F416600

General Info

Members Datasets Scaffolds Average Seq Length
345 221 691 291

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990059506|2990067098
Length 325
Sequence EAAARDAAEEASAFSHPPVTPDATARYGDHPDQVIDFYAPRTGTGTGTGTGAGASAGAGAGMGAGADAGAGTDGVPLVVVLHGGAWRAPYDRLHITPFADFLARRGFAVANVEYRRGGSIPAQTGPAGSTGPAGSTGPVAGRWPETFDDIAAALDALPGLVREALPQGDPRRMVLAGHSAGGHLALWAAARHVLPADAPWRTARPAPLRGVVAMAPIADFAVAEKLDVCGGATTQLLGGQDKFAERLPYADPSLLLPTGIATTLVQGRADIVVPEAVAEAYADAAAKSGEVVGLTLLEDVGHFPLIDPAADACAVVAEEIAQLAW

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
9 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
12 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
13 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
14 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
15 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
16 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
22 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
23 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
24 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
31 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
32 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
33 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
34 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
35 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
36 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
39 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
40 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
41 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
42 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
43 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
44 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
45 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
46 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
47 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
48 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
49 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
50 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
53 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
58 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
72 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
73 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
74 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
158 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
159 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
162 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
163 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
164 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
165 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
166 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
167 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
168 2643221578 Streptomyces sp. Root63 Isolate Unclassified
169 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
170 2643221647 Streptomyces sp. Root369 Isolate Unclassified
171 2643221670 Streptomyces sp. Root431 Isolate Unclassified
172 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
173 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
174 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
175 2643221714 Streptomyces sp. Root264 Isolate Unclassified
176 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
177 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
178 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
179 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
180 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
181 2808606448 Streptomyces sp. 193411 Isolate Unclassified
182 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
183 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
184 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
