F416563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 345 | 206 | 334 | 418 |
Family's Representative Sequence
| Representative Sequence | 3300050492|nmdc:mga0yw44_121991_c1|nmdc:mga0yw44_121991_c1_89_1342 |
| Length | 417 |
| Sequence | MSTNRDSHIRLTSHPNHRGPTRHPIRWDAPTAQERGPIIGTVTNPSERNAIGAHGGSYALYRALAVSSGALNPMARPDLTNTAPVIDIGPFPQWSEPGRIVSLDPWGARVASDFAKEISEGLDIRPTIAVTKARLTIPEFAARSQKWIDIDGDIVRAGGEIAVTKAAIDPVWYLPGIASRFNVSEDTLRRTLFEQTGGIYPELVTRPDLSVFLPPIGGITLYMFGDPAAVADPKRALTCRVHDECNGSDVFGSDICTCRPYLVHGIAECVKQAQHGGAGLIVYNRKEGRALGEVTKFLVYNARKRQEGGDQASTYFERTECVAGVQDARFQQLMPDVLHWLGITRIDRFVSMSNMKYEAIVNTGIQIVERVPIPDGLVPPDAQVELQAKMAAGYYTPDHAPTADELKSVVGRDLKEF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 2 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 3 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 4 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 5 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 6 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 7 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 8 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 9 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 10 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 74 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 133 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 134 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 143 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 144 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 147 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 154 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 155 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 156 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 161 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 162 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 182 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 183 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 184 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 185 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 196 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 197 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 198 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 199 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 200 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 201 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 202 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 203 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 206 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.81 |
| Metatranscriptomes | 0 |
| Isolates | 3.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.51 |
| Nodule | 0.87 |
| Rhizoplane | 11.3 |
| Rhizosphere | 72.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1005695 | 3300000549 | Bacteria | 1570 |
| 2 | JGI25153J46596_10001651 | 3300003215 | Bacteria | 13214 |
| 3 | Ga0055530_10000091 | 3300003791 | Bacteria | 78039 |
| 4 | Ga0065707_10120068 | 3300005295 | Bacteria | 2144 |
| 5 | Ga0070658_10000029 | 3300005327 | Bacteria | 156910 |
| 6 | Ga0070658_10091198 | 3300005327 | Bacteria | 2511 |
| 7 | Ga0070683_100041446 | 3300005329 | Bacteria | 4235 |
| 8 | Ga0070677_10000312 | 3300005333 | Bacteria | 16970 |
| 9 | Ga0070666_10056486 | 3300005335 | Bacteria | 2651 |
| 10 | Ga0070680_100004826 | 3300005336 | Bacteria | 10146 |
| 11 | Ga0070680_100007661 | 3300005336 | Bacteria | 8238 |
| 12 | Ga0070680_100013160 | 3300005336 | Bacteria | 6440 |
| 13 | Ga0068868_100000001 | 3300005338 | Bacteria | 282170 |
| 14 | Ga0070660_100000437 | 3300005339 | Bacteria | 27601 |
| 15 | Ga0070660_100007310 | 3300005339 | Bacteria | 7696 |
| 16 | Ga0070691_10007112 | 3300005341 | Bacteria | 5132 |
| 17 | Ga0070661_100001016 | 3300005344 | Bacteria | 19889 |
| 18 | Ga0070661_100130242 | 3300005344 | Bacteria | 1889 |
| 19 | Ga0070661_100145566 | 3300005344 | Bacteria | 1788 |
| 20 | Ga0070669_100131763 | 3300005353 | Bacteria | 1919 |
| 21 | Ga0070675_100004415 | 3300005354 | Bacteria | 10723 |
| 22 | Ga0070675_100053785 | 3300005354 | Bacteria | 3312 |
| 23 | Ga0070671_100012454 | 3300005355 | Bacteria | 6849 |
| 24 | Ga0070671_100114771 | 3300005355 | Bacteria | 2264 |
| 25 | Ga0070674_100006032 | 3300005356 | Bacteria | 7043 |
| 26 | Ga0070659_100000001 | 3300005366 | Bacteria | 576390 |
| 27 | Ga0070659_100000143 | 3300005366 | Bacteria | 55183 |
| 28 | Ga0070659_100000968 | 3300005366 | Bacteria | 21135 |
| 29 | Ga0070659_100007260 | 3300005366 | Bacteria | 8043 |
| 30 | Ga0070667_100033395 | 3300005367 | Unclassified | 4300 |
| 31 | Ga0070713_100083952 | 3300005436 | Bacteria | 2724 |
| 32 | Ga0070713_100125533 | 3300005436 | Bacteria | 2256 |
| 33 | Ga0070713_100284087 | 3300005436 | Bacteria | 1519 |
| 34 | Ga0070708_100018692 | 3300005445 | Bacteria | 5801 |
| 35 | Ga0070708_100059730 | 3300005445 | Bacteria | 3400 |
| 36 | Ga0070663_100055367 | 3300005455 | Bacteria | 2839 |
| 37 | Ga0070663_100094659 | 3300005455 | Bacteria | 2218 |
| 38 | Ga0070678_100002683 | 3300005456 | Bacteria | 9809 |
| 39 | Ga0070678_100053244 | 3300005456 | Bacteria | 2942 |
| 40 | Ga0070662_100021304 | 3300005457 | Bacteria | 4425 |
| 41 | Ga0070681_10004132 | 3300005458 | Bacteria | 13726 |
| 42 | Ga0070681_10009948 | 3300005458 | Bacteria | 9373 |
| 43 | Ga0070681_10025926 | 3300005458 | Bacteria | 5894 |
| 44 | Ga0070681_10032905 | 3300005458 | Bacteria | 5205 |
| 45 | Ga0070706_100037262 | 3300005467 | Bacteria | 4491 |
| 46 | Ga0070707_100009420 | 3300005468 | Bacteria | 9065 |
| 47 | Ga0070707_100255987 | 3300005468 | Bacteria | 1703 |
| 48 | Ga0070698_100011791 | 3300005471 | Bacteria | 9274 |
| 49 | Ga0070699_100040986 | 3300005518 | Bacteria | 4007 |
| 50 | Ga0070679_100000005 | 3300005530 | Bacteria | 263201 |
| 51 | Ga0070679_100016698 | 3300005530 | Bacteria | 7091 |
| 52 | Ga0070679_100033350 | 3300005530 | Bacteria | 5098 |
| 53 | Ga0070697_100009354 | 3300005536 | Bacteria | 7657 |
| 54 | Ga0070686_100000252 | 3300005544 | Bacteria | 36805 |
| 55 | Ga0070693_100079284 | 3300005547 | Bacteria | 1954 |
| 56 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 57 | Ga0070665_100000144 | 3300005548 | Bacteria | 132302 |
