacteria 770
312 Ga0496110_0111844 3300048913 Bacteria 2455
313 Ga0496112_0151521 3300048915 Bacteria 2286
314 Ga0496112_0281526 3300048915 Bacteria 1610
315 Ga0496114_0121830 3300048917 Bacteria 2244
316 Ga0501036_0429915 3300049572 Bacteria 1101
317 Ga0501039_1196766 3300049575 Bacteria 588
318 Ga0501041_0752059 3300049577 Bacteria 624
319 Ga0501042_0582799 3300049578 Bacteria 813
320 Ga0501047_0201566 3300049581 Bacteria 1851
321 Ga0501047_0203446 3300049581 Bacteria 1840
322 Ga0501067_0027694 3300049583 Bacteria 3140
323 Ga0501069_0053166 3300049585 Bacteria 2256
324 Ga0501069_0183262 3300049585 Bacteria 1210
325 Ga0501069_0845376 3300049585 Bacteria 556
326 Ga0501070_0069203 3300049586 Bacteria 2922
327 Ga0501073_1118244 3300049589 Bacteria 541
328 Ga0501074_0209620 3300049590 Bacteria 1388
329 Ga0501076_0623612 3300049592 Bacteria 890
330 Ga0501076_0859778 3300049592 Bacteria 748
331 Ga0501080_0183468 3300049742 Bacteria 1925
332 Ga0501080_1516563 3300049742 Bacteria 569
333 Ga0501045_1192450 3300049824 Bacteria 556
334 nmdc:mga00v17_992533_c1 3300050491 Bacteria 529
335 nmdc:mga06r32_1085659_c1 3300050510 Bacteria 750
336 nmdc:mga08y16_320056_c1 3300050511 Bacteria 1597
337 nmdc:mga0n895_131943_c1 3300050512 Bacteria 2523
338 Ga0495601_0145235 3300053077 Bacteria 1548
339 Ga0495612_0019518 3300053078 Bacteria 2714
340 Ga0495612_0320321 3300053078 Bacteria 697
341 Ga0495595_0032166 3300053084 Bacteria 2361
342 Ga0495619_0027967 3300053085 Bacteria 3635
343 Ga0495619_0081094 3300053085 Bacteria 2184
344 Ga0466962_0001099 3300061719 Bacteria 12446
345 Ga0466962_0101418 3300061719 Bacteria 1382
346 2867323512 2867319477 Bacteria 7069771
347 Ga0070681_10197092
348 Ga0070658_10018190
349 Ga0070683_100003014
350 Ga0070683_100120056
351 Ga0070683_100132780
352 Ga0070683_100216177
353 Ga0068869_100414695
354 Ga0070680_100001050
355 Ga0070680_100020957
356 Ga0070680_100104297
357 Ga0070680_100276653
358 Ga0070680_100296200
359 Ga0070682_100284029
360 Ga0070682_100397229
361 Ga0070660_100030923
362 Ga0070660_100046811
363 Ga0070660_100085206
364 Ga0070660_100344202
365 Ga0070660_101202071
366 Ga0070661_100029051
367 Ga0070661_100233720
368 Ga0070661_100285698
369 Ga0070675_100119339
370 Ga0070659_100043366
371 Ga0070659_100198717
372 Ga0070659_100458936
373 Ga0070659_100520957
374 Ga0070659_101289071
375 Ga0070709_10787666
376 Ga0070714_100247909
377 Ga0070714_102029380
378 Ga0070701_10242323
379 Ga0070708_102118798
380 Ga0070663_101999652
381 Ga0070678_100292653
382 Ga0070681_10011277
383 Ga0070681_10011931
384 Ga0070681_10126627
385 Ga0070681_10249349
386 Ga0074259_11931221
387 Ga0070679_100011160
388 Ga0070679_100019792
389 Ga0070679_100567934
390 Ga0070679_100594834
391 Ga0070684_100004862
392 Ga0070684_100545344
393 Ga0068853_100062918
394 Ga0068853_100524824
395 Ga0070665_100009628
396 Ga0068855_100211891
397 Ga0068857_100051356
398 Ga0068857_100051660
399 Ga0068854_100198408
400 Ga0068854_101031209
401 Ga0068856_100086285
402 Ga0068856_100935114
403 Ga0068852_100846570
404 Ga0081455_10093650
405 Ga0081538_10039224
406 Ga0070717_11258350
407 Ga0075364_10379609
408 Ga0070712_100229723
409 Ga0070712_100613088
410 Ga0097621_100512619
411 Ga0068871_100157016
412 Ga0075431_101207774
413 Ga0105240_10183768
414 Ga0105240_11694926
415 Ga0111539_10387870
416 Ga0105245_10607204
417 Ga0105245_10626484
418 Ga0105241_10735327
419 Ga0105241_11700178
420 Ga0105242_11573170
421 Ga0105248_10904514
422 Ga0105237_10144100
423 Ga0105237_11995308
424 Ga0105238_10024233
425 Ga0105238_10469018
426 Ga0105239_10097033
427 Ga0105239_10541927
428 Ga0105239_11004371
429 Ga0105239_12248162
430 Ga0105246_10969827
431 Ga0105246_11143304
432 Ga0157326_1090349
433 Ga0157373_10163287
434 Ga0157371_10128144