185 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
186 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
187 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
188 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
189 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
190 2862574272 Streptomyces sp. AcE210 Isolate Nodule
191 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
192 2867428634 Streptomyces sp. RP5T Isolate Unclassified
193 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
194 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
195 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
196 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
197 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
198 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
199 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
200 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
201 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
202 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
203 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
204 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
205 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
206 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
207 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
208 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
209 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
210 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
211 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
212 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
213 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
214 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
215 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
216 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
217 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
218 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
219 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
220 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
221 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.74
Metatranscriptomes 0.58
Isolates 17.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0.58
Rhizoplane 0.87
Rhizosphere 79.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10014610 3300003316 Bacteria 16128
2 rootH1_10014610 3300003323 Bacteria 26841
3 rootH1_10107150 3300003316 Bacteria 1203
4 rootH2_10069702 3300003320 Bacteria 3666
5 rootL2_10010397 3300003322 Bacteria 7235
6 rootH1_10020393 3300003323 Bacteria 3676
7 rootH1_10087459 3300003323 Bacteria 2634
8 Ga0006562J51391_1088179 3300003578 Bacteria 3311
9 Ga0006562J51391_1088180 3300003578 Bacteria 2960
10 Ga0068854_100260489 3300005578 Bacteria 1388
11 Ga0075367_10090513 3300006178 Bacteria 1861
12 Ga0105250_10013557 3300009092 Bacteria 3358
13 Ga0105243_10254387 3300009148 Bacteria 1570
14 Ga0105246_10000962 3300011119 Bacteria 16486
15 Ga0105246_10189701 3300011119 Bacteria 1590
16 Ga0157372_10440635 3300013307 Bacteria 1518
17 Ga0182008_10001881 3300014497 Bacteria 13649
18 Ga0182007_10001532 3300015262 Bacteria 12349
19 Ga0183367_1015 3300015688 Bacteria 298435
20 Ga0209758_1009995 3300025297 Bacteria 5766
21 Ga0207696_1015450 3300025711 Bacteria 2588
22 Ga0207647_10135809 3300025904 Bacteria 1443
23 Ga0207687_10033994 3300025927 Bacteria 3460
24 Ga0207691_10136841 3300025940 Bacteria 2160
25 Ga0207691_10194876 3300025940 Bacteria 1766
26 Ga0268266_10136237 3300028379 Bacteria 2200
27 Ga0307515_10002347 3300028794 Bacteria 41312
28 Ga0307515_10046619 3300028794 Bacteria 6619
29 Ga0307515_10236731 3300028794 Bacteria 1605
30 Ga0268256_1015629 3300030500 Bacteria 2207
31 Ga0307511_10001252 3300030521 Bacteria 26858
32 Ga0307511_10092459 3300030521 Bacteria 2040
33 Ga0307511_10127928 3300030521 Bacteria 1542
