F416648

General Info

Members Datasets Scaffolds Average Seq Length
346 215 692 55

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100599658|Ga0070675_1005996582
Length 55
Sequence MPAEKECPLCGSTMRLKQTQTVVHIPGNPKASTRKTPEWVCPECDYFEEAEEAGT

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
150 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
153 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
203 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
204 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 1.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.51
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 45.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100599658 3300005354 Unclassified 999
2 MRS1b_contig_4539310 2162886011 Bacteria 1250
3 JGI25406J46586_10002832 3300003203 Bacteria 8168
4 JGI25406J46586_10155629 3300003203 Unclassified 667
5 Ga0058859_11509088 3300004798 Bacteria 526
6 Ga0058860_11294607 3300004801 Unclassified 660
7 Ga0065714_10093845 3300005288 Unclassified 1834
8 Ga0065704_10198273 3300005289 Bacteria 1158
9 Ga0065712_10000597 3300005290 Bacteria 9694
10 Ga0065715_10000279 3300005293 Bacteria 24409
11 Ga0065707_10052145 3300005295 Unclassified 687
12 Ga0065707_10138931 3300005295 Unclassified 1799
13 Ga0065707_10163075 3300005295 Unclassified 1546
14 Ga0065707_10191936 3300005295 Bacteria 1356
15 Ga0065707_11089610 3300005295 Unclassified 518
16 Ga0070676_10045852 3300005328 Unclassified 2547
17 Ga0070690_100091255 3300005330 Unclassified 2007
18 Ga0070690_101225669 3300005330 Unclassified 599
19 Ga0070670_100002450 3300005331 Bacteria 15299
20 Ga0070670_100745029 3300005331 Unclassified 883
21 Ga0070670_100873411 3300005331 Bacteria 814
22 Ga0070680_100231464 3300005336 Bacteria 1561
23 Ga0068868_101569028 3300005338 Unclassified 618
24 Ga0070689_100091364 3300005340 Unclassified 2400
25 Ga0070689_100375937 3300005340 Bacteria 1196
26 Ga0070691_10092194 3300005341 Unclassified 1495
27 Ga0070687_100205495 3300005343 Unclassified 1196
28 Ga0070687_100294882 3300005343 Bacteria 1026
29 Ga0070687_101246027 3300005343 Unclassified 550
30 Ga0070692_10040415 3300005345 Bacteria 2386
31 Ga0070692_10775834 3300005345 Unclassified 652
32 Ga0070668_100186969 3300005347 Unclassified 1695
33 Ga0070668_100520000 3300005347 Bacteria 1032
34 Ga0070668_101115047 3300005347 Unclassified 712
35 Ga0070669_100545060 3300005353 Bacteria 966
36 Ga0070675_100032244 3300005354 Bacteria 4239
37 Ga0070675_100062776 3300005354 Bacteria 3070
38 Ga0070675_100128799 3300005354 Bacteria 2155
39 Ga0070675_102080103 3300005354 Unclassified 523
40 Ga0070671_100028417 3300005355 Bacteria 4605
41 Ga0070674_100179113 3300005356 Unclassified 1622
42 Ga0070674_100259216 3300005356 Unclassified 1369
43 Ga0070674_101447323 3300005356 Unclassified 616
44 Ga0070673_100035380 3300005364 Bacteria 3787
45 Ga0070673_100541257 3300005364 Unclassified 1057
46 Ga0070673_100822382 3300005364 Unclassified 859
47 Ga0070688_100004045 3300005365 Bacteria 7610
48 Ga0070688_100649799 3300005365 Unclassified 812
49 Ga0070667_102282936 3300005367 Unclassified 510
50 Ga0070701_10125598 3300005438 Bacteria 1451
51 Ga0070705_100002146 3300005440 Bacteria 10030
52 Ga0070705_100121783 3300005440 Bacteria 1685
53 Ga0070700_100073035 3300005441 Unclassified 2195
54 Ga0070700_100243412 3300005441 Bacteria 1286
55 Ga0070700_101074878 3300005441 Bacteria 665