| 58 | Ga0070665_100000265 | 3300005548 | Bacteria | 85729 |
| 59 | Ga0070665_100000939 | 3300005548 | Bacteria | 37232 |
| 60 | Ga0070665_100006429 | 3300005548 | Bacteria | 11958 |
| 61 | Ga0070665_100024545 | 3300005548 | Bacteria | 6074 |
| 62 | Ga0070665_100317608 | 3300005548 | Bacteria | 1562 |
| 63 | Ga0068855_100016452 | 3300005563 | Bacteria | 8893 |
| 64 | Ga0068859_100003874 | 3300005617 | Bacteria | 15281 |
| 65 | Ga0068864_100000257 | 3300005618 | Bacteria | 47415 |
| 66 | Ga0068861_100024556 | 3300005719 | Bacteria | 4360 |
| 67 | Ga0068863_100000167 | 3300005841 | Bacteria | 70943 |
| 68 | Ga0068863_100001641 | 3300005841 | Bacteria | 22133 |
| 69 | Ga0068863_100083990 | 3300005841 | Bacteria | 3018 |
| 70 | Ga0068858_100000198 | 3300005842 | Bacteria | 64645 |
| 71 | Ga0068858_100003849 | 3300005842 | Bacteria | 14837 |
| 72 | Ga0068860_100009293 | 3300005843 | Bacteria | 9768 |
| 73 | Ga0068860_100016085 | 3300005843 | Bacteria | 7298 |
| 74 | Ga0081455_10001615 | 3300005937 | Bacteria | 27557 |
| 75 | Ga0081455_10021725 | 3300005937 | Bacteria | 6011 |
| 76 | Ga0081539_10001495 | 3300005985 | Bacteria | 39548 |
| 77 | Ga0070717_10189291 | 3300006028 | Bacteria | 1797 |
| 78 | Ga0070715_10055098 | 3300006163 | Bacteria | 1724 |
| 79 | Ga0070712_100021870 | 3300006175 | Bacteria | 4207 |
| 80 | Ga0070712_100089267 | 3300006175 | Bacteria | 2254 |
| 81 | Ga0075428_100054776 | 3300006844 | Bacteria | 4370 |
| 82 | Ga0075428_100188296 | 3300006844 | Bacteria | 2232 |
| 83 | Ga0097620_100003874 | 3300006931 | Bacteria | 15281 |
| 84 | Ga0099794_10005140 | 3300007265 | Bacteria | 5223 |
| 85 | Ga0105250_10028014 | 3300009092 | Bacteria | 2269 |
| 86 | Ga0105240_10012470 | 3300009093 | Bacteria | 11727 |
| 87 | Ga0105240_10046538 | 3300009093 | Bacteria | 5496 |
| 88 | Ga0105240_10169945 | 3300009093 | Bacteria | 2583 |
| 89 | Ga0111539_10457418 | 3300009094 | Bacteria | 1486 |
| 90 | Ga0105245_10123482 | 3300009098 | Bacteria | 2421 |
| 91 | Ga0114129_10255978 | 3300009147 | Bacteria | 2348 |
| 92 | Ga0114129_10429386 | 3300009147 | Bacteria | 1736 |
| 93 | Ga0105243_10166102 | 3300009148 | Bacteria | 1907 |
| 94 | Ga0105248_10000489 | 3300009177 | Bacteria | 45002 |
| 95 | Ga0105248_10009341 | 3300009177 | Bacteria | 10796 |
| 96 | Ga0105238_10102617 | 3300009551 | Bacteria | 2841 |
| 97 | Ga0105238_10172571 | 3300009551 | Bacteria | 2139 |
| 98 | Ga0105239_10018257 | 3300010375 | Bacteria | 7755 |
| 99 | Ga0157375_10121012 | 3300013308 | Bacteria | 2727 |
| 100 | Ga0157375_10130655 | 3300013308 | Bacteria | 2630 |
| 101 | Ga0163163_10184536 | 3300014325 | Bacteria | 2134 |
| 102 | Ga0163163_10211032 | 3300014325 | Bacteria | 1991 |
| 103 | Ga0157379_10031450 | 3300014968 | Bacteria | 4728 |
| 104 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 105 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 106 | Ga0213876_10000217 | 3300021384 | Bacteria | 57767 |
| 107 | Ga0213876_10003872 | 3300021384 | Bacteria | 8458 |
| 108 | Ga0213876_10012866 | 3300021384 | Bacteria | 4449 |
| 109 | Ga0213876_10031924 | 3300021384 | Bacteria | 2778 |
| 110 | Ga0213875_10000011 | 3300021388 | Bacteria | 332447 |
| 111 | Ga0213875_10001172 | 3300021388 | Bacteria | 17976 |
| 112 | Ga0209026_1007229 | 3300025250 | Bacteria | 2545 |
| 113 | Ga0209758_1000217 | 3300025297 | Bacteria | 124619 |
| 114 | Ga0209758_1002042 | 3300025297 | Bacteria | 21647 |
| 115 | Ga0209758_1005471 | 3300025297 | Bacteria | 9758 |
| 116 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 117 | Ga0207426_1028672 | 3300025302 | Bacteria | 1843 |
| 118 | Ga0209257_1000271 | 3300025304 | Bacteria | 118632 |
| 119 | Ga0207697_10054875 | 3300025315 | Bacteria | 1651 |
| 120 | Ga0207682_10000533 | 3300025893 | Bacteria | 17501 |
| 121 | Ga0207682_10057623 | 3300025893 | Bacteria | 1620 |
| 122 | Ga0207710_10000861 | 3300025900 | Bacteria | 16327 |
| 123 | Ga0207688_10037649 | 3300025901 | Bacteria | 2684 |
| 124 | Ga0207645_10029447 | 3300025907 | Bacteria | 3540 |
| 125 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 126 | Ga0207705_10003884 | 3300025909 | Bacteria | 11370 |
| 127 | Ga0207684_10022465 | 3300025910 | Bacteria | 5384 |
| 128 | Ga0207684_10120508 | 3300025910 | Bacteria | 2249 |
| 129 | Ga0207654_10009330 | 3300025911 | Bacteria | 4980 |
| 130 | Ga0207707_10003322 | 3300025912 | Bacteria | 14290 |
| 131 | Ga0207707_10008145 | 3300025912 | Bacteria | 9097 |
| 132 | Ga0207707_10040713 | 3300025912 | Bacteria | 4058 |
| 133 | Ga0207695_10003032 | 3300025913 | Bacteria | 24100 |
| 134 | Ga0207695_10007406 | 3300025913 | Bacteria | 13985 |
| 135 | Ga0207695_10066465 | 3300025913 | Bacteria | 3702 |
| 136 | Ga0207671_10073980 | 3300025914 | Bacteria | 2546 |
| 137 | Ga0207671_10213235 | 3300025914 | Bacteria | 1511 |
| 138 | Ga0207693_10022458 | 3300025915 | Bacteria | 5014 |
| 139 | Ga0207693_10025163 | 3300025915 | Bacteria | 4721 |
| 140 | Ga0207693_10072296 | 3300025915 | Bacteria | 2701 |
| 141 | Ga0207660_10005447 | 3300025917 | Bacteria | 8259 |
| 142 | Ga0207660_10018746 | 3300025917 | Bacteria | 4619 |
| 143 | Ga0207660_10027484 | 3300025917 | Bacteria | 3883 |
| 144 | Ga0207662_10050811 | 3300025918 | Bacteria | 2465 |
| 145 | Ga0207657_10002491 | 3300025919 | Bacteria | 19909 |
| 146 | Ga0207657_10010246 | 3300025919 | Bacteria | 9364 |
| 147 | Ga0207657_10013159 | 3300025919 | Bacteria | 8123 |
| 148 | Ga0207657_10185010 | 3300025919 | Bacteria | 1682 |
| 149 | Ga0207649_10000106 | 3300025920 | Bacteria | 69452 |
| 150 | Ga0207649_10058140 | 3300025920 | Bacteria | 2420 |
| 151 | Ga0207649_10144205 | 3300025920 | Bacteria | 1633 |
| 152 | Ga0207652_10000036 | 3300025921 | Bacteria | 134949 |
| 153 | Ga0207652_10006620 | 3300025921 | Bacteria | 9338 |
| 154 | Ga0207652_10011908 | 3300025921 | Bacteria | 7017 |
| 155 | Ga0207646_10005677 | 3300025922 | Bacteria | 13087 |
| 156 | Ga0207646_10251922 | 3300025922 | Bacteria | 1595 |
| 157 | Ga0207650_10032603 | 3300025925 | Bacteria | 3768 |
| 158 | Ga0207659_10138602 | 3300025926 | Bacteria | 1886 |
| 159 | Ga0207659_10164139 | 3300025926 | Bacteria | 1747 |