34 Ga0307512_10004438 3300030522 Bacteria 15362
35 Ga0307512_10097755 3300030522 Bacteria 2006
36 Ga0307512_10167782 3300030522 Bacteria 1267
37 Ga0307513_10001860 3300031456 Bacteria 29972
38 Ga0307509_10005745 3300031507 Bacteria 17077
39 Ga0307509_10008351 3300031507 Bacteria 13229
40 Ga0307509_10030438 3300031507 Bacteria 5971
41 Ga0307508_10016984 3300031616 Bacteria 6621
42 Ga0307514_10009413 3300031649 Bacteria 8220
43 Ga0307514_10031035 3300031649 Bacteria 4285
44 Ga0307514_10135270 3300031649 Bacteria 1688
45 Ga0307516_10062822 3300031730 Bacteria 3597
46 Ga0307516_10257268 3300031730 Bacteria 1437
47 Ga0307413_10439003 3300031824 Bacteria 1033
48 Ga0307518_10065674 3300031838 Bacteria 2632
49 Ga0307518_10082848 3300031838 Bacteria 2314
50 Ga0307416_100602528 3300032002 Bacteria 1178
51 Ga0307416_100866529 3300032002 Bacteria 1002
52 Ga0307507_10038003 3300033179 Bacteria 4888
53 Ga0307507_10117295 3300033179 Bacteria 2146
54 Ga0307510_10018695 3300033180 Bacteria 8144
55 Ga0307510_10050509 3300033180 Bacteria 4410
56 Ga0307510_10073212 3300033180 Bacteria 3397
57 Ga0307510_10087758 3300033180 Bacteria 2974
58 Ga0395901_0292134 3300038443 Bacteria 1691
59 Ga0439439_0000903 3300041406 Bacteria 5489
60 Ga0451853_1340935 3300041512 Bacteria 6241
61 Ga0439448_0003066 3300042005 Bacteria 4595
62 Ga0439432_022397 3300042006 Bacteria 2087
63 Ga0439449_0007540 3300042007 Bacteria 4134
64 Ga0439449_0039611 3300042007 Bacteria 1752
65 Ga0439455_0000131 3300042012 Bacteria 7967
66 Ga0439457_000728 3300042014 Bacteria 9774
67 Ga0439457_004776 3300042014 Bacteria 3491
68 Ga0439457_013445 3300042014 Bacteria 1840
69 Ga0450899_000667 3300042135 Bacteria 3897
70 Ga0450900_000378 3300042136 Bacteria 3365
71 Ga0450903_001795 3300042138 Bacteria 3924
72 Ga0450906_002726 3300042145 Bacteria 3842
73 Ga0450910_011161 3300042147 Bacteria 1286
74 Ga0439458_0002109 3300042157 Bacteria 4930
75 Ga0439458_0027039 3300042157 Bacteria 1352
76 Ga0450908_003359 3300042184 Bacteria 3108
77 Ga0450901_001251 3300042533 Bacteria 2936
78 Ga0466969_0111876 3300044656 Bacteria 1277
79 Ga0466972_0049366 3300044658 Bacteria 2032
80 Ga0466965_0005628 3300044683 Bacteria 5655
81 Ga0466965_0137935 3300044683 Bacteria 1268
82 Ga0466966_0163348 3300044684 Bacteria 1355
83 Ga0466961_0062445 3300044693 Bacteria 2367
84 Ga0466961_0199074 3300044693 Bacteria 1239
85 Ga0466963_0000365 3300044694 Bacteria 20535
86 Ga0466963_0116300 3300044694 Bacteria 1838
87 Ga0466964_0000783 3300044706 Bacteria 10348
88 Ga0466971_0000298 3300044719 Bacteria 19054
89 Ga0466970_0013879 3300044765 Bacteria 4132
90 Ga0466970_0036131 3300044765 Bacteria 2616
91 Ga0466970_0223685 3300044765 Bacteria 1051
92 Ga0466957_0000443 3300044842 Bacteria 20418
93 Ga0466960_0002012 3300044901 Bacteria 7540
94 Ga0466960_0038424 3300044901 Bacteria 2251
95 Ga0466959_0137079 3300045049 Bacteria 1732
96 Ga0466958_0018763 3300045836 Bacteria 4017
97 Ga0466967_0030023 3300045976 Bacteria 4557
98 Ga0466967_0063039 3300045976 Bacteria 3292
99 Ga0466967_0084436 3300045976 Bacteria 2873
100 Ga0495627_045038 3300046453 Bacteria 1345
101 Ga0495592_0020771 3300046454 Bacteria 4995
102 Ga0495603_0002709 3300046455 Bacteria 10441
103 Ga0495603_0003941 3300046455 Bacteria 8842
104 Ga0495603_0027088 3300046455 Bacteria 3460
105 Ga0495603_0031972 3300046455 Bacteria 3167
106 Ga0495603_0085496 3300046455 Bacteria 1846
107 Ga0495629_0004117 3300046459 Bacteria 10909
108 Ga0495629_0005006 3300046459 Bacteria 9933
109 Ga0495629_0008718 3300046459 Bacteria 7462
110 Ga0495629_0012497 3300046459 Bacteria 6149
111 Ga0495629_0016357 3300046459 Bacteria 5324
112 Ga0495629_0107291 3300046459 Bacteria 1948
113 Ga0495638_0084623 3300046460 Bacteria 1919
114 Ga0495651_0015960 3300046462 Bacteria 5817
115 Ga0495651_0187854 3300046462 Bacteria 1456
116 Ga0495582_0026052 3300046473 Bacteria 3204