56 Ga0070694_100008629 3300005444 Bacteria 6242
57 Ga0070694_100026662 3300005444 Bacteria 3747
58 Ga0070694_100059801 3300005444 Bacteria 2596
59 Ga0070694_100577481 3300005444 Unclassified 903
60 Ga0070708_100164819 3300005445 Bacteria 2067
61 Ga0070678_100806621 3300005456 Unclassified 853
62 Ga0070678_101582961 3300005456 Bacteria 615
63 Ga0070662_100528567 3300005457 Unclassified 986
64 Ga0070662_101477264 3300005457 Unclassified 586
65 Ga0068867_100418240 3300005459 Unclassified 1135
66 Ga0070685_10003178 3300005466 Bacteria 8356
67 Ga0070685_10276292 3300005466 Bacteria 1123
68 Ga0070706_100603101 3300005467 Bacteria 1020
69 Ga0070706_100797645 3300005467 Unclassified 874
70 Ga0070707_100140459 3300005468 Bacteria 2350
71 Ga0070707_100575499 3300005468 Unclassified 1088
72 Ga0070707_100763681 3300005468 Unclassified 930
73 Ga0070707_101446709 3300005468 Bacteria 654
74 Ga0070698_100007543 3300005471 Bacteria 11764
75 Ga0070698_100112836 3300005471 Bacteria 2683
76 Ga0070698_100320871 3300005471 Unclassified 1480
77 Ga0070699_100020406 3300005518 Bacteria 5715
78 Ga0070679_100798910 3300005530 Unclassified 887
79 Ga0070684_100022773 3300005535 Bacteria 5230
80 Ga0070697_101776250 3300005536 Bacteria 552
81 Ga0070672_100019211 3300005543 Bacteria 4957
82 Ga0070672_100388200 3300005543 Unclassified 1195
83 Ga0070686_100172347 3300005544 Bacteria 1531
84 Ga0070695_100000092 3300005545 Bacteria 38562
85 Ga0070695_100044613 3300005545 Bacteria 2823
86 Ga0070695_100149709 3300005545 Unclassified 1627
87 Ga0070695_100701016 3300005545 Unclassified 804
88 Ga0070696_100001034 3300005546 Bacteria 17980
89 Ga0070696_100003929 3300005546 Bacteria 9919
90 Ga0070696_100759282 3300005546 Bacteria 795
91 Ga0070693_100883995 3300005547 Unclassified 668
92 Ga0070665_100003351 3300005548 Bacteria 17146
93 Ga0070704_100001850 3300005549 Bacteria 11661
94 Ga0070704_100115555 3300005549 Bacteria 2050
95 Ga0070704_100628105 3300005549 Unclassified 946
96 Ga0070704_100651405 3300005549 Unclassified 930
97 Ga0070664_100613859 3300005564 Bacteria 1009
98 Ga0068857_102087574 3300005577 Unclassified 556
99 Ga0068854_101632288 3300005578 Unclassified 588
100 Ga0070702_100065181 3300005615 Bacteria 2133
101 Ga0070702_100387396 3300005615 Unclassified 996
102 Ga0068852_100971602 3300005616 Unclassified 868
103 Ga0068852_102082206 3300005616 Unclassified 589
104 Ga0068859_101531480 3300005617 Unclassified 736
105 Ga0068859_101700100 3300005617 Bacteria 697
106 Ga0068864_100013157 3300005618 Bacteria 6850
107 Ga0068866_10265400 3300005718 Bacteria 1057
108 Ga0068870_10137876 3300005840 Unclassified 1424
109 Ga0068863_100023872 3300005841 Bacteria 5836
110 Ga0068858_100378702 3300005842 Bacteria 1358
111 Ga0068862_100044201 3300005844 Bacteria 3799
112 Ga0068862_102190597 3300005844 Unclassified 564
113 Ga0081538_10175007 3300005981 Bacteria 929
114 Ga0081539_10000024 3300005985 Bacteria 354702
115 Ga0081539_10001148 3300005985 Bacteria 47960
116 Ga0070712_100338838 3300006175 Bacteria 1227
117 Ga0097621_100108185 3300006237 Unclassified 2347
118 Ga0097621_100135273 3300006237 Unclassified 2102
119 Ga0068871_100036940 3300006358 Bacteria 3892
120 Ga0068871_100280915 3300006358 Unclassified 1456
121 Ga0075428_100009073 3300006844 Bacteria 11038
122 Ga0075428_100800335 3300006844 Unclassified 1002
123 Ga0075430_101607345 3300006846 Unclassified 534
124 Ga0075431_101676107 3300006847 Unclassified 593