| 160 | Ga0207659_10177617 | 3300025926 | Bacteria | 1684 |
| 161 | Ga0207664_10092391 | 3300025929 | Bacteria | 2484 |
| 162 | Ga0207644_10010597 | 3300025931 | Bacteria | 6078 |
| 163 | Ga0207644_10019606 | 3300025931 | Unclassified | 4590 |
| 164 | Ga0207690_10000018 | 3300025932 | Bacteria | 238992 |
| 165 | Ga0207690_10000283 | 3300025932 | Bacteria | 36051 |
| 166 | Ga0207690_10002077 | 3300025932 | Bacteria | 12273 |
| 167 | Ga0207690_10031232 | 3300025932 | Bacteria | 3406 |
| 168 | Ga0207706_10023646 | 3300025933 | Bacteria | 5517 |
| 169 | Ga0207706_10030469 | 3300025933 | Bacteria | 4811 |
| 170 | Ga0207706_10138678 | 3300025933 | Bacteria | 2139 |
| 171 | Ga0207709_10088079 | 3300025935 | Bacteria | 2020 |
| 172 | Ga0207669_10015295 | 3300025937 | Bacteria | 3867 |
| 173 | Ga0207704_10001720 | 3300025938 | Bacteria | 9796 |
| 174 | Ga0207665_10174697 | 3300025939 | Bacteria | 1553 |
| 175 | Ga0207691_10005669 | 3300025940 | Bacteria | 12069 |
| 176 | Ga0207711_10001294 | 3300025941 | Bacteria | 23722 |
| 177 | Ga0207711_10025144 | 3300025941 | Bacteria | 4996 |
| 178 | Ga0207711_10037098 | 3300025941 | Bacteria | 4138 |
| 179 | Ga0207711_10072708 | 3300025941 | Bacteria | 2987 |
| 180 | Ga0207661_10049557 | 3300025944 | Bacteria | 3343 |
| 181 | Ga0207661_10265926 | 3300025944 | Bacteria | 1529 |
| 182 | Ga0207667_10066555 | 3300025949 | Bacteria | 3755 |
| 183 | Ga0207712_10006854 | 3300025961 | Bacteria | 7191 |
| 184 | Ga0207668_10011930 | 3300025972 | Bacteria | 5302 |
| 185 | Ga0207668_10175855 | 3300025972 | Bacteria | 1683 |
| 186 | Ga0207658_10002499 | 3300025986 | Bacteria | 13396 |
| 187 | Ga0207677_10000024 | 3300026023 | Bacteria | 127407 |
| 188 | Ga0207703_10000189 | 3300026035 | Bacteria | 72189 |
| 189 | Ga0207703_10003511 | 3300026035 | Bacteria | 13115 |
| 190 | Ga0207703_10061776 | 3300026035 | Bacteria | 3068 |
| 191 | Ga0207678_10068879 | 3300026067 | Bacteria | 3035 |
| 192 | Ga0207641_10000120 | 3300026088 | Bacteria | 116070 |
| 193 | Ga0207641_10006678 | 3300026088 | Bacteria | 9679 |
| 194 | Ga0207641_10011694 | 3300026088 | Bacteria | 7206 |
| 195 | Ga0207648_10017971 | 3300026089 | Bacteria | 6413 |
| 196 | Ga0207676_10000424 | 3300026095 | Bacteria | 35638 |
| 197 | Ga0207674_10164084 | 3300026116 | Bacteria | 2176 |
| 198 | Ga0207683_10000755 | 3300026121 | Bacteria | 29385 |
| 199 | Ga0207683_10024201 | 3300026121 | Bacteria | 5227 |
| 200 | Ga0207683_10075026 | 3300026121 | Bacteria | 2993 |
| 201 | Ga0207428_10025214 | 3300027907 | Bacteria | 4978 |
| 202 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 203 | Ga0268266_10000063 | 3300028379 | Bacteria | 253339 |
| 204 | Ga0268266_10000592 | 3300028379 | Bacteria | 49766 |
| 205 | Ga0268266_10007933 | 3300028379 | Bacteria | 9499 |
| 206 | Ga0268266_10041823 | 3300028379 | Bacteria | 3912 |
| 207 | Ga0268266_10126621 | 3300028379 | Bacteria | 2280 |
| 208 | Ga0268264_10019593 | 3300028381 | Bacteria | 5527 |
| 209 | Ga0268264_10183883 | 3300028381 | Unclassified | 1900 |
| 210 | Ga0265334_10007691 | 3300028573 | Bacteria | 4615 |
| 211 | Ga0265318_10002314 | 3300028577 | Bacteria | 10231 |
| 212 | Ga0265323_10001191 | 3300028653 | Bacteria | 13249 |
| 213 | Ga0265336_10000091 | 3300028666 | Bacteria | 69365 |
| 214 | Ga0307517_10000235 | 3300028786 | Bacteria | 93944 |
| 215 | Ga0265338_10000094 | 3300028800 | Bacteria | 168366 |
| 216 | Ga0265324_10011294 | 3300029957 | Bacteria | 3408 |
| 217 | Ga0307511_10000937 | 3300030521 | Bacteria | 30868 |
| 218 | Ga0265325_10004144 | 3300031241 | Bacteria | 9218 |
| 219 | Ga0307509_10000003 | 3300031507 | Bacteria | 577578 |
| 220 | Ga0307408_100075879 | 3300031548 | Bacteria | 2499 |
| 221 | Ga0307405_10113796 | 3300031731 | Bacteria | 1838 |
| 222 | Ga0307405_10145320 | 3300031731 | Bacteria | 1660 |
| 223 | Ga0307413_10049587 | 3300031824 | Bacteria | 2517 |
| 224 | Ga0307413_10065900 | 3300031824 | Bacteria | 2257 |
| 225 | Ga0307410_10040236 | 3300031852 | Bacteria | 3075 |
| 226 | Ga0307409_100037173 | 3300031995 | Bacteria | 3587 |
| 227 | Ga0307411_10042769 | 3300032005 | Bacteria | 2894 |
| 228 | Ga0307411_10043179 | 3300032005 | Bacteria | 2883 |
| 229 | Ga0307411_10147990 | 3300032005 | Bacteria | 1741 |
| 230 | Ga0307411_10222800 | 3300032005 | Bacteria | 1464 |
| 231 | Ga0307415_100016602 | 3300032126 | Bacteria | 4393 |
| 232 | Ga0307415_100074296 | 3300032126 | Bacteria | 2402 |
| 233 | Ga0307510_10013610 | 3300033180 | Bacteria | 9646 |
| 234 | Ga0373946_0014163 | 3300035171 | Bacteria | 3005 |
| 235 | Ga0373931_0002608 | 3300035691 | Bacteria | 8026 |
| 236 | Ga0373931_0057854 | 3300035691 | Bacteria | 2080 |
| 237 | Ga0373935_0014691 | 3300035692 | Bacteria | 4726 |
| 238 | Ga0373927_0000155 | 3300035695 | Bacteria | 53529 |
| 239 | Ga0373927_0139703 | 3300035695 | Bacteria | 1584 |
| 240 | Ga0373947_0135902 | 3300035725 | Bacteria | 1573 |
| 241 | Ga0373947_0190731 | 3300035725 | Bacteria | 1337 |
| 242 | Ga0373925_0000050 | 3300037068 | Bacteria | 127678 |
| 243 | Ga0373925_0074277 | 3300037068 | Bacteria | 2575 |
| 244 | Ga0395898_0008597 | 3300037466 | Bacteria | 10775 |
| 245 | Ga0395905_0148897 | 3300037471 | Bacteria | 2202 |
| 246 | Ga0395905_0173888 | 3300037471 | Bacteria | 2022 |
| 247 | Ga0436364_0622718 | 3300037853 | Bacteria | 37563 |
| 248 | Ga0436364_0883536 | 3300037853 | Bacteria | 58970 |
| 249 | Ga0436365_0862833 | 3300039437 | Bacteria | 88455 |
| 250 | Ga0436365_1095116 | 3300039437 | Bacteria | 3910 |
| 251 | Ga0436365_1189040 | 3300039437 | Bacteria | 29791 |
| 252 | Ga0436365_1259102 | 3300039437 | Bacteria | 59061 |
| 253 | Ga0436360_1222596 | 3300039438 | Bacteria | 1408 |
| 254 | Ga0436363_0387523 | 3300039450 | Bacteria | 1770 |
| 255 | Ga0436362_0949954 | 3300039453 | Bacteria | 89092 |
| 256 | Ga0466969_0005562 | 3300044656 | Bacteria | 6701 |
| 257 | Ga0466966_0002380 | 3300044684 | Bacteria | 12282 |
| 258 | Ga0466961_0005117 | 3300044693 | Bacteria | 8253 |
| 259 | Ga0466963_0217495 | 3300044694 | Bacteria | 1338 |
| 260 | Ga0466964_0001940 | 3300044706 | Bacteria | 7245 |
| 261 | Ga0466970_0011980 | 3300044765 | Bacteria | 4426 |
| 262 | Ga0466957_0005029 | 3300044842 | Bacteria | 7402 |