117 Ga0495582_0062018 3300046473 Bacteria 2065
118 Ga0495605_0014591 3300046474 Bacteria 4297
119 Ga0495605_0113195 3300046474 Bacteria 1236
120 Ga0495639_0040526 3300046475 Bacteria 2095
121 Ga0495662_0010061 3300046476 Bacteria 4638
122 Ga0495662_0010485 3300046476 Bacteria 4535
123 Ga0495662_0087070 3300046476 Bacteria 1521
124 Ga0495664_0000960 3300046477 Bacteria 14809
125 Ga0495664_0108286 3300046477 Bacteria 1676
126 Ga0495584_0084735 3300046491 Bacteria 1596
127 Ga0495594_0000911 3300046499 Bacteria 15345
128 Ga0495594_0016103 3300046499 Bacteria 3934
129 Ga0495607_0048860 3300046501 Bacteria 2471
130 Ga0495607_0063281 3300046501 Bacteria 2093
131 Ga0495583_0021402 3300046506 Bacteria 3327
132 Ga0495583_0069197 3300046506 Bacteria 1555
133 Ga0495606_0021108 3300046507 Bacteria 4776
134 Ga0495616_0012908 3300046513 Bacteria 4724
135 Ga0495618_0016055 3300046514 Bacteria 4574
136 Ga0495620_0009673 3300046515 Bacteria 5117
137 Ga0495620_0019972 3300046515 Bacteria 3280
138 Ga0495620_0055617 3300046515 Bacteria 1667
139 Ga0495628_0290718 3300046516 Bacteria 1211
140 Ga0495630_0013116 3300046517 Bacteria 6026
141 Ga0495631_0021605 3300046518 Bacteria 2996
142 Ga0495643_0032498 3300046522 Bacteria 2896
143 Ga0495648_0015973 3300046524 Bacteria 5424
144 Ga0495666_0061654 3300046526 Bacteria 1791
145 Ga0495642_0024578 3300046528 Bacteria 2384
146 Ga0495652_0060536 3300046529 Bacteria 3199
147 Ga0495652_0194031 3300046529 Bacteria 1547
148 Ga0495654_0017876 3300046530 Bacteria 3721
149 Ga0495640_0002388 3300046533 Bacteria 15077
150 Ga0495640_0021800 3300046533 Bacteria 4693
151 Ga0495587_0014978 3300046536 Bacteria 4849
152 Ga0495609_0016724 3300046538 Bacteria 3416
153 Ga0495609_0115846 3300046538 Bacteria 1154
154 Ga0495597_0009932 3300046542 Bacteria 4678
155 Ga0495645_0058970 3300046543 Bacteria 2784
156 Ga0495645_0065780 3300046543 Bacteria 2623
157 Ga0495622_0001928 3300046557 Bacteria 10192
158 Ga0495622_0023476 3300046557 Bacteria 2875
159 Ga0495622_0040299 3300046557 Bacteria 2174
160 Ga0495668_0041838 3300046616 Bacteria 2551
161 Ga0495668_0252182 3300046616 Bacteria 966
162 Ga0495634_0018959 3300046642 Bacteria 4891
163 Ga0495634_0079227 3300046642 Bacteria 2151
164 Ga0495625_0006051 3300046660 Bacteria 10858
165 Ga0495625_0067723 3300046660 Bacteria 2512
166 Ga0495635_0015985 3300046663 Bacteria 5242
167 Ga0495661_0087294 3300046665 Bacteria 1784
168 Ga0495588_0005063 3300046674 Bacteria 5853
169 Ga0495588_0014822 3300046674 Bacteria 3739
170 Ga0495588_0053590 3300046674 Bacteria 2080
171 Ga0495657_0006781 3300046675 Bacteria 8925
172 Ga0495657_0202432 3300046675 Bacteria 1209
173 Ga0495599_0110353 3300046678 Bacteria 1714
174 Ga0495623_0177847 3300046679 Bacteria 1238
175 Ga0495646_0000454 3300046680 Bacteria 21689
176 Ga0495613_0005010 3300046689 Bacteria 9951
177 Ga0495613_0009728 3300046689 Bacteria 7146
178 Ga0495613_0010674 3300046689 Bacteria 6814
179 Ga0495613_0017208 3300046689 Bacteria 5384
180 Ga0495613_0018497 3300046689 Bacteria 5194
181 Ga0495613_0030586 3300046689 Bacteria 3999
182 Ga0495624_0016395 3300046690 Bacteria 4986
183 Ga0495624_0194253 3300046690 Bacteria 1234
184 Ga0495671_0023447 3300046692 Bacteria 3224
185 Ga0495671_0076293 3300046692 Bacteria 1644
186 Ga0495671_0136100 3300046692 Bacteria 1198
187 Ga0495649_0021236 3300046694 Bacteria 3638
188 Ga0495649_0164316 3300046694 Bacteria 1163
189 Ga0495589_0012218 3300046794 Bacteria 4454
190 Ga0495589_0026399 3300046794 Bacteria 2942
191 Ga0495589_0044967 3300046794 Bacteria 2194
192 Ga0495660_0031321 3300046810 Bacteria 2990
193 Ga0495581_0012198 3300047315 Bacteria 4976
194 Ga0495604_0001619 3300047317 Bacteria 18556
195 Ga0495604_0142309 3300047317 Bacteria 1712
196 Ga0495636_0009747 3300047318 Bacteria 3783
197 Ga0495636_0151818 3300047318 Bacteria 1040