125 Ga0075433_10013644 3300006852 Bacteria 6615
126 Ga0075433_10107052 3300006852 Bacteria 2479
127 Ga0075434_100001417 3300006871 Bacteria 20141
128 Ga0075434_100031330 3300006871 Bacteria 5242
129 Ga0075434_102349215 3300006871 Unclassified 536
130 Ga0075429_100403376 3300006880 Bacteria 1197
131 Ga0068865_100089291 3300006881 Unclassified 2232
132 Ga0068865_100293549 3300006881 Bacteria 1298
133 Ga0075436_100105345 3300006914 Bacteria 1966
134 Ga0097620_101531602 3300006931 Unclassified 736
135 Ga0097620_101700326 3300006931 Bacteria 697
136 Ga0097620_101887245 3300006931 Bacteria 660
137 Ga0075435_100018074 3300007076 Bacteria 5350
138 Ga0075435_100105798 3300007076 Unclassified 2336
139 Ga0111539_10419109 3300009094 Unclassified 1559
140 Ga0105247_10467283 3300009101 Unclassified 913
141 Ga0114129_12143891 3300009147 Unclassified 673
142 Ga0105243_10043787 3300009148 Unclassified 3509
143 Ga0105242_10204758 3300009176 Bacteria 1754
144 Ga0105242_10671402 3300009176 Bacteria 1010
145 Ga0105242_10893009 3300009176 Unclassified 888
146 Ga0105242_12856018 3300009176 Bacteria 533
147 Ga0105248_10017735 3300009177 Bacteria 7851
148 Ga0105249_10018601 3300009553 Bacteria 6187
149 Ga0105249_10802796 3300009553 Bacteria 1005
150 Ga0105246_10058743 3300011119 Unclassified 2666
151 Ga0157374_10027753 3300013296 Bacteria 5111
152 Ga0157378_12549209 3300013297 Unclassified 563
153 Ga0163162_10145920 3300013306 Bacteria 2483
154 Ga0163162_12491671 3300013306 Unclassified 595
155 Ga0157375_10088547 3300013308 Bacteria 3151
156 Ga0163163_10633746 3300014325 Bacteria 1132
157 Ga0157380_10332177 3300014326 Unclassified 1414
158 Ga0157380_11997131 3300014326 Unclassified 642
159 Ga0157379_12308998 3300014968 Unclassified 536
160 Ga0157376_10271070 3300014969 Unclassified 1594
161 Ga0157376_12915188 3300014969 Unclassified 518
162 Ga0163161_10574714 3300017792 Unclassified 926
163 Ga0207697_10079155 3300025315 Unclassified 1384
164 Ga0207688_10255409 3300025901 Unclassified 1062
165 Ga0207645_10054655 3300025907 Bacteria 2550
166 Ga0207705_10969762 3300025909 Unclassified 657
167 Ga0207684_10038353 3300025910 Bacteria 4065
168 Ga0207684_11201786 3300025910 Unclassified 628
169 Ga0207693_10299694 3300025915 Bacteria 1259
170 Ga0207660_10414238 3300025917 Bacteria 1086
171 Ga0207662_10671768 3300025918 Unclassified 725
172 Ga0207646_10121272 3300025922 Bacteria 2349
173 Ga0207646_10162045 3300025922 Bacteria 2018
174 Ga0207646_10590530 3300025922 Unclassified 997
175 Ga0207646_10922678 3300025922 Unclassified 774
176 Ga0207646_10989455 3300025922 Unclassified 743
177 Ga0207681_10708662 3300025923 Unclassified 837
178 Ga0207650_10037351 3300025925 Bacteria 3539
179 Ga0207659_10062557 3300025926 Bacteria 2687
180 Ga0207659_11281263 3300025926 Unclassified 629
181 Ga0207700_10329275 3300025928 Unclassified 1325
182 Ga0207690_10940537 3300025932 Bacteria 718
183 Ga0207706_10098599 3300025933 Bacteria 2570
184 Ga0207706_10991152 3300025933 Unclassified 706
185 Ga0207686_10127580 3300025934 Bacteria 1740
186 Ga0207686_10452781 3300025934 Bacteria 988
187 Ga0207709_10129160 3300025935 Bacteria 1719
188 Ga0207670_10097517 3300025936 Unclassified 2093
189 Ga0207691_10049455 3300025940 Bacteria 3852
190 Ga0207691_10063006 3300025940 Bacteria 3363
191 Ga0207711_10059653 3300025941 Bacteria 3285
192 Ga0207661_10899909 3300025944 Unclassified 815
193 Ga0207679_11169082 3300025945 Unclassified 706