| 263 | Ga0495603_0024477 | 3300046455 | Bacteria | 3651 |
| 264 | Ga0495644_0060955 | 3300046523 | Bacteria | 1418 |
| 265 | Ga0495668_0064252 | 3300046616 | Bacteria | 2021 |
| 266 | Ga0495669_0001626 | 3300046684 | Bacteria | 9228 |
| 267 | Ga0496100_0001424 | 3300048903 | Bacteria | 11698 |
| 268 | Ga0496101_0003301 | 3300048904 | Bacteria | 10039 |
| 269 | Ga0496101_0059353 | 3300048904 | Bacteria | 2772 |
| 270 | Ga0496102_0004527 | 3300048905 | Bacteria | 11748 |
| 271 | Ga0496102_0127544 | 3300048905 | Bacteria | 2379 |
| 272 | Ga0496103_0045817 | 3300048906 | Bacteria | 2699 |
| 273 | Ga0496104_0016626 | 3300048907 | Bacteria | 6686 |
| 274 | Ga0496104_0031776 | 3300048907 | Bacteria | 4911 |
| 275 | Ga0496104_0258406 | 3300048907 | Bacteria | 1655 |
| 276 | Ga0496105_0020513 | 3300048908 | Bacteria | 5341 |
| 277 | Ga0496105_0043069 | 3300048908 | Bacteria | 3723 |
| 278 | Ga0496105_0158547 | 3300048908 | Bacteria | 1858 |
| 279 | Ga0496106_0021256 | 3300048909 | Bacteria | 4818 |
| 280 | Ga0496106_0025932 | 3300048909 | Bacteria | 4360 |
| 281 | Ga0496106_0122188 | 3300048909 | Bacteria | 2036 |
| 282 | Ga0496107_0009209 | 3300048910 | Bacteria | 6842 |
| 283 | Ga0496107_0142707 | 3300048910 | Bacteria | 1770 |
| 284 | Ga0496108_0046267 | 3300048911 | Bacteria | 3635 |
| 285 | Ga0496108_0130426 | 3300048911 | Bacteria | 2161 |
| 286 | Ga0496108_0133318 | 3300048911 | Bacteria | 2135 |
| 287 | Ga0496109_0015946 | 3300048912 | Bacteria | 6563 |
| 288 | Ga0496109_0040197 | 3300048912 | Bacteria | 4235 |
| 289 | Ga0496109_0041321 | 3300048912 | Bacteria | 4177 |
| 290 | Ga0496109_0046107 | 3300048912 | Bacteria | 3958 |
| 291 | Ga0496109_0254023 | 3300048912 | Bacteria | 1655 |
| 292 | Ga0496110_0000935 | 3300048913 | Bacteria | 20529 |
| 293 | Ga0496110_0003779 | 3300048913 | Bacteria | 11663 |
| 294 | Ga0496110_0018818 | 3300048913 | Bacteria | 5800 |
| 295 | Ga0496110_0211544 | 3300048913 | Bacteria | 1763 |
| 296 | Ga0496111_0107641 | 3300048914 | Bacteria | 2052 |
| 297 | Ga0496112_0027672 | 3300048915 | Bacteria | 5468 |
| 298 | Ga0496112_0071174 | 3300048915 | Bacteria | 3437 |
| 299 | Ga0496113_0003554 | 3300048916 | Bacteria | 9353 |
| 300 | Ga0496113_0013045 | 3300048916 | Bacteria | 5610 |
| 301 | Ga0496114_0017451 | 3300048917 | Bacteria | 5792 |
| 302 | Ga0496115_0000562 | 3300048918 | Bacteria | 28823 |
| 303 | Ga0496115_0001274 | 3300048918 | Bacteria | 18022 |
| 304 | Ga0496115_0003355 | 3300048918 | Bacteria | 11493 |
| 305 | Ga0496115_0016550 | 3300048918 | Bacteria | 5618 |
| 306 | Ga0496118_0011991 | 3300048921 | Bacteria | 8376 |
| 307 | Ga0496119_0005547 | 3300048922 | Bacteria | 12012 |
| 308 | Ga0496121_0000053 | 3300048924 | Bacteria | 312611 |
| 309 | Ga0496121_0009984 | 3300048924 | Bacteria | 10794 |
| 310 | Ga0496121_0085820 | 3300048924 | Bacteria | 2476 |
| 311 | Ga0496125_0000090 | 3300048928 | Bacteria | 214433 |
| 312 | Ga0496125_0000877 | 3300048928 | Bacteria | 47865 |
| 313 | Ga0496126_0002898 | 3300048929 | Bacteria | 22361 |
| 314 | Ga0496126_0058883 | 3300048929 | Bacteria | 3462 |
| 315 | Ga0501047_0000771 | 3300049581 | Bacteria | 33529 |
| 316 | Ga0501047_0083006 | 3300049581 | Bacteria | 3080 |
| 317 | Ga0501044_0001492 | 3300049823 | Bacteria | 27394 |
| 318 | nmdc:mga0yw44_121991_c1 | 3300050492 | Bacteria | 1679 |
| 319 | nmdc:mga0yw44_129829_c1 | 3300050492 | Bacteria | 1630 |
| 320 | nmdc:mga05p37_296602_c1 | 3300050507 | Bacteria | 1922 |
| 321 | nmdc:mga0n895_139276_c1 | 3300050512 | Bacteria | 2454 |
| 322 | nmdc:mga0rr50_142659_c1 | 3300050513 | Bacteria | 1928 |
| 323 | Ga0495601_0037592 | 3300053077 | Bacteria | 3027 |
| 324 | Ga0495601_0055809 | 3300053077 | Bacteria | 2501 |
| 325 | Ga0500651_0057201 | 3300053093 | Bacteria | 2441 |
| 326 | Ga0500555_003662 | 3300053103 | Bacteria | 4374 |
| 327 | Ga0500562_001102 | 3300053108 | Bacteria | 6638 |
| 328 | Ga0500595_002066 | 3300053119 | Bacteria | 10256 |
| 329 | Ga0500652_000002 | 3300053131 | Bacteria | 273315 |
| 330 | Ga0500655_009436 | 3300053133 | Bacteria | 1760 |
| 331 | Ga0500577_0000038 | 3300053142 | Bacteria | 29648 |
| 332 | Ga0500634_0078890 | 3300053161 | Bacteria | 1702 |
| 333 | Ga0500637_0001638 | 3300053178 | Bacteria | 9615 |
| 334 | Ga0501082_0000074 | 3300060353 | Bacteria | 73246 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007265 | Ga0099794_10005140 | Ga0099794_100051405 | 370 |
| 2 | 3300035725 | Ga0373947_0190731 | Ga0373947_0190731_42_1232 | 396 |
| 3 | 3300005295 | Ga0065707_10120068 | Ga0065707_101200682 | 397 |
| 4 | 3300025926 | Ga0207659_10138602 | Ga0207659_101386021 | 397 |
| 5 | 3300025913 | Ga0207695_10003032 | Ga0207695_1000303219 | 400 |
| 6 | 3300030521 | Ga0307511_10000937 | Ga0307511_1000093728 | 406 |
| 7 | 3300053178 | Ga0500637_0001638 | Ga0500637_0001638_253_1515 | 406 |
| 8 | 3300025297 | Ga0209758_1002042 | Ga0209758_10020425 | 408 |
| 9 | 3300025910 | Ga0207684_10120508 | Ga0207684_101205081 | 409 |
| 10 | 3300025939 | Ga0207665_10174697 | Ga0207665_101746971 | 409 |
| 11 | iso_pu_bacteria | 8006984368 | 8006989575 | 412 |
| 12 | iso_pu_bacteria | 8054563764 | 8054564420 | 412 |
| 13 | iso_pu_bacteria | 2643221699 | 2644549819 | 413 |
| 14 | 3300025944 | Ga0207661_10265926 | Ga0207661_102659261 | 414 |
| 15 | 3300048907 | Ga0496104_0258406 | Ga0496104_0258406_124_1368 | 414 |
| 16 | iso_pu_bacteria | 2513237139 | 2513875143 | 414 |
| 17 | iso_pu_bacteria | 2802429603 | 2805919513 | 414 |
| 18 | iso_pu_bacteria | 2824696289 | 2824699969 | 414 |
| 19 | iso_pu_bacteria | 2847939898 | 2847943698 | 414 |
| 20 | iso_pu_bacteria | 2881364244 | 2881371307 | 414 |
| 21 | 3300003215 | JGI25153J46596_10001651 | JGI25153J46596_100016512 | 415 |
| 22 | 3300025297 | Ga0209758_1005471 | Ga0209758_10054715 | 415 |
| 23 | 3300025920 | Ga0207649_10144205 | Ga0207649_101442052 | 415 |
| 24 | 3300039438 | Ga0436360_1222596 | Ga0436360_1222596_128_1381 | 415 |
| 25 | 3300044656 | Ga0466969_0005562 | Ga0466969_0005562_333_1580 | 415 |
| 26 | 3300044684 | Ga0466966_0002380 | Ga0466966_0002380_10946_12193 | 415 |
| 27 | 3300044693 | Ga0466961_0005117 | Ga0466961_0005117_4864_6111 | 415 |
