F416563

General Info

Members Datasets Scaffolds Average Seq Length
345 206 334 418

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_121991_c1|nmdc:mga0yw44_121991_c1_89_1342
Length 417
Sequence MSTNRDSHIRLTSHPNHRGPTRHPIRWDAPTAQERGPIIGTVTNPSERNAIGAHGGSYALYRALAVSSGALNPMARPDLTNTAPVIDIGPFPQWSEPGRIVSLDPWGARVASDFAKEISEGLDIRPTIAVTKARLTIPEFAARSQKWIDIDGDIVRAGGEIAVTKAAIDPVWYLPGIASRFNVSEDTLRRTLFEQTGGIYPELVTRPDLSVFLPPIGGITLYMFGDPAAVADPKRALTCRVHDECNGSDVFGSDICTCRPYLVHGIAECVKQAQHGGAGLIVYNRKEGRALGEVTKFLVYNARKRQEGGDQASTYFERTECVAGVQDARFQQLMPDVLHWLGITRIDRFVSMSNMKYEAIVNTGIQIVERVPIPDGLVPPDAQVELQAKMAAGYYTPDHAPTADELKSVVGRDLKEF

Samples

Sample ID Description Type Environment
1 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
2 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
3 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
4 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
5 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
6 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
7 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
8 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
9 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
10 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
201 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
202 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
203 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
206 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 0
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.51
Nodule 0.87
Rhizoplane 11.3
Rhizosphere 72.46
Stem 0
Stem Tuber 0
Unclassified 9.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005695 3300000549 Bacteria 1570
2 JGI25153J46596_10001651 3300003215 Bacteria 13214
3 Ga0055530_10000091 3300003791 Bacteria 78039
4 Ga0065707_10120068 3300005295 Bacteria 2144
5 Ga0070658_10000029 3300005327 Bacteria 156910
6 Ga0070658_10091198 3300005327 Bacteria 2511
7 Ga0070683_100041446 3300005329 Bacteria 4235
8 Ga0070677_10000312 3300005333 Bacteria 16970
9 Ga0070666_10056486 3300005335 Bacteria 2651
10 Ga0070680_100004826 3300005336 Bacteria 10146
11 Ga0070680_100007661 3300005336 Bacteria 8238
12 Ga0070680_100013160 3300005336 Bacteria 6440
13 Ga0068868_100000001 3300005338 Bacteria 282170
14 Ga0070660_100000437 3300005339 Bacteria 27601
15 Ga0070660_100007310 3300005339 Bacteria 7696
16 Ga0070691_10007112 3300005341 Bacteria 5132
17 Ga0070661_100001016 3300005344 Bacteria 19889
18 Ga0070661_100130242 3300005344 Bacteria 1889
19 Ga0070661_100145566 3300005344 Bacteria 1788
20 Ga0070669_100131763 3300005353 Bacteria 1919
21 Ga0070675_100004415 3300005354 Bacteria 10723
22 Ga0070675_100053785 3300005354 Bacteria 3312
23 Ga0070671_100012454 3300005355 Bacteria 6849
24 Ga0070671_100114771 3300005355 Bacteria 2264
25 Ga0070674_100006032 3300005356 Bacteria 7043
26 Ga0070659_100000001 3300005366 Bacteria 576390
27 Ga0070659_100000143 3300005366 Bacteria 55183
28 Ga0070659_100000968 3300005366 Bacteria 21135
29 Ga0070659_100007260 3300005366 Bacteria 8043
30 Ga0070667_100033395 3300005367 Unclassified 4300
31 Ga0070713_100083952 3300005436 Bacteria 2724
32 Ga0070713_100125533 3300005436 Bacteria 2256
33 Ga0070713_100284087 3300005436 Bacteria 1519
34 Ga0070708_100018692 3300005445 Bacteria 5801
35 Ga0070708_100059730 3300005445 Bacteria 3400
36 Ga0070663_100055367 3300005455 Bacteria 2839
37 Ga0070663_100094659 3300005455 Bacteria 2218
38 Ga0070678_100002683 3300005456 Bacteria 9809
39 Ga0070678_100053244 3300005456 Bacteria 2942
40 Ga0070662_100021304 3300005457 Bacteria 4425
41 Ga0070681_10004132 3300005458 Bacteria 13726
42 Ga0070681_10009948 3300005458 Bacteria 9373
43 Ga0070681_10025926 3300005458 Bacteria 5894
44 Ga0070681_10032905 3300005458 Bacteria 5205
45 Ga0070706_100037262 3300005467 Bacteria 4491
46 Ga0070707_100009420 3300005468 Bacteria 9065
47 Ga0070707_100255987 3300005468 Bacteria 1703
48 Ga0070698_100011791 3300005471 Bacteria 9274
49 Ga0070699_100040986 3300005518 Bacteria 4007
50 Ga0070679_100000005 3300005530 Bacteria 263201
51 Ga0070679_100016698 3300005530 Bacteria 7091
52 Ga0070679_100033350 3300005530 Bacteria 5098
53 Ga0070697_100009354 3300005536 Bacteria 7657
54 Ga0070686_100000252 3300005544 Bacteria 36805
55 Ga0070693_100079284 3300005547 Bacteria 1954
56 Ga0070665_100000011 3300005548 Bacteria 525539
57 Ga0070665_100000144 3300005548 Bacteria 132302
58 Ga0070665_100000265 3300005548 Bacteria 85729
59 Ga0070