194 Ga0207651_10027410 3300025960 Bacteria 3578
195 Ga0207651_10279156 3300025960 Bacteria 1380
196 Ga0207712_10559446 3300025961 Unclassified 985
197 Ga0207668_10720455 3300025972 Unclassified 878
198 Ga0207668_11740442 3300025972 Bacteria 563
199 Ga0207708_10186731 3300026075 Bacteria 1648
200 Ga0207641_10048711 3300026088 Bacteria 3578
201 Ga0207641_11141149 3300026088 Bacteria 778
202 Ga0207648_10045003 3300026089 Bacteria 3872
203 Ga0207676_10497182 3300026095 Bacteria 1157
204 Ga0207675_100045094 3300026118 Bacteria 4119
205 Ga0207675_100972118 3300026118 Unclassified 867
206 Ga0207675_101074275 3300026118 Bacteria 824
207 Ga0207683_10103364 3300026121 Bacteria 2545
208 Ga0207698_11389569 3300026142 Unclassified 717
209 Ga0268266_10053660 3300028379 Bacteria 3464
210 Ga0268265_10430180 3300028380 Bacteria 1228
211 Ga0268264_11006525 3300028381 Unclassified 840
212 Ga0307408_102037470 3300031548 Unclassified 552
213 Ga0307405_10091153 3300031731 Bacteria 2019
214 Ga0307405_11511852 3300031731 Unclassified 590
215 Ga0307405_12078390 3300031731 Unclassified 509
216 Ga0307413_10143626 3300031824 Bacteria 1653
217 Ga0307410_10165734 3300031852 Bacteria 1660
218 Ga0307410_10278557 3300031852 Bacteria 1311
219 Ga0307407_10027755 3300031903 Bacteria 3017
220 Ga0307407_10862613 3300031903 Unclassified 692
221 Ga0307407_10962931 3300031903 Unclassified 658
222 Ga0307412_10163953 3300031911 Bacteria 1655
223 Ga0307412_10592806 3300031911 Unclassified 937
224 Ga0307412_10872415 3300031911 Bacteria 787
225 Ga0307409_100021267 3300031995 Bacteria 4444
226 Ga0307416_100153708 3300032002 Unclassified 2115
227 Ga0307416_100442618 3300032002 Unclassified 1350
228 Ga0307416_102036851 3300032002 Unclassified 676
229 Ga0307416_103674173 3300032002 Unclassified 514
230 Ga0307411_10029813 3300032005 Bacteria 3337
231 Ga0307411_10302707 3300032005 Bacteria 1283
232 Ga0307411_10435898 3300032005 Bacteria 1092
233 Ga0307415_100135351 3300032126 Bacteria 1873
234 Ga0307415_101839238 3300032126 Unclassified 587
235 Ga0307415_101926732 3300032126 Bacteria 574
236 Ga0373936_0161855 3300035113 Unclassified 975
237 Ga0373953_0031494 3300035117 Bacteria 2063
238 Ga0373933_0286221 3300035724 Bacteria 1065
239 Ga0373947_0474837 3300035725 Unclassified 848
240 Ga0373937_0009300 3300036401 Bacteria 8531
241 Ga0373937_0158177 3300036401 Bacteria 2124
242 Ga0373925_0324071 3300037068 Bacteria 1247
243 Ga0373925_1235720 3300037068 Unclassified 614
244 Ga0395900_0485666 3300037418 Unclassified 1187
245 Ga0395905_0938816 3300037471 Bacteria 768
246 Ga0395901_1203930 3300038443 Unclassified 723
247 Ga0451853_0417151 3300041512 Unclassified 529
248 Ga0439433_0048000 3300041999 Bacteria 1003
249 Ga0439433_0170954 3300041999 Unclassified 566
250 Ga0450920_107438 3300042122 Unclassified 582
251 Ga0439434_0028016 3300042435 Bacteria 1705
252 Ga0439434_0097406 3300042435 Unclassified 945
253 Ga0439434_0110265 3300042435 Unclassified 891
254 Ga0439464_0059622 3300042439 Bacteria 1115
255 Ga0439460_0051594 3300042461 Bacteria 1235
256 Ga0451577_1668000 3300042876 Unclassified 561
257 Ga0451576_0008261 3300045051 Bacteria 12240
258 Ga0466967_1305449 3300045976 Bacteria 723
259 Ga0495590_0440914 3300046457 Unclassified 503
260 Ga0495629_0007234 3300046459 Bacteria 8174
261 Ga0495641_0038021 3300046461 Bacteria 2251
262 Ga0495651_0378350 3300046462 Bacteria 929
263 Ga0495580_0118723 3300046472 Bacteria 1836
264 Ga0495580_1085335 3300046472 Unclassified 507