435 Ga0157370_10080731
436 Ga0157370_10612663
437 Ga0157370_11272982
438 Ga0157369_10165964
439 Ga0157369_10196088
440 Ga0157369_10210106
441 Ga0157374_10029337
442 Ga0157372_10084713
443 Ga0157372_10309231
444 Ga0157372_10350474
445 Ga0157372_10681019
446 Ga0157372_11150941
447 Ga0163163_11214511
448 Ga0182008_10139099
449 Ga0182008_10640875
450 Ga0157377_10366825
451 Ga0157379_11534785
452 Ga0182007_10328653
453 Ga0197907_10970788
454 Ga0197907_11225509
455 Ga0206356_10164471
456 Ga0206356_10482171
457 Ga0206356_10618549
458 Ga0206356_11158822
459 Ga0206354_10166484
460 Ga0206354_10323914
461 Ga0206354_10703893
462 Ga0206353_11182390
463 Ga0206353_11454782
464 Ga0206353_11568503
465 Ga0206353_11810766
466 Ga0207656_10261426
467 Ga0207705_10668555
468 Ga0207707_10008292
469 Ga0207707_10264359
470 Ga0207707_10346067
471 Ga0207695_10066259
472 Ga0207695_10399887
473 Ga0207695_11119447
474 Ga0207671_10212995
475 Ga0207671_10723752
476 Ga0207693_10263170
477 Ga0207663_10241248
478 Ga0207660_10007206
479 Ga0207660_10132181
480 Ga0207660_10252758
481 Ga0207660_11166195
482 Ga0207657_10007262
483 Ga0207657_10024919
484 Ga0207657_10172374
485 Ga0207657_10441785
486 Ga0207649_10030383
487 Ga0207649_10273533
488 Ga0207652_10008408
489 Ga0207652_10041654
490 Ga0207652_10152532
491 Ga0207652_10233434
492 Ga0207652_10369109
493 Ga0207652_10413716
494 Ga0207694_10164656
495 Ga0207694_10183787
496 Ga0207659_10135114
497 Ga0207687_10416697
498 Ga0207664_10440217
499 Ga0207690_10020079
500 Ga0207690_10381275
501 Ga0207709_11102009
502 Ga0207665_10175374
503 Ga0207711_10635733
504 Ga0207661_10031672
505 Ga0207661_10092677
506 Ga0207661_10101314
507 Ga0207661_10176697
508 Ga0207679_10343184
509 Ga0207667_10206943
510 Ga0207640_10621815
511 Ga0207640_11047816
512 Ga0207639_11407994
513 Ga0207678_10049369
514 Ga0207678_11227909
515 Ga0207702_10167885
516 Ga0207702_10177116
517 Ga0207702_10500174
518 Ga0207702_11777635
519 Ga0207674_10046975
520 Ga0207674_10065186
521 Ga0207683_10310115
522 Ga0207698_10078321
523 Ga0207698_10284349
524 Ga0268266_11704491
525 Ga0265334_10310386
526 Ga0265322_10012673
527 Ga0265336_10179540
528 Ga0265338_10076099
529 Ga0265330_10149005
530 Ga0265325_10072485
531 Ga0265329_10055321
532 Ga0265340_10192058
533 Ga0265340_10364960
534 Ga0265339_10141700
535 Ga0265331_10239769
536 Ga0265327_10039368
537 Ga0265327_10129674
538 Ga0265316_10063090
539 Ga0265316_10708548
540 Ga0265313_10041891
541 Ga0265314_10047188
542 Ga0265314_10093305
543 Ga0265342_10133264
544 Ga0307410_11226168
545 Ga0307409_100035894
546 Ga0307416_100169516
547 Ga0307415_100705554
548 Ga0373926_0276095
549 Ga0373923_0107995
550 Ga0373936_0009201
551 Ga0373936_0627308
552 Ga0373953_0100612
553 Ga0373956_0111220
554 Ga0373943_0004337
555 Ga0373955_0033908
556 Ga0373924_0111947
557 Ga0373935_0158129
558 Ga0373947_0074708
559 Ga0373937_0157455
560 Ga0373925_0126296
561 Ga0395899_0117958
562 Ga0395900_0085042
563 Ga0395900_0945660
564 Ga0395898_0136534
565 Ga0395898_0352346
566 Ga0395905_0229683
567 Ga0395905_1403388
568 Ga0395901_0066509
569 Ga0395901_0129338
570 Ga0395901_0168139
571 Ga0395901_0689630
572 Ga0436365_0483999
573 Ga0436365_0742578
574 Ga0436365_1312404
575 Ga0436363_0614380
576 Ga0436362_0270015
577 Ga0451839_1474157
578 Ga0451849_1529007
579 Ga0439448_0084801
580 Ga0450923_139311
581 Ga0450907_045595
582 Ga0466965_0074942
583 Ga0466966_0006477
584 Ga0466966_0280490
585 Ga0466961_0001212
586 Ga0466963_0003774
587 Ga0466963_0055616
588 Ga0466963_0198767
589 Ga0466963_0301808
590 Ga0466964_0002191
591 Ga0466964_0018326
592 Ga0466971_0000164
593 Ga0466971_0023398
594 Ga0466971_0073462
595 Ga0466968_0173119
596 Ga0466968_0314503
597 Ga0466970_0011046
598 Ga0466970_0543627
599 Ga0466957_0001579