198 Ga0495674_0040172 3300047319 Bacteria 4187
199 Ga0495674_0242392 3300047319 Bacteria 1485
200 Ga0495672_0072946 3300047320 Bacteria 1937
201 Ga0495676_0003144 3300047321 Bacteria 14936
202 Ga0495676_0010896 3300047321 Bacteria 8218
203 Ga0495676_0016195 3300047321 Bacteria 6622
204 Ga0495676_0024573 3300047321 Bacteria 5212
205 Ga0495676_0203686 3300047321 Bacteria 1373
206 Ga0495683_0016723 3300047323 Bacteria 3806
207 Ga0495687_001423 3300047443 Bacteria 22031
208 Ga0495687_002514 3300047443 Bacteria 14576
209 Ga0495687_076906 3300047443 Bacteria 1319
210 Ga0495687_110516 3300047443 Bacteria 1011
211 Ga0495675_0172514 3300047444 Bacteria 1328
212 Ga0495677_0067327 3300047445 Bacteria 1332
213 Ga0495677_0076984 3300047445 Bacteria 1248
214 Ga0495685_001652 3300047447 Bacteria 6878
215 Ga0495685_008661 3300047447 Bacteria 3384
216 Ga0495685_011481 3300047447 Bacteria 2989
217 Ga0495685_016892 3300047447 Bacteria 2494
218 Ga0495685_052516 3300047447 Bacteria 1380
219 Ga0495681_0001891 3300047470 Bacteria 15359
220 Ga0495681_0031024 3300047470 Bacteria 2713
221 Ga0495686_0236990 3300047472 Bacteria 1030
222 Ga0495593_0015939 3300047673 Bacteria 4245
223 Ga0495593_0091968 3300047673 Bacteria 1561
224 Ga0495593_0145194 3300047673 Bacteria 1201
225 Ga0495602_0036599 3300048088 Bacteria 4566
226 Ga0495602_0181311 3300048088 Bacteria 1624
227 Ga0495614_0003030 3300048089 Bacteria 7483
228 Ga0495614_0008796 3300048089 Bacteria 4482
229 Ga0495614_0030370 3300048089 Bacteria 2325
230 Ga0495614_0043388 3300048089 Bacteria 1928
231 Ga0495614_0150917 3300048089 Bacteria 1036
232 Ga0496106_0038110 3300048909 Bacteria 3597
233 Ga0496108_0436767 3300048911 Bacteria 1143
234 Ga0496109_0003413 3300048912 Bacteria 13294
235 Ga0495678_012174 3300049459 Bacteria 4085
236 Ga0495682_0010879 3300049460 Bacteria 3507
237 Ga0501032_0084796 3300049569 Bacteria 2106
238 Ga0501032_0191337 3300049569 Bacteria 1337
239 Ga0501033_0000908 3300049570 Bacteria 27052
240 Ga0501033_0035371 3300049570 Bacteria 3745
241 Ga0501034_0002448 3300049571 Bacteria 22388
242 Ga0501034_0025134 3300049571 Bacteria 6062
243 Ga0501036_0004031 3300049572 Bacteria 11811
244 Ga0501036_0005336 3300049572 Bacteria 10402
245 Ga0501036_0181590 3300049572 Bacteria 1771
246 Ga0501036_0299613 3300049572 Bacteria 1345
247 Ga0501037_0044847 3300049573 Bacteria 3246
248 Ga0501037_0135573 3300049573 Bacteria 1763
249 Ga0501037_0178110 3300049573 Bacteria 1509
250 Ga0501038_0001803 3300049574 Bacteria 19828
251 Ga0501038_0019669 3300049574 Bacteria 6079
252 Ga0501038_0202906 3300049574 Bacteria 1590
253 Ga0501039_0019842 3300049575 Bacteria 5152
254 Ga0501039_0174805 3300049575 Bacteria 1689
255 Ga0501043_0001081 3300049579 Bacteria 23969
256 Ga0501043_0058945 3300049579 Bacteria 3013
257 Ga0501046_0083159 3300049580 Bacteria 2471
258 Ga0501047_0012912 3300049581 Bacteria 7914
259 Ga0501047_0021165 3300049581 Bacteria 6245
260 Ga0501047_0206142 3300049581 Bacteria 1825
261 Ga0501048_0006433 3300049582 Bacteria 8928
262 Ga0501048_0245382 3300049582 Bacteria 1271
263 Ga0501048_0247537 3300049582 Bacteria 1265
264 Ga0501069_0177049 3300049585 Bacteria 1232
265 Ga0501070_0013963 3300049586 Bacteria 6762
266 Ga0501070_0248374 3300049586 Bacteria 1456
267 Ga0501071_0471281 3300049587 Bacteria 962
268 Ga0501073_0155292 3300049589 Bacteria 1586
269 Ga0501074_0001979 3300049590 Bacteria 14091
270 Ga0501080_0155937 3300049742 Bacteria 2109
271 Ga0501035_0000307 3300049822 Bacteria 57471
272 Ga0501035_0014009 3300049822 Bacteria 7396
273 Ga0501035_0015522 3300049822 Bacteria 7027
274 Ga0501035_0062968 3300049822 Bacteria 3299
275 Ga0501035_0404407 3300049822 Bacteria 1135
276 Ga0501044_0007527 3300049823 Bacteria 11977
277 Ga0501044_0027642 3300049823 Bacteria 5991
278 Ga0501044_0045739 3300049823 Bacteria 4534
279 nmdc:mga07m45_88938_c1 3300050496 Bacteria 1768