| 28 | 3300044706 | Ga0466964_0001940 | Ga0466964_0001940_2244_3491 | 415 |
| 29 | 3300044765 | Ga0466970_0011980 | Ga0466970_0011980_1131_2378 | 415 |
| 30 | 3300044842 | Ga0466957_0005029 | Ga0466957_0005029_2848_4095 | 415 |
| 31 | iso_pu_bacteria | 2894232714 | 2894236129 | 415 |
| 32 | iso_pu_bacteria | 2917554339 | 2917554542 | 415 |
| 33 | iso_pu_bacteria | 2939669807 | 2939673603 | 415 |
| 34 | 3300005344 | Ga0070661_100145566 | Ga0070661_1001455662 | 416 |
| 35 | 3300005436 | Ga0070713_100125533 | Ga0070713_1001255332 | 416 |
| 36 | 3300005455 | Ga0070663_100055367 | Ga0070663_1000553672 | 416 |
| 37 | 3300005455 | Ga0070663_100094659 | Ga0070663_1000946592 | 416 |
| 38 | 3300005456 | Ga0070678_100053244 | Ga0070678_1000532442 | 416 |
| 39 | 3300005548 | Ga0070665_100024545 | Ga0070665_1000245454 | 416 |
| 40 | 3300005618 | Ga0068864_100000257 | Ga0068864_1000002578 | 416 |
| 41 | 3300005719 | Ga0068861_100024556 | Ga0068861_1000245563 | 416 |
| 42 | 3300005841 | Ga0068863_100000167 | Ga0068863_10000016735 | 416 |
| 43 | 3300005842 | Ga0068858_100000198 | Ga0068858_10000019825 | 416 |
| 44 | 3300005937 | Ga0081455_10021725 | Ga0081455_100217252 | 416 |
| 45 | 3300006163 | Ga0070715_10055098 | Ga0070715_100550982 | 416 |
| 46 | 3300006844 | Ga0075428_100054776 | Ga0075428_1000547762 | 416 |
| 47 | 3300009092 | Ga0105250_10028014 | Ga0105250_100280142 | 416 |
| 48 | 3300009094 | Ga0111539_10457418 | Ga0111539_104574181 | 416 |
| 49 | 3300009098 | Ga0105245_10123482 | Ga0105245_101234821 | 416 |
| 50 | 3300009147 | Ga0114129_10255978 | Ga0114129_102559782 | 416 |
| 51 | 3300009148 | Ga0105243_10166102 | Ga0105243_101661021 | 416 |
| 52 | 3300009177 | Ga0105248_10009341 | Ga0105248_1000934112 | 416 |
| 53 | 3300013308 | Ga0157375_10121012 | Ga0157375_101210122 | 416 |
| 54 | 3300014325 | Ga0163163_10211032 | Ga0163163_102110322 | 416 |
| 55 | 3300014968 | Ga0157379_10031450 | Ga0157379_100314504 | 416 |
| 56 | 3300021384 | Ga0213876_10031924 | Ga0213876_100319242 | 416 |
| 57 | 3300021388 | Ga0213875_10000011 | Ga0213875_10000011231 | 416 |
| 58 | 3300025315 | Ga0207697_10054875 | Ga0207697_100548751 | 416 |
| 59 | 3300025901 | Ga0207688_10037649 | Ga0207688_100376492 | 416 |
| 60 | 3300025907 | Ga0207645_10029447 | Ga0207645_100294472 | 416 |
| 61 | 3300025911 | Ga0207654_10009330 | Ga0207654_100093302 | 416 |
| 62 | 3300025914 | Ga0207671_10073980 | Ga0207671_100739803 | 416 |
| 63 | 3300025918 | Ga0207662_10050811 | Ga0207662_100508112 | 416 |
| 64 | 3300025920 | Ga0207649_10058140 | Ga0207649_100581402 | 416 |
| 65 | 3300025933 | Ga0207706_10030469 | Ga0207706_100304694 | 416 |
| 66 | 3300025933 | Ga0207706_10138678 | Ga0207706_101386782 | 416 |
| 67 | 3300025941 | Ga0207711_10025144 | Ga0207711_100251443 | 416 |
| 68 | 3300025941 | Ga0207711_10037098 | Ga0207711_100370982 | 416 |
| 69 | 3300025972 | Ga0207668_10175855 | Ga0207668_101758551 | 416 |
| 70 | 3300026035 | Ga0207703_10000189 | Ga0207703_1000018932 | 416 |
| 71 | 3300026035 | Ga0207703_10061776 | Ga0207703_100617762 | 416 |
| 72 | 3300026067 | Ga0207678_10068879 | Ga0207678_100688792 | 416 |
| 73 | 3300026088 | Ga0207641_10000120 | Ga0207641_1000012070 | 416 |
| 74 | 3300026095 | Ga0207676_10000424 | Ga0207676_1000042432 | 416 |
| 75 | 3300026116 | Ga0207674_10164084 | Ga0207674_101640843 | 416 |
| 76 | 3300026121 | Ga0207683_10075026 | Ga0207683_100750262 | 416 |
| 77 | 3300028379 | Ga0268266_10007933 | Ga0268266_100079338 | 416 |
| 78 | 3300028379 | Ga0268266_10041823 | Ga0268266_100418233 | 416 |
| 79 | 3300028379 | Ga0268266_10126621 | Ga0268266_101266212 | 416 |
| 80 | 3300028786 | Ga0307517_10000235 | Ga0307517_1000023578 | 416 |
| 81 | 3300031241 | Ga0265325_10004144 | Ga0265325_100041444 | 416 |
| 82 | 3300031731 | Ga0307405_10113796 | Ga0307405_101137961 | 416 |
| 83 | 3300031824 | Ga0307413_10049587 | Ga0307413_100495872 | 416 |
| 84 | 3300031995 | Ga0307409_100037173 | Ga0307409_1000371732 | 416 |
| 85 | 3300032005 | Ga0307411_10043179 | Ga0307411_100431793 | 416 |
| 86 | 3300032005 | Ga0307411_10222800 | Ga0307411_102228001 | 416 |
| 87 | 3300032126 | Ga0307415_100016602 | Ga0307415_1000166023 | 416 |
| 88 | 3300033180 | Ga0307510_10013610 | Ga0307510_100136102 | 416 |
| 89 | 3300035692 | Ga0373935_0014691 | Ga0373935_0014691_1371_2621 | 416 |
| 90 | 3300035695 | Ga0373927_0139703 | Ga0373927_0139703_307_1557 | 416 |
| 91 | 3300035725 | Ga0373947_0135902 | Ga0373947_0135902_59_1309 | 416 |
| 92 | 3300037853 | Ga0436364_0622718 | Ga0436364_0622718_4788_6038 | 416 |
| 93 | 3300046455 | Ga0495603_0024477 | Ga0495603_0024477_1360_2610 | 416 |
| 94 | 3300046523 | Ga0495644_0060955 | Ga0495644_0060955_109_1359 | 416 |
| 95 | 3300046684 | Ga0495669_0001626 | Ga0495669_0001626_1417_2667 | 416 |
| 96 | 3300048903 | Ga0496100_0001424 | Ga0496100_0001424_7541_8791 | 416 |
| 97 | 3300048904 | Ga0496101_0003301 | Ga0496101_0003301_6105_7355 | 416 |
| 98 | 3300048905 | Ga0496102_0127544 | Ga0496102_0127544_438_1688 | 416 |
| 99 | 3300048906 | Ga0496103_0045817 | Ga0496103_0045817_810_2060 | 416 |
| 100 | 3300048907 | Ga0496104_0016626 | Ga0496104_0016626_1716_2966 | 416 |
| 101 | 3300048908 | Ga0496105_0020513 | Ga0496105_0020513_2384_3634 | 416 |
| 102 | 3300048908 | Ga0496105_0043069 | Ga0496105_0043069_775_2025 | 416 |
| 103 | 3300048908 | Ga0496105_0158547 | Ga0496105_0158547_159_1409 | 416 |
| 104 | 3300048909 | Ga0496106_0025932 | Ga0496106_0025932_344_1594 | 416 |
| 105 | 3300048909 | Ga0496106_0122188 | Ga0496106_0122188_611_1861 | 416 |
| 106 | 3300048910 | Ga0496107_0009209 | Ga0496107_0009209_427_1677 | 416 |
| 107 | 3300048911 | Ga0496108_0046267 | Ga0496108_0046267_643_1893 | 416 |
| 108 | 3300048911 | Ga0496108_0130426 | Ga0496108_0130426_35_1285 | 416 |
| 109 | 3300048911 | Ga0496108_0133318 | Ga0496108_0133318_720_1970 | 416 |
| 110 | 3300048912 | Ga0496109_0040197 | Ga0496109_0040197_407_1657 | 416 |
| 111 | 3300048912 | Ga0496109_0046107 | Ga0496109_0046107_1163_2413 | 416 |
| 112 | 3300048912 | Ga0496109_0254023 | Ga0496109_0254023_185_1435 | 416 |
| 113 | 3300048913 | Ga0496110_0000935 | Ga0496110_0000935_13887_15137 | 416 |
| 114 | 3300048913 | Ga0496110_0018818 | Ga0496110_0018818_1719_2969 | 416 |