600 Ga0466957_0016956
601 Ga0466957_0022554
602 Ga0466960_0217085
603 Ga0466960_0232408
604 Ga0466959_0043519
605 Ga0466959_0098152
606 Ga0466958_0009724
607 Ga0466958_0016426
608 Ga0466958_0029383
609 Ga0466958_0177562
610 Ga0466967_0005671
611 Ga0466967_0008811
612 Ga0466967_0012973
613 Ga0466967_0018006
614 Ga0466967_0023088
615 Ga0466967_0028210
616 Ga0466967_0274816
617 Ga0495592_0059959
618 Ga0495641_0095028
619 Ga0495641_0172612
620 Ga0495651_0031320
621 Ga0495653_0078383
622 Ga0495662_0482221
623 Ga0495608_0028561
624 Ga0495608_0846397
625 Ga0495618_0134430
626 Ga0495628_0387380
627 Ga0495630_0028660
628 Ga0495630_0077227
629 Ga0495652_0158711
630 Ga0495587_0013545
631 Ga0495667_0015837
632 Ga0495635_0122869
633 Ga0495657_0014838
634 Ga0495599_0107826
635 Ga0495623_0022529
636 Ga0495658_0097571
637 Ga0495613_0091769
638 Ga0495613_0455012
639 Ga0495600_0002467
640 Ga0495604_0089861
641 Ga0495674_0046818
642 Ga0495676_0213446
643 Ga0495680_0007344
644 Ga0495675_0071944
645 Ga0495684_0168252
646 Ga0495602_0046738
647 Ga0496100_0001352
648 Ga0496100_0242520
649 Ga0496101_0017463
650 Ga0496101_0383769
651 Ga0496104_0043225
652 Ga0496105_0050689
653 Ga0496105_0275593
654 Ga0496105_1389029
655 Ga0496106_0003498
656 Ga0496106_1217479
657 Ga0496109_1009207
658 Ga0496110_0111844
659 Ga0496112_0151521
660 Ga0496112_0281526
661 Ga0496114_0121830
662 Ga0501036_0429915
663 Ga0501039_1196766
664 Ga0501041_0752059
665 Ga0501042_0582799
666 Ga0501047_0201566
667 Ga0501047_0203446
668 Ga0501067_0027694
669 Ga0501069_0053166
670 Ga0501069_0183262
671 Ga0501069_0845376
672 Ga0501070_0069203
673 Ga0501073_1118244
674 Ga0501074_0209620
675 Ga0501076_0623612
676 Ga0501076_0859778
677 Ga0501080_0183468
678 Ga0501080_1516563
679 Ga0501045_1192450
680 nmdc:mga00v17_992533_c1
681 nmdc:mga06r32_1085659_c1
682 nmdc:mga08y16_320056_c1
683 nmdc:mga0n895_131943_c1
684 Ga0495601_0145235
685 Ga0495612_0019518
686 Ga0495612_0320321
687 Ga0495595_0032166
688 Ga0495619_0027967
689 Ga0495619_0081094
690 Ga0466962_0001099
691 Ga0466962_0101418
692 2867323512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

54

146

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o4a-assembly3.cif.gz_C crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf355 0.9962 19 121
4ggq-assembly3.cif.gz_B crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 0.9961 19 121
4ggq-assembly1.cif.gz_C crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 0.9947 19 121
5klx-assembly1.cif.gz_A crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf110 0.9938 19 121
2y78-assembly1.cif.gz_A-2 crystal structure of bpss1823, a mip-like chaperone from burkholderia pseudomallei 0.9934 19 121
ID Description Score Start End Superfamily
af_B0G119_2_111_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.978 17 124 3.10.50.40
4odpA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9605 30 123 3.10.50.40
af_Q66H94_147_254_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.9583 18 124 3.10.50.40
af_A0A0R4IUU2_161_295_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.9537 18 124 3.10.50.40
1q6uA02 Alpha Beta;Roll;Chitinase A; domain 3; 0.9524 18 124 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A248YND7-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 1.002 20 124 GO:0140839
GO:0140840
AF-A0A0M9YNY9-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9979 20 122 GO:0140839
GO:0140840
AF-A0A5Q4GQR8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9973 13 124 GO:0006457
GO:0140839
GO:0140840
AF-A0A2D4VWM6-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9972 18 124 GO:0006457
GO:0140839
GO:0140840
AF-A0A292YYX4-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9971 3 124 GO:0140839
GO:0140840

Map