265 Ga0495582_0146722 3300046473 Bacteria 1339
266 Ga0495639_0699737 3300046475 Unclassified 523
267 Ga0495662_0679194 3300046476 Unclassified 502
268 Ga0495584_0112335 3300046491 Unclassified 1379
269 Ga0495584_0488174 3300046491 Unclassified 627
270 Ga0495594_0036065 3300046499 Bacteria 2696
271 Ga0495594_0039840 3300046499 Bacteria 2570
272 Ga0495628_0311083 3300046516 Bacteria 1164
273 Ga0495644_0199797 3300046523 Unclassified 770
274 Ga0495586_0355912 3300046535 Unclassified 841
275 Ga0495609_0111310 3300046538 Bacteria 1182
276 Ga0495621_0012664 3300046539 Bacteria 2633
277 Ga0495621_0029041 3300046539 Bacteria 1883
278 Ga0495621_0069325 3300046539 Bacteria 1296
279 Ga0495621_0316657 3300046539 Unclassified 649
280 Ga0495621_0521544 3300046539 Unclassified 514
281 Ga0495645_0144069 3300046543 Bacteria 1660
282 Ga0495659_0157088 3300046664 Unclassified 916
283 Ga0495659_0162808 3300046664 Bacteria 901
284 Ga0495659_0380123 3300046664 Unclassified 607
285 Ga0495657_0531426 3300046675 Unclassified 684
286 Ga0495623_0303501 3300046679 Bacteria 881
287 Ga0495658_0139302 3300046683 Bacteria 1482
288 Ga0495658_0657182 3300046683 Unclassified 671
289 Ga0495669_0216570 3300046684 Unclassified 917
290 Ga0495670_0693697 3300046691 Unclassified 555
291 Ga0495674_0429809 3300047319 Bacteria 1063
292 Ga0495676_0013576 3300047321 Bacteria 7315
293 Ga0495677_0265028 3300047445 Unclassified 673
294 Ga0495685_068358 3300047447 Bacteria 1192
295 Ga0496100_0326376 3300048903 Bacteria 1154
296 Ga0496100_1609703 3300048903 Unclassified 513
297 Ga0496101_0151178 3300048904 Unclassified 1776
298 Ga0496102_0044723 3300048905 Bacteria 4019
299 Ga0496102_0770898 3300048905 Unclassified 884
300 Ga0496104_0061601 3300048907 Bacteria 3557
301 Ga0496105_0762047 3300048908 Unclassified 738
302 Ga0496106_0423141 3300048909 Unclassified 1070
303 Ga0496106_0700686 3300048909 Unclassified 807
304 Ga0496106_0759823 3300048909 Unclassified 770
305 Ga0496107_0423694 3300048910 Unclassified 989
306 Ga0496107_0479421 3300048910 Bacteria 923
307 Ga0496108_0534642 3300048911 Unclassified 1023
308 Ga0496108_0864839 3300048911 Bacteria 777
309 Ga0496109_0014625 3300048912 Bacteria 6828
310 Ga0496109_0253184 3300048912 Bacteria 1658
311 Ga0496110_0003805 3300048913 Bacteria 11629
312 Ga0496110_0054233 3300048913 Bacteria 3526
313 Ga0496111_0032276 3300048914 Bacteria 3733
314 Ga0496111_0245181 3300048914 Unclassified 1330
315 Ga0496112_0000542 3300048915 Bacteria 25877
316 Ga0496112_0015875 3300048915 Bacteria 7038
317 Ga0496112_0190884 3300048915 Bacteria 2011
318 Ga0496113_0003179 3300048916 Bacteria 9782
319 Ga0496113_0158800 3300048916 Bacteria 1787
320 Ga0496114_0837115 3300048917 Unclassified 800
321 Ga0501308_053456 3300049128 Bacteria 596
322 Ga0501325_053923 3300049541 Unclassified 517
323 Ga0501041_0566884 3300049577 Bacteria 724
324 Ga0501042_1372539 3300049578 Unclassified 515
325 Ga0501074_0857451 3300049590 Unclassified 640
326 Ga0501217_256745 3300049661 Bacteria 565
327 Ga0501259_210997 3300049688 Bacteria 500
328 Ga0501275_058947 3300049772 Unclassified 581
329 nmdc:mga08y16_473899_c1 3300050511 Unclassified 1274
330 nmdc:mga08y16_89786_c1 3300050511 Bacteria 3202
331 nmdc:mga0n895_11062_c1 3300050512 Bacteria 8026
332 nmdc:mga0rr50_149446_c1 3300050513 Unclassified 1886
333 nmdc:mga0rr50_50909_c1 3300050513 Bacteria 3071
334 nmdc:mga08x19_603857_c1 3300050514 Bacteria 778