| 115 | 3300048914 | Ga0496111_0107641 | Ga0496111_0107641_350_1600 | 416 |
| 116 | 3300048915 | Ga0496112_0027672 | Ga0496112_0027672_3713_4963 | 416 |
| 117 | 3300048915 | Ga0496112_0071174 | Ga0496112_0071174_1726_2976 | 416 |
| 118 | 3300048916 | Ga0496113_0003554 | Ga0496113_0003554_6024_7274 | 416 |
| 119 | 3300048916 | Ga0496113_0013045 | Ga0496113_0013045_2760_4010 | 416 |
| 120 | 3300048918 | Ga0496115_0016550 | Ga0496115_0016550_3718_4968 | 416 |
| 121 | 3300048921 | Ga0496118_0011991 | Ga0496118_0011991_1809_3059 | 416 |
| 122 | 3300048922 | Ga0496119_0005547 | Ga0496119_0005547_8760_10010 | 416 |
| 123 | 3300048924 | Ga0496121_0000053 | Ga0496121_0000053_186116_187366 | 416 |
| 124 | 3300048924 | Ga0496121_0085820 | Ga0496121_0085820_303_1553 | 416 |
| 125 | 3300048929 | Ga0496126_0002898 | Ga0496126_0002898_113_1456 | 416 |
| 126 | 3300050507 | nmdc:mga05p37_296602_c1 | nmdc:mga05p37_296602_c1_19_1269 | 416 |
| 127 | 3300053093 | Ga0500651_0057201 | Ga0500651_0057201_485_1735 | 416 |
| 128 | 3300053119 | Ga0500595_002066 | Ga0500595_002066_8537_9787 | 416 |
| 129 | 3300053161 | Ga0500634_0078890 | Ga0500634_0078890_271_1521 | 416 |
| 130 | 3300005329 | Ga0070683_100041446 | Ga0070683_1000414462 | 417 |
| 131 | 3300005336 | Ga0070680_100004826 | Ga0070680_1000048268 | 417 |
| 132 | 3300005336 | Ga0070680_100013160 | Ga0070680_1000131604 | 417 |
| 133 | 3300005344 | Ga0070661_100130242 | Ga0070661_1001302421 | 417 |
| 134 | 3300005353 | Ga0070669_100131763 | Ga0070669_1001317632 | 417 |
| 135 | 3300005354 | Ga0070675_100053785 | Ga0070675_1000537852 | 417 |
| 136 | 3300005355 | Ga0070671_100114771 | Ga0070671_1001147711 | 417 |
| 137 | 3300005436 | Ga0070713_100083952 | Ga0070713_1000839523 | 417 |
| 138 | 3300005445 | Ga0070708_100018692 | Ga0070708_1000186924 | 417 |
| 139 | 3300005457 | Ga0070662_100021304 | Ga0070662_1000213044 | 417 |
| 140 | 3300005458 | Ga0070681_10004132 | Ga0070681_100041328 | 417 |
| 141 | 3300005467 | Ga0070706_100037262 | Ga0070706_1000372622 | 417 |
| 142 | 3300005468 | Ga0070707_100009420 | Ga0070707_1000094209 | 417 |
| 143 | 3300005471 | Ga0070698_100011791 | Ga0070698_1000117918 | 417 |
| 144 | 3300005518 | Ga0070699_100040986 | Ga0070699_1000409861 | 417 |
| 145 | 3300005530 | Ga0070679_100016698 | Ga0070679_1000166982 | 417 |
| 146 | 3300005536 | Ga0070697_100009354 | Ga0070697_1000093545 | 417 |
| 147 | 3300005547 | Ga0070693_100079284 | Ga0070693_1000792842 | 417 |
| 148 | 3300005548 | Ga0070665_100000939 | Ga0070665_1000009393 | 417 |
| 149 | 3300006175 | Ga0070712_100021870 | Ga0070712_1000218703 | 417 |
| 150 | 3300006175 | Ga0070712_100089267 | Ga0070712_1000892672 | 417 |
| 151 | 3300006844 | Ga0075428_100188296 | Ga0075428_1001882962 | 417 |
| 152 | 3300009093 | Ga0105240_10012470 | Ga0105240_1001247011 | 417 |
| 153 | 3300010375 | Ga0105239_10018257 | Ga0105239_100182579 | 417 |
| 154 | 3300021388 | Ga0213875_10001172 | Ga0213875_100011722 | 417 |
| 155 | 3300025910 | Ga0207684_10022465 | Ga0207684_100224652 | 417 |
| 156 | 3300025912 | Ga0207707_10003322 | Ga0207707_100033227 | 417 |
| 157 | 3300025913 | Ga0207695_10066465 | Ga0207695_100664654 | 417 |
| 158 | 3300025914 | Ga0207671_10213235 | Ga0207671_102132351 | 417 |
| 159 | 3300025915 | Ga0207693_10022458 | Ga0207693_100224583 | 417 |
| 160 | 3300025915 | Ga0207693_10025163 | Ga0207693_100251633 | 417 |
| 161 | 3300025917 | Ga0207660_10027484 | Ga0207660_100274843 | 417 |
| 162 | 3300025921 | Ga0207652_10006620 | Ga0207652_100066205 | 417 |
| 163 | 3300025922 | Ga0207646_10005677 | Ga0207646_1000567711 | 417 |
| 164 | 3300025926 | Ga0207659_10177617 | Ga0207659_101776171 | 417 |
| 165 | 3300025929 | Ga0207664_10092391 | Ga0207664_100923911 | 417 |
| 166 | 3300025931 | Ga0207644_10010597 | Ga0207644_100105975 | 417 |
| 167 | 3300025933 | Ga0207706_10023646 | Ga0207706_100236465 | 417 |
| 168 | 3300025937 | Ga0207669_10015295 | Ga0207669_100152951 | 417 |
| 169 | 3300025944 | Ga0207661_10049557 | Ga0207661_100495571 | 417 |
| 170 | 3300025972 | Ga0207668_10011930 | Ga0207668_100119302 | 417 |
| 171 | 3300026121 | Ga0207683_10024201 | Ga0207683_100242014 | 417 |
| 172 | 3300027907 | Ga0207428_10025214 | Ga0207428_100252144 | 417 |
| 173 | 3300035691 | Ga0373931_0002608 | Ga0373931_0002608_4494_5747 | 417 |
| 174 | 3300035691 | Ga0373931_0057854 | Ga0373931_0057854_574_1827 | 417 |
| 175 | 3300037068 | Ga0373925_0074277 | Ga0373925_0074277_157_1410 | 417 |
| 176 | 3300037853 | Ga0436364_0883536 | Ga0436364_0883536_38280_39545 | 417 |
| 177 | 3300039437 | Ga0436365_1095116 | Ga0436365_1095116_2280_3533 | 417 |
| 178 | 3300048904 | Ga0496101_0059353 | Ga0496101_0059353_154_1407 | 417 |
| 179 | 3300048905 | Ga0496102_0004527 | Ga0496102_0004527_3027_4280 | 417 |
| 180 | 3300048907 | Ga0496104_0031776 | Ga0496104_0031776_626_1879 | 417 |
| 181 | 3300048909 | Ga0496106_0021256 | Ga0496106_0021256_3469_4722 | 417 |
| 182 | 3300048910 | Ga0496107_0142707 | Ga0496107_0142707_303_1556 | 417 |
| 183 | 3300048912 | Ga0496109_0015946 | Ga0496109_0015946_4116_5369 | 417 |
| 184 | 3300048912 | Ga0496109_0041321 | Ga0496109_0041321_2099_3352 | 417 |
| 185 | 3300048913 | Ga0496110_0003779 | Ga0496110_0003779_2150_3403 | 417 |
| 186 | 3300048917 | Ga0496114_0017451 | Ga0496114_0017451_3513_4766 | 417 |
| 187 | 3300048918 | Ga0496115_0001274 | Ga0496115_0001274_12779_14032 | 417 |
| 188 | 3300050492 | nmdc:mga0yw44_121991_c1 | nmdc:mga0yw44_121991_c1_89_1342 | 417 |
| 189 | 3300053077 | Ga0495601_0037592 | Ga0495601_0037592_1197_2450 | 417 |
| 190 | 3300053077 | Ga0495601_0055809 | Ga0495601_0055809_1141_2394 | 417 |
| 191 | 3300003791 | Ga0055530_10000091 | Ga0055530_100000914 | 418 |
| 192 | 3300005327 | Ga0070658_10091198 | Ga0070658_100911981 | 418 |
| 193 | 3300005335 | Ga0070666_10056486 | Ga0070666_100564862 | 418 |
| 194 | 3300005341 | Ga0070691_10007112 | Ga0070691_100071124 | 418 |
| 195 | 3300005355 | Ga0070671_100012454 | Ga0070671_1000124545 | 418 |
| 196 | 3300005356 | Ga0070674_100006032 | Ga0070674_1000060322 | 418 |
| 197 | 3300005366 | Ga0070659_100000143 | Ga0070659_10000014318 | 418 |
| 198 | 3300005366 | Ga0070659_100007260 | Ga0070659_1000072604 | 418 |