280 Ga0500644_0062318 3300053088 Bacteria 1318
281 Ga0500650_0050938 3300053098 Bacteria 1923
282 Ga0500560_001065 3300053107 Bacteria 4461
283 Ga0500624_007736 3300053157 Bacteria 1487
284 Ga0466962_0000225 3300061719 Bacteria 23463
285 Ga0466962_0023600 3300061719 Bacteria 2956
286 2990067098 2990059506 Bacteria 9321252
287 2547406352 2547132111 Bacteria 8013147
288 2554257724 2554235005 Bacteria 6457341
289 2585297894 2582581312 Bacteria 7308206
290 2585305398 2582581313 Bacteria 10042643
291 2585312868 2582581314 Bacteria 11452267
292 2616702314 2616644814 Bacteria 11555299
293 2643900462 2643221578 Bacteria 9213798
294 2643947487 2643221587 Bacteria 7586415
295 2644268539 2643221647 Bacteria 10741251
296 2644390387 2643221670 Bacteria 6497041
297 2644405316 2643221673 Bacteria 9196637
298 2644435179 2643221677 Bacteria 7584031
299 2644437421 2643221678 Bacteria 9540101
300 2644628176 2643221714 Bacteria 9015452
301 2784589267 2784132148 Bacteria 8627943
302 2785370313 2784746768 Bacteria 10036182
303 2786671418 2786546132 Bacteria 10419719
304 2808842837 2808606359 Bacteria 9866990
305 2808921236 2808606375 Bacteria 9466072
306 2809232881 2808606448 Bacteria 8656184
307 2812357228 2811994879 Bacteria 9313447
308 2812479907 2811994917 Bacteria 7761064
309 2819700051 2818991463 Bacteria 7948711
310 2852639882 2852635781 Bacteria 8251373
311 2862182105 2862178590 Bacteria 8583590
312 2862286493 2862281513 Bacteria 9621493
313 2862296209 2862290372 Bacteria 7471434
314 2862510128 2862507626 Bacteria 9425308
315 2862578613 2862574272 Bacteria 10567477
316 2863412133 2863404153 Bacteria 9672205
317 2867429077 2867428634 Bacteria 9590268
318 2873155144 2873151551 Bacteria 8625867
319 2877680317 2877676314 Bacteria 9512378
320 2912718951 2912715099 Bacteria 9460473
321 2912724180 2912723979 Bacteria 8557534
322 2918504817 2918501144 Bacteria 8668083
323 2919471283 2919468124 Bacteria 9133025
324 2946049190 2946045630 Bacteria 8527308
325 2946068638 2946064051 Bacteria 8957905
326 2946076638 2946072368 Bacteria 8999607
327 2947228255 2947224130 Bacteria 9938529
328 2954385350 2954380949 Bacteria 10050426
329 2954677744 2954673503 Bacteria 9685905
330 2954686410 2954682443 Bacteria 9862841
331 2954696081 2954691527 Bacteria 10720516
332 2954711253 2954701450 Bacteria 10834262
333 2954715486 2954711539 Bacteria 10867210
334 2954725404 2954721474 Bacteria 10456478
335 2954736390 2954731030 Bacteria 10243860
336 2954744340 2954740390 Bacteria 10229294
337 2954755238 2954749733 Bacteria 10366972
338 2954763312 2954759201 Bacteria 9358192
339 2966602345 2966598605 Bacteria 7676064
340 3006490410 3006486233 Bacteria 8157040
341 3006500219 3006493962 Bacteria 8825450
342 8008566006 8008558824 Bacteria 10610750
343 8008578230 8008574985 Bacteria 7815457
344 8023630054 8023623736 Bacteria 8593882
345 8048410806 8048406513 Bacteria 8936924
346 8056837788 8056829672 Bacteria 9045328
347 rootH1_10014610
348 rootH1_10107150
349 rootH2_10069702
350 rootL2_10010397
351 rootH1_10020393
352 rootH1_10087459
353 Ga0006562J51391_1088179
354 Ga0006562J51391_1088180
355 Ga0068854_100260489
356 Ga0075367_10090513
357 Ga0105250_10013557
358 Ga0105243_10254387
359 Ga0105246_10000962
360 Ga0105246_10189701
361 Ga0157372_10440635
362 Ga0182008_10001881
363 Ga0182007_10001532
364 Ga0183367_1015
365 Ga0209758_1009995
366 Ga0207696_1015450
367 Ga0207647_10135809
368 Ga0207687_10033994
369 Ga0207691_10136841
370 Ga0207691_10194876
371 Ga0268266_10136237
372 Ga0307515_10002347
373 Ga0307515_10046619
374 Ga0307515_10236731
375 Ga0268256_1015629
376 Ga0307511_10001252
377 Ga0307511_10092459
378 Ga0307511_10127928
379 Ga0307512_10004438
380 Ga0307512_10097755
381 Ga0307512_10167782
382 Ga0307513_10001860
383 Ga0307509_10005745
384 Ga0307509_10008351
385 Ga0307509_10030438
386 Ga0307508_10016984
387 Ga0307514_10009413
388 Ga0307514_10031035
389 Ga0307514_10135270
390 Ga0307516_10062822
391 Ga0307516_10257268
392 Ga0307413_10439003
393 Ga0307518_10065674
394 Ga0307518_10082848
395 Ga0307416_100602528
396 Ga0307416_100866529
397 Ga0307507_10038003
398 Ga0307507_10117295
399 Ga0307510_10018695
400 Ga0307510_10050509
401 Ga0307510_10073212
402 Ga0307510_10087758
403 Ga0395901_0292134
404 Ga0439439_0000903
405 Ga0451853_1340935
406 Ga0439448_0003066
407 Ga0439432_022397
408 Ga0439449_0007540
409 Ga0439449_0039611
410 Ga0439455_0000131
411 Ga0439457_000728
412 Ga0439457_004776
413 Ga0439457_013445
414 Ga0450899_000667
415 Ga0450900_000378
416 Ga0450903_001795
417 Ga0450906_002726
418 Ga0450910_011161
419 Ga0439458_0002109
420 Ga0439458_0027039
421 Ga0450908_003359
422 Ga0450901_001251
423 Ga0466969_0111876
424 Ga0466972_0049366
425 Ga0466965_0005628
426 Ga0466965_0137935
427 Ga0466966_0163348
428 Ga0466961_0062445
429 Ga0466961_0199074
430 Ga0466963_0000365
431 Ga0466963_0116300
432 Ga0466964_0000783
433 Ga0466971_0000298
434 Ga0466970_0013879
435 Ga0466970_0036131
436 Ga0466970_0223685
437 Ga0466957_0000443
438 Ga0466960_0002012
439 Ga0466960_0038424
440 Ga0466959_0137079
441 Ga0466958_0018763
442 Ga0466967_0030023
443 Ga0466967_0063039
444 Ga0466967_0084436
445 Ga0495627_045038
446 Ga0495592_0020771
447 Ga0495603_0002709
448 Ga0495603_0003941
449 Ga0495603_0027088
450 Ga0495603_0031972
451 Ga0495603_0085496
452 Ga0495629_0004117
453 Ga0495629_0005006
454 Ga0495629_0008718
455 Ga0495629_0012497
456 Ga0495629_0016357
457 Ga0495629_0107291
458 Ga0495638_0084623
459 Ga0495651_0015960
460 Ga0495651_0187854
461 Ga0495582_0026052
462 Ga0495582_0062018
463 Ga0495605_0014591
464 Ga0495605_0113195
465 Ga0495639_0040526
466 Ga0495662_0010061
467 Ga0495662_0010485
468 Ga0495662_0087070
469 Ga0495664_0000960
470 Ga0495664_0108286
471 Ga0495584_0084735
472 Ga0495594_0000911
473 Ga0495594_0016103
474 Ga0495607_0048860
475 Ga0495607_0063281
476 Ga0495583_0021402
477 Ga0495583_0069197
478 Ga0495606_0021108
479 Ga0495616_0012908
480 Ga0495618_0016055
481 Ga0495620_0009673
482 Ga0495620_0019972
483 Ga0495620_0055617
484 Ga0495628_0290718
485 Ga0495630_0013116
486 Ga0495631_0021605
487 Ga0495643_0032498
488 Ga0495648_0015973
489 Ga0495666_0061654
490 Ga0495642_0024578
491 Ga0495652_0060536
492 Ga0495652_0194031
493 Ga0495654_0017876
494 Ga0495640_0002388
495 Ga0495640_0021800
496 Ga0495587_0014978
497 Ga0495609_0016724
498 Ga0495609_0115846
499 Ga0495597_0009932
500 Ga0495645_0058970
501 Ga0495645_0065780
502 Ga0495622_0001928
503 Ga0495622_0023476
504 Ga0495622_0040299
505 Ga0495668_0041838
506 Ga0495668_0252182
507 Ga0495634_0018959
508 Ga0495634_0079227
509 Ga0495625_0006051
510 Ga0495625_0067723
511 Ga0495635_0015985
512 Ga0495661_0087294
513 Ga0495588_0005063
514 Ga0495588_0014822
515 Ga0495588_0053590
516 Ga0495657_0006781
517 Ga0495657_0202432
518 Ga0495599_0110353
519 Ga0495623_0177847
520 Ga0495646_0000454
521 Ga0495613_0005010
522 Ga0495613_0009728
523 Ga0495613_0010674
524 Ga0495613_0017208
525 Ga0495613_0018497
526 Ga0495613_0030586
527 Ga0495624_0016395
528 Ga0495624_0194253
529 Ga0495671_0023447
530 Ga0495671_0076293
531 Ga0495671_0136100
532 Ga0495649_0021236
533 Ga0495649_0164316
534 Ga0495589_0012218
535 Ga0495589_0026399
536 Ga0495589_0044967
537 Ga0495660_0031321
538 Ga0495581_0012198
539 Ga0495604_0001619
540 Ga0495604_0142309
541 Ga0495636_0009747
542 Ga0495636_0151818
543 Ga0495674_0040172
544 Ga0495674_0242392
545 Ga0495672_0072946
546 Ga0495676_0003144
547 Ga0495676_0010896
548 Ga0495676_0016195
549 Ga0495676_0024573
550 Ga0495676_0203686
551 Ga0495683_0016723
552 Ga0495687_001423
553 Ga0495687_002514
554 Ga0495687_076906
555 Ga0495687_110516
556 Ga0495675_0172514
557 Ga0495677_0067327
558 Ga0495677_0076984
559 Ga0495685_001652
560 Ga0495685_008661
561 Ga0495685_011481
562 Ga0495685_016892