335 nmdc:mga08x19_822465_c1 3300050514 Unclassified 660
336 nmdc:mga0a205_7415_c1 3300050515 Bacteria 9933
337 Ga0495595_0482962 3300053084 Unclassified 631
338 Ga0495619_0256382 3300053085 Bacteria 1212
339 Ga0590071_002243 3300059421 Bacteria 4897
340 Ga0590071_017597 3300059421 Unclassified 1679
341 Ga0590074_000716 3300059423 Bacteria 5045
342 Ga0590074_107605 3300059423 Unclassified 548
343 Ga0590075_005402 3300059424 Bacteria 3016
344 Ga0590075_011298 3300059424 Bacteria 2157
345 Ga0590077_001549 3300059426 Bacteria 5311
346 Ga0590077_011479 3300059426 Bacteria 1830
347 Ga0070675_100599658
348 MRS1b_contig_4539310
349 JGI25406J46586_10002832
350 JGI25406J46586_10155629
351 Ga0058859_11509088
352 Ga0058860_11294607
353 Ga0065714_10093845
354 Ga0065704_10198273
355 Ga0065712_10000597
356 Ga0065715_10000279
357 Ga0065707_10052145
358 Ga0065707_10138931
359 Ga0065707_10163075
360 Ga0065707_10191936
361 Ga0065707_11089610
362 Ga0070676_10045852
363 Ga0070690_100091255
364 Ga0070690_101225669
365 Ga0070670_100002450
366 Ga0070670_100745029
367 Ga0070670_100873411
368 Ga0070680_100231464
369 Ga0068868_101569028
370 Ga0070689_100091364
371 Ga0070689_100375937
372 Ga0070691_10092194
373 Ga0070687_100205495
374 Ga0070687_100294882
375 Ga0070687_101246027
376 Ga0070692_10040415
377 Ga0070692_10775834
378 Ga0070668_100186969
379 Ga0070668_100520000
380 Ga0070668_101115047
381 Ga0070669_100545060
382 Ga0070675_100032244
383 Ga0070675_100062776
384 Ga0070675_100128799
385 Ga0070675_102080103
386 Ga0070671_100028417
387 Ga0070674_100179113
388 Ga0070674_100259216
389 Ga0070674_101447323
390 Ga0070673_100035380
391 Ga0070673_100541257
392 Ga0070673_100822382
393 Ga0070688_100004045
394 Ga0070688_100649799
395 Ga0070667_102282936
396 Ga0070701_10125598
397 Ga0070705_100002146
398 Ga0070705_100121783
399 Ga0070700_100073035
400 Ga0070700_100243412
401 Ga0070700_101074878
402 Ga0070694_100008629
403 Ga0070694_100026662
404 Ga0070694_100059801
405 Ga0070694_100577481
406 Ga0070708_100164819
407 Ga0070678_100806621
408 Ga0070678_101582961
409 Ga0070662_100528567
410 Ga0070662_101477264
411 Ga0068867_100418240
412 Ga0070685_10003178
413 Ga0070685_10276292
414 Ga0070706_100603101
415 Ga0070706_100797645
416 Ga0070707_100140459
417 Ga0070707_100575499
418 Ga0070707_100763681
419 Ga0070707_101446709
420 Ga0070698_100007543
421 Ga0070698_100112836
422 Ga0070698_100320871
423 Ga0070699_100020406
424 Ga0070679_100798910
425 Ga0070684_100022773
426 Ga0070697_101776250
427 Ga0070672_100019211
428 Ga0070672_100388200
429 Ga0070686_100172347
430 Ga0070695_100000092
431 Ga0070695_100044613
432 Ga0070695_100149709
433 Ga0070695_100701016
434 Ga0070696_100001034
435 Ga0070696_100003929
436 Ga0070696_100759282
437 Ga0070693_100883995
438 Ga0070665_100003351
439 Ga0070704_100001850
440 Ga0070704_100115555
441 Ga0070704_100628105
442 Ga0070704_100651405
443 Ga0070664_100613859
444 Ga0068857_102087574
445 Ga0068854_101632288
446 Ga0070702_100065181
447 Ga0070702_100387396
448 Ga0068852_100971602
449 Ga0068852_102082206
450 Ga0068859_101531480
451 Ga0068859_101700100
452 Ga0068864_100013157
453 Ga0068866_10265400
454 Ga0068870_10137876
455 Ga0068863_100023872
456 Ga0068858_100378702
457 Ga0068862_100044201
458 Ga0068862_102190597
459 Ga0081538_10175007
460 Ga0081539_10000024
461 Ga0081539_10001148
462 Ga0070712_100338838
463 Ga0097621_100108185
464 Ga0097621_100135273
465 Ga0068871_100036940
466 Ga0068871_100280915
467 Ga0075428_100009073
468 Ga0075428_100800335
469 Ga0075430_101607345
470 Ga0075431_101676107
471 Ga0075433_10013644
472 Ga0075433_10107052
473 Ga0075434_100001417
474 Ga0075434_100031330
475 Ga0075434_102349215
476 Ga0075429_100403376
477 Ga0068865_100089291
478 Ga0068865_100293549
479 Ga0075436_100105345
480 Ga0097620_101531602
481 Ga0097620_101700326
482 Ga0097620_101887245
483 Ga0075435_100018074
484 Ga0075435_100105798
485 Ga0111539_10419109
486 Ga0105247_10467283
487 Ga0114129_12143891
488 Ga0105243_10043787
489 Ga0105242_10204758
490 Ga0105242_10671402
491 Ga0105242_10893009
492 Ga0105242_12856018
493 Ga0105248_10017735
494 Ga0105249_10018601
495 Ga0105249_10802796
496 Ga0105246_10058743
497 Ga0157374_10027753
498 Ga0157378_12549209
499 Ga0163162_10145920
500 Ga0163162_12491671
501 Ga0157375_10088547
502 Ga0163163_10633746
503 Ga0157380_10332177
504 Ga0157380_11997131
505 Ga0157379_12308998
506 Ga0157376_10271070
507 Ga0157376_12915188
508 Ga0163161_10574714
509 Ga0207697_10079155
510 Ga0207688_10255409
511 Ga0207645_10054655
512 Ga0207705_10969762
513 Ga0207684_10038353
514 Ga0207684_11201786
515 Ga0207693_10299694
516 Ga0207660_10414238
517 Ga0207662_10671768
518 Ga0207646_10121272
519 Ga0207646_10162045
520 Ga0207646_10590530
521 Ga0207646_10922678
522 Ga0207646_10989455
523 Ga0207681_10708662
524 Ga0207650_10037351
525 Ga0207659_10062557
526 Ga0207659_11281263
527 Ga0207700_10329275
528 Ga0207690_10940537
529 Ga0207706_10098599
530 Ga0207706_10991152
531 Ga0207686_10127580
532 Ga0207686_10452781
533 Ga0207709_10129160
534 Ga0207670_10097517
535 Ga0207691_10049455
536 Ga0207691_10063006
537 Ga0207711_10059653
538 Ga0207661_10899909
539 Ga0207679_11169082
540 Ga0207651_10027410
541 Ga0207651_10279156
542 Ga0207712_10559446
543 Ga0207668_10720455
544 Ga0207668_11740442
545 Ga0207708_10186731
546 Ga0207641_10048711
547 Ga0207641_11141149
548 Ga0207648_10045003
549 Ga0207676_10497182
550 Ga0207675_100045094
551 Ga0207675_100972118
552 Ga0207675_101074275
553 Ga0207683_10103364
554 Ga0207698_11389569
555 Ga0268266_10053660
556 Ga0268265_10430180
557 Ga0268264_11006525
558 Ga0307408_102037470
559 Ga0307405_10091153
560 Ga0307405_11511852
561 Ga0307405_12078390
562 Ga0307413_10143626
563 Ga0307410_10165734
564 Ga0307410_10278557
565 Ga0307407_10027755
566 Ga0307407_10862613
567 Ga0307407_10962931
568 Ga0307412_10163953
569 Ga0307412_10592806
570 Ga0307412_10872415
571 Ga0307409_100021267
572 Ga0307416_100153708
573 Ga0307416_100442618
574 Ga0307416_102036851
575 Ga0307416_103674173
576 Ga0307411_10029813
577 Ga0307411_10302707
578 Ga0307411_10435898
579 Ga0307415_100135351
580 Ga0307415_101839238
581 Ga0307415_101926732
582 Ga0373936_0161855
583 Ga0373953_0031494
584 Ga0373933_0286221
585 Ga0373947_0474837
586 Ga0373937_0009300
587 Ga0373937_0158177
588 Ga0373925_0324071
589 Ga0373925_1235720
590 Ga0395900_0485666
591 Ga0395905_0938816
592 Ga0395901_1203930
593 Ga0451853_0417151
594 Ga0439433_0048000
595 Ga0439433_0170954
596 Ga0450920_107438
597 Ga0439434_0028016
598 Ga0439434_0097406
599 Ga0439434_0110265
600 Ga0439464_0059622
601 Ga0439460_0051594
602 Ga0451577_1668000
603 Ga0451576_0008261
604 Ga0466967_1305449
605 Ga0495590_0440914
606 Ga0495629_0007234
607 Ga0495641_0038021
608 Ga0495651_0378350
609 Ga0495580_0118723
610 Ga0495580_1085335
611 Ga0495582_0146722
612 Ga0495639_0699737
613 Ga0495662_0679194
614 Ga0495584_0112335
615 Ga0495584_0488174