| 199 | 3300005367 | Ga0070667_100033395 | Ga0070667_1000333954 | 418 |
| 200 | 3300005436 | Ga0070713_100284087 | Ga0070713_1002840871 | 418 |
| 201 | 3300005445 | Ga0070708_100059730 | Ga0070708_1000597302 | 418 |
| 202 | 3300005456 | Ga0070678_100002683 | Ga0070678_10000268310 | 418 |
| 203 | 3300005458 | Ga0070681_10009948 | Ga0070681_100099483 | 418 |
| 204 | 3300005458 | Ga0070681_10032905 | Ga0070681_100329053 | 418 |
| 205 | 3300005468 | Ga0070707_100255987 | Ga0070707_1002559872 | 418 |
| 206 | 3300005530 | Ga0070679_100033350 | Ga0070679_1000333503 | 418 |
| 207 | 3300005548 | Ga0070665_100000144 | Ga0070665_10000014441 | 418 |
| 208 | 3300005548 | Ga0070665_100000265 | Ga0070665_1000002655 | 418 |
| 209 | 3300005548 | Ga0070665_100006429 | Ga0070665_10000642910 | 418 |
| 210 | 3300005548 | Ga0070665_100317608 | Ga0070665_1003176082 | 418 |
| 211 | 3300005563 | Ga0068855_100016452 | Ga0068855_1000164523 | 418 |
| 212 | 3300005617 | Ga0068859_100003874 | Ga0068859_1000038748 | 418 |
| 213 | 3300005841 | Ga0068863_100001641 | Ga0068863_10000164113 | 418 |
| 214 | 3300005842 | Ga0068858_100003849 | Ga0068858_1000038496 | 418 |
| 215 | 3300005843 | Ga0068860_100009293 | Ga0068860_1000092933 | 418 |
| 216 | 3300005937 | Ga0081455_10001615 | Ga0081455_100016155 | 418 |
| 217 | 3300005985 | Ga0081539_10001495 | Ga0081539_1000149525 | 418 |
| 218 | 3300006028 | Ga0070717_10189291 | Ga0070717_101892912 | 418 |
| 219 | 3300006931 | Ga0097620_100003874 | Ga0097620_1000038748 | 418 |
| 220 | 3300009093 | Ga0105240_10046538 | Ga0105240_100465384 | 418 |
| 221 | 3300009093 | Ga0105240_10169945 | Ga0105240_101699452 | 418 |
| 222 | 3300009147 | Ga0114129_10429386 | Ga0114129_104293862 | 418 |
| 223 | 3300009177 | Ga0105248_10000489 | Ga0105248_1000048939 | 418 |
| 224 | 3300009551 | Ga0105238_10102617 | Ga0105238_101026172 | 418 |
| 225 | 3300013308 | Ga0157375_10130655 | Ga0157375_101306552 | 418 |
| 226 | 3300014325 | Ga0163163_10184536 | Ga0163163_101845362 | 418 |
| 227 | 3300025250 | Ga0209026_1007229 | Ga0209026_10072293 | 418 |
| 228 | 3300025297 | Ga0209758_1000217 | Ga0209758_1000217109 | 418 |
| 229 | 3300025298 | Ga0209050_1000029 | Ga0209050_10000295 | 418 |
| 230 | 3300025302 | Ga0207426_1028672 | Ga0207426_10286722 | 418 |
| 231 | 3300025304 | Ga0209257_1000271 | Ga0209257_1000271117 | 418 |
| 232 | 3300025893 | Ga0207682_10057623 | Ga0207682_100576232 | 418 |
| 233 | 3300025900 | Ga0207710_10000861 | Ga0207710_100008618 | 418 |
| 234 | 3300025909 | Ga0207705_10003884 | Ga0207705_1000388411 | 418 |
| 235 | 3300025912 | Ga0207707_10008145 | Ga0207707_100081457 | 418 |
| 236 | 3300025913 | Ga0207695_10007406 | Ga0207695_1000740611 | 418 |
| 237 | 3300025915 | Ga0207693_10072296 | Ga0207693_100722963 | 418 |
| 238 | 3300025917 | Ga0207660_10018746 | Ga0207660_100187462 | 418 |
| 239 | 3300025921 | Ga0207652_10011908 | Ga0207652_100119083 | 418 |
| 240 | 3300025922 | Ga0207646_10251922 | Ga0207646_102519221 | 418 |
| 241 | 3300025925 | Ga0207650_10032603 | Ga0207650_100326033 | 418 |
| 242 | 3300025931 | Ga0207644_10019606 | Ga0207644_100196062 | 418 |
| 243 | 3300025932 | Ga0207690_10000283 | Ga0207690_1000028317 | 418 |
| 244 | 3300025932 | Ga0207690_10031232 | Ga0207690_100312324 | 418 |
| 245 | 3300025935 | Ga0207709_10088079 | Ga0207709_100880791 | 418 |
| 246 | 3300025938 | Ga0207704_10001720 | Ga0207704_100017206 | 418 |
| 247 | 3300025940 | Ga0207691_10005669 | Ga0207691_100056696 | 418 |
| 248 | 3300025941 | Ga0207711_10001294 | Ga0207711_1000129418 | 418 |
| 249 | 3300025941 | Ga0207711_10072708 | Ga0207711_100727081 | 418 |
| 250 | 3300025949 | Ga0207667_10066555 | Ga0207667_100665553 | 418 |
| 251 | 3300025961 | Ga0207712_10006854 | Ga0207712_100068542 | 418 |
| 252 | 3300025986 | Ga0207658_10002499 | Ga0207658_100024995 | 418 |
| 253 | 3300026035 | Ga0207703_10003511 | Ga0207703_100035115 | 418 |
| 254 | 3300026088 | Ga0207641_10011694 | Ga0207641_100116945 | 418 |
| 255 | 3300026089 | Ga0207648_10017971 | Ga0207648_100179714 | 418 |
| 256 | 3300026121 | Ga0207683_10000755 | Ga0207683_100007554 | 418 |
| 257 | 3300028379 | Ga0268266_10000003 | Ga0268266_10000003333 | 418 |
| 258 | 3300028379 | Ga0268266_10000592 | Ga0268266_1000059246 | 418 |
| 259 | 3300028381 | Ga0268264_10183883 | Ga0268264_101838832 | 418 |
| 260 | 3300028573 | Ga0265334_10007691 | Ga0265334_100076912 | 418 |
| 261 | 3300028577 | Ga0265318_10002314 | Ga0265318_100023144 | 418 |
| 262 | 3300028653 | Ga0265323_10001191 | Ga0265323_100011918 | 418 |
| 263 | 3300028666 | Ga0265336_10000091 | Ga0265336_1000009116 | 418 |
| 264 | 3300028800 | Ga0265338_10000094 | Ga0265338_1000009477 | 418 |
| 265 | 3300029957 | Ga0265324_10011294 | Ga0265324_100112943 | 418 |
| 266 | 3300031507 | Ga0307509_10000003 | Ga0307509_10000003298 | 418 |
| 267 | 3300031824 | Ga0307413_10065900 | Ga0307413_100659003 | 418 |
| 268 | 3300035171 | Ga0373946_0014163 | Ga0373946_0014163_672_1928 | 418 |
| 269 | 3300035695 | Ga0373927_0000155 | Ga0373927_0000155_15146_16402 | 418 |
| 270 | 3300037068 | Ga0373925_0000050 | Ga0373925_0000050_14870_16126 | 418 |
| 271 | 3300037466 | Ga0395898_0008597 | Ga0395898_0008597_486_1742 | 418 |
| 272 | 3300037471 | Ga0395905_0148897 | Ga0395905_0148897_700_1956 | 418 |
| 273 | 3300037471 | Ga0395905_0173888 | Ga0395905_0173888_458_1714 | 418 |
| 274 | 3300044694 | Ga0466963_0217495 | Ga0466963_0217495_64_1320 | 418 |
| 275 | 3300048913 | Ga0496110_0211544 | Ga0496110_0211544_162_1418 | 418 |
| 276 | 3300048918 | Ga0496115_0000562 | Ga0496115_0000562_14198_15454 | 418 |
| 277 | 3300048918 | Ga0496115_0003355 | Ga0496115_0003355_2339_3595 | 418 |
| 278 | 3300048924 | Ga0496121_0009984 | Ga0496121_0009984_2300_3556 | 418 |
| 279 | 3300048928 | Ga0496125_0000090 | Ga0496125_0000090_95481_96737 | 418 |
| 280 | 3300048928 | Ga0496125_0000877 | Ga0496125_0000877_17586_18842 | 418 |
| 281 | 3300048929 | Ga0496126_0058883 | Ga0496126_0058883_1874_3130 | 418 |
| 282 | 3300049581 | Ga0501047_0000771 | Ga0501047_0000771_24724_26058 | 418 |
| 283 | 3300049581 | Ga0501047_0083006 | Ga0501047_0083006_1487_2743 | 418 |
| 284 | 3300049823 | Ga0501044_0001492 | Ga0501044_0001492_27_1283 | 418 |