563 Ga0495685_052516
564 Ga0495681_0001891
565 Ga0495681_0031024
566 Ga0495686_0236990
567 Ga0495593_0015939
568 Ga0495593_0091968
569 Ga0495593_0145194
570 Ga0495602_0036599
571 Ga0495602_0181311
572 Ga0495614_0003030
573 Ga0495614_0008796
574 Ga0495614_0030370
575 Ga0495614_0043388
576 Ga0495614_0150917
577 Ga0496106_0038110
578 Ga0496108_0436767
579 Ga0496109_0003413
580 Ga0495678_012174
581 Ga0495682_0010879
582 Ga0501032_0084796
583 Ga0501032_0191337
584 Ga0501033_0000908
585 Ga0501033_0035371
586 Ga0501034_0002448
587 Ga0501034_0025134
588 Ga0501036_0004031
589 Ga0501036_0005336
590 Ga0501036_0181590
591 Ga0501036_0299613
592 Ga0501037_0044847
593 Ga0501037_0135573
594 Ga0501037_0178110
595 Ga0501038_0001803
596 Ga0501038_0019669
597 Ga0501038_0202906
598 Ga0501039_0019842
599 Ga0501039_0174805
600 Ga0501043_0001081
601 Ga0501043_0058945
602 Ga0501046_0083159
603 Ga0501047_0012912
604 Ga0501047_0021165
605 Ga0501047_0206142
606 Ga0501048_0006433
607 Ga0501048_0245382
608 Ga0501048_0247537
609 Ga0501069_0177049
610 Ga0501070_0013963
611 Ga0501070_0248374
612 Ga0501071_0471281
613 Ga0501073_0155292
614 Ga0501074_0001979
615 Ga0501080_0155937
616 Ga0501035_0000307
617 Ga0501035_0014009
618 Ga0501035_0015522
619 Ga0501035_0062968
620 Ga0501035_0404407
621 Ga0501044_0007527
622 Ga0501044_0027642
623 Ga0501044_0045739
624 nmdc:mga07m45_88938_c1
625 Ga0500644_0062318
626 Ga0500650_0050938
627 Ga0500560_001065
628 Ga0500624_007736
629 Ga0466962_0000225
630 Ga0466962_0023600
631 2990067098
632 2547406352
633 2554257724
634 2585297894
635 2585305398
636 2585312868
637 2616702314
638 2643900462
639 2643947487
640 2644268539
641 2644390387
642 2644405316
643 2644435179
644 2644437421
645 2644628176
646 2784589267
647 2785370313
648 2786671418
649 2808842837
650 2808921236
651 2809232881
652 2812357228
653 2812479907
654 2819700051
655 2852639882
656 2862182105
657 2862286493
658 2862296209
659 2862510128
660 2862578613
661 2863412133
662 2867429077
663 2873155144
664 2877680317
665 2912718951
666 2912724180
667 2918504817
668 2919471283
669 2946049190
670 2946068638
671 2946076638
672 2947228255
673 2954385350
674 2954677744
675 2954686410
676 2954696081
677 2954711253
678 2954715486
679 2954725404
680 2954736390
681 2954744340
682 2954755238
683 2954763312
684 2966602345
685 3006490410
686 3006500219
687 8008566006
688 8008578230
689 8023630054
690 8048410806
691 8056837788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

139

304

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.7513 26 288
6xyc-assembly1.cif.gz_A truncated form of carbohydrate esterase from gut microbiota 0.7504 20 289
4zrs-assembly1.cif.gz_B crystal structure of a cloned feruloyl esterase from a soil metagenomic library 0.743 10 289
4re6-assembly1.cif.gz_A acylaminoacyl peptidase complexed with a chloromethylketone inhibitor 0.7379 38 289
7bfr-assembly1.cif.gz_A thermogutta terrifontis esterase 2 phosphorylated by paraoxon 0.7296 27 287
ID Description Score Start End Superfamily
af_Q2G2V6_14_244_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7539 39 289 3.40.50.1820
af_B4FFC7_103_353_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7471 28 270 3.40.50.1820
af_I6Y9F7_131_400_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7359 29 289 3.40.50.1820
2z3wA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7335 38 289 3.40.50.1820
4re6B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7335 54 289 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6G3SR75-F1-model_v4 Alpha/beta hydrolase 0.9813 169 290 GO:0016787
AF-A0A3M8USA3-F1-model_v4 Alpha/beta hydrolase 0.9777 169 290 GO:0016787
AF-A0A6B2SDU7-F1-model_v4 Alpha/beta hydrolase 0.9772 180 290 GO:0016787
AF-A0A6I5GTP3-F1-model_v4 Alpha/beta hydrolase 0.9769 171 290 GO:0016787
AF-A0A6I5CZ98-F1-model_v4 deleted 0.9768 144 290

Map