616 Ga0495594_0036065
617 Ga0495594_0039840
618 Ga0495628_0311083
619 Ga0495644_0199797
620 Ga0495586_0355912
621 Ga0495609_0111310
622 Ga0495621_0012664
623 Ga0495621_0029041
624 Ga0495621_0069325
625 Ga0495621_0316657
626 Ga0495621_0521544
627 Ga0495645_0144069
628 Ga0495659_0157088
629 Ga0495659_0162808
630 Ga0495659_0380123
631 Ga0495657_0531426
632 Ga0495623_0303501
633 Ga0495658_0139302
634 Ga0495658_0657182
635 Ga0495669_0216570
636 Ga0495670_0693697
637 Ga0495674_0429809
638 Ga0495676_0013576
639 Ga0495677_0265028
640 Ga0495685_068358
641 Ga0496100_0326376
642 Ga0496100_1609703
643 Ga0496101_0151178
644 Ga0496102_0044723
645 Ga0496102_0770898
646 Ga0496104_0061601
647 Ga0496105_0762047
648 Ga0496106_0423141
649 Ga0496106_0700686
650 Ga0496106_0759823
651 Ga0496107_0423694
652 Ga0496107_0479421
653 Ga0496108_0534642
654 Ga0496108_0864839
655 Ga0496109_0014625
656 Ga0496109_0253184
657 Ga0496110_0003805
658 Ga0496110_0054233
659 Ga0496111_0032276
660 Ga0496111_0245181
661 Ga0496112_0000542
662 Ga0496112_0015875
663 Ga0496112_0190884
664 Ga0496113_0003179
665 Ga0496113_0158800
666 Ga0496114_0837115
667 Ga0501308_053456
668 Ga0501325_053923
669 Ga0501041_0566884
670 Ga0501042_1372539
671 Ga0501074_0857451
672 Ga0501217_256745
673 Ga0501259_210997
674 Ga0501275_058947
675 nmdc:mga08y16_473899_c1
676 nmdc:mga08y16_89786_c1
677 nmdc:mga0n895_11062_c1
678 nmdc:mga0rr50_149446_c1
679 nmdc:mga0rr50_50909_c1
680 nmdc:mga08x19_603857_c1
681 nmdc:mga08x19_822465_c1
682 nmdc:mga0a205_7415_c1
683 Ga0495595_0482962
684 Ga0495619_0256382
685 Ga0590071_002243
686 Ga0590071_017597
687 Ga0590074_000716
688 Ga0590074_107605
689 Ga0590075_005402
690 Ga0590075_011298
691 Ga0590077_001549
692 Ga0590077_011479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t2h-assembly1.cif.gz_A engineered variant of i-onui meganuclease targeting the human tcra gene; harbors 43 point mutations relative to wild-type i-onui 0.7686 17 40
4tx4-assembly1.cif.gz_B crystal structure of a single-domain cysteine protease inhibitor from cowpea (vigna unguiculata) 0.7674 17 52
4v4b-assembly1.cif.gz_AQ structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. 0.7401 15 41
4s26-assembly1.cif.gz_A crystal structure of arabidopsis thaliana thic with bound imidazole ribonucleotide, s-adenosylhomocysteine, fe4s4 cluster and zn (monoclinic crystal form) 0.6871 17 50
5dat-assembly2.cif.gz_C1 complex of yeast 80s ribosome with hypusine-containing eif5a 0.6373 15 41
ID Description Score Start End Superfamily
af_Q59DY3_39_320_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8384 15 43 3.90.1200.10
af_P87295_31_328_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.818 15 51 2.130.10.10
af_O44199_1058_1283_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8138 16 50 3.40.50.300
af_Q8I1Z2_508_679_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.782 15 45 1.25.40.10
af_Q9VBT7_1_163_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7561 15 46 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A2V8EC04-F1-model_v4 Small CPxCG-related zinc finger protein 0.8983 1 58
AF-A0A1C5Z5Z5-F1-model_v4 Recombinase zinc beta ribbon domain-containing protein 0.8852 7 43
AF-A0A2V8EC04-F1-model_v4 Small CPxCG-related zinc finger protein 0.884 1 58
AF-A0A3N5YYM6-F1-model_v4 Small CPxCG-related zinc finger protein 0.8804 1 58
AF-A0A7V9NKZ4-F1-model_v4 Small CPxCG-related zinc finger protein 0.8795 6 58 GO:0046872

Map