| 285 | 3300050492 | nmdc:mga0yw44_129829_c1 | nmdc:mga0yw44_129829_c1_61_1317 | 418 |
| 286 | 3300050513 | nmdc:mga0rr50_142659_c1 | nmdc:mga0rr50_142659_c1_400_1656 | 418 |
| 287 | 3300053103 | Ga0500555_003662 | Ga0500555_003662_445_1701 | 418 |
| 288 | 3300053108 | Ga0500562_001102 | Ga0500562_001102_863_2119 | 418 |
| 289 | 3300053131 | Ga0500652_000002 | Ga0500652_000002_63383_64639 | 418 |
| 290 | 3300053133 | Ga0500655_009436 | Ga0500655_009436_457_1713 | 418 |
| 291 | 3300053142 | Ga0500577_0000038 | Ga0500577_0000038_23608_24864 | 418 |
| 292 | 3300060353 | Ga0501082_0000074 | Ga0501082_0000074_69016_70275 | 418 |
| 293 | 3300025919 | Ga0207657_10185010 | Ga0207657_101850102 | 419 |
| 294 | 3300031852 | Ga0307410_10040236 | Ga0307410_100402362 | 419 |
| 295 | 3300032005 | Ga0307411_10147990 | Ga0307411_101479901 | 419 |
| 296 | 3300032126 | Ga0307415_100074296 | Ga0307415_1000742961 | 419 |
| 297 | 3300046616 | Ga0495668_0064252 | Ga0495668_0064252_641_1900 | 419 |
| 298 | 3300005327 | Ga0070658_10000029 | Ga0070658_1000002970 | 420 |
| 299 | 3300005333 | Ga0070677_10000312 | Ga0070677_100003128 | 420 |
| 300 | 3300005336 | Ga0070680_100007661 | Ga0070680_1000076618 | 420 |
| 301 | 3300005338 | Ga0068868_100000001 | Ga0068868_100000001257 | 420 |
| 302 | 3300005339 | Ga0070660_100000437 | Ga0070660_1000004379 | 420 |
| 303 | 3300005339 | Ga0070660_100007310 | Ga0070660_1000073108 | 420 |
| 304 | 3300005344 | Ga0070661_100001016 | Ga0070661_1000010166 | 420 |
| 305 | 3300005354 | Ga0070675_100004415 | Ga0070675_1000044154 | 420 |
| 306 | 3300005366 | Ga0070659_100000001 | Ga0070659_10000000198 | 420 |
| 307 | 3300005366 | Ga0070659_100000968 | Ga0070659_10000096816 | 420 |
| 308 | 3300005458 | Ga0070681_10025926 | Ga0070681_100259262 | 420 |
| 309 | 3300005530 | Ga0070679_100000005 | Ga0070679_10000000560 | 420 |
| 310 | 3300005544 | Ga0070686_100000252 | Ga0070686_10000025232 | 420 |
| 311 | 3300005548 | Ga0070665_100000011 | Ga0070665_1000000116 | 420 |
| 312 | 3300005841 | Ga0068863_100083990 | Ga0068863_1000839902 | 420 |
| 313 | 3300005843 | Ga0068860_100016085 | Ga0068860_1000160859 | 420 |
| 314 | 3300009551 | Ga0105238_10172571 | Ga0105238_101725712 | 420 |
| 315 | 3300021358 | Ga0213873_10000006 | Ga0213873_10000006170 | 420 |
| 316 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004676 | 420 |
| 317 | 3300021384 | Ga0213876_10000217 | Ga0213876_1000021737 | 420 |
| 318 | 3300021384 | Ga0213876_10003872 | Ga0213876_100038728 | 420 |
| 319 | 3300021384 | Ga0213876_10012866 | Ga0213876_100128661 | 420 |
| 320 | 3300025893 | Ga0207682_10000533 | Ga0207682_100005335 | 420 |
| 321 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002803 | 420 |
| 322 | 3300025912 | Ga0207707_10040713 | Ga0207707_100407134 | 420 |
| 323 | 3300025917 | Ga0207660_10005447 | Ga0207660_100054477 | 420 |
| 324 | 3300025919 | Ga0207657_10002491 | Ga0207657_100024912 | 420 |
| 325 | 3300025919 | Ga0207657_10010246 | Ga0207657_100102466 | 420 |
| 326 | 3300025919 | Ga0207657_10013159 | Ga0207657_100131598 | 420 |
| 327 | 3300025920 | Ga0207649_10000106 | Ga0207649_1000010662 | 420 |
| 328 | 3300025921 | Ga0207652_10000036 | Ga0207652_1000003659 | 420 |
| 329 | 3300025926 | Ga0207659_10164139 | Ga0207659_101641392 | 420 |
| 330 | 3300025932 | Ga0207690_10000018 | Ga0207690_10000018166 | 420 |
| 331 | 3300025932 | Ga0207690_10002077 | Ga0207690_1000207710 | 420 |
| 332 | 3300026023 | Ga0207677_10000024 | Ga0207677_1000002477 | 420 |
| 333 | 3300026088 | Ga0207641_10006678 | Ga0207641_100066786 | 420 |
| 334 | 3300028379 | Ga0268266_10000063 | Ga0268266_100000633 | 420 |
| 335 | 3300028381 | Ga0268264_10019593 | Ga0268264_100195936 | 420 |
| 336 | 3300031548 | Ga0307408_100075879 | Ga0307408_1000758792 | 420 |
| 337 | 3300031731 | Ga0307405_10145320 | Ga0307405_101453201 | 420 |
| 338 | 3300032005 | Ga0307411_10042769 | Ga0307411_100427692 | 420 |
| 339 | 3300039437 | Ga0436365_0862833 | Ga0436365_0862833_76653_77918 | 420 |
| 340 | 3300039437 | Ga0436365_1189040 | Ga0436365_1189040_4476_5741 | 420 |
| 341 | 3300039437 | Ga0436365_1259102 | Ga0436365_1259102_45560_46828 | 420 |
| 342 | 3300039450 | Ga0436363_0387523 | Ga0436363_0387523_391_1656 | 420 |
| 343 | 3300039453 | Ga0436362_0949954 | Ga0436362_0949954_25984_27249 | 420 |
| 344 | 3300050512 | nmdc:mga0n895_139276_c1 | nmdc:mga0n895_139276_c1_125_1390 | 420 |
| 345 | 3300000549 | LJQas_1005695 | LJQas_10056952 | 421 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ej3-assembly1.cif.gz_B | utp cyclohydrolase | 0.9439 | 25 | 418 |
| 7ej3-assembly1.cif.gz_B | utp cyclohydrolase | 0.9235 | 25 | 418 |
| 2bz0-assembly1.cif.gz_A | crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc | 0.6642 | 129 | 379 |
| 2bz0-assembly1.cif.gz_A | crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc | 0.6578 | 129 | 379 |
| 2bz1-assembly1.cif.gz_A-2 | crystal structure of apo e. coli gtp cyclohydrolase ii | 0.6492 | 129 | 379 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9US41_242_400_3.40.50.10990 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.8687 | 217 | 378 | 3.40.50.10990 |
| af_Q9US41_242_400_3.40.50.10990 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.8636 | 217 | 378 | 3.40.50.10990 |
| 4i14B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.716 | 221 | 376 | 3.40.50.10990 |
| af_A0A1D6LPG1_1_132_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.7086 | 335 | 376 | 3.30.420.80 |
| af_A0A0R0GI97_331_502_3.40.50.10990 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.6786 | 221 | 379 | 3.40.50.10990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258TEC2-F1-model_v4 | deleted | 0.949 | 29 | 275 |
|
| AF-A0A1R1YIC3-F1-model_v4 | Uracil-regulated protein 1 | 0.9454 | 25 | 417 |
GO:0003935
GO:0005525 GO:0009231 |
| AF-A0A536VGU3-F1-model_v4 | GTP cyclohydrolase II (EC 3.5.4.25) | 0.9441 | 73 | 418 |
GO:0003935
GO:0005525 GO:0009231 |
| AF-A0A2T1D035-F1-model_v4 | GTP cyclohydrolase II | 0.9439 | 33 | 419 |
GO:0003935
GO:0005525 GO:0009231 |
| AF-A0A7S1WIU3-F1-model_v4 | GTP cyclohydrolase II | 0.9376 | 13 | 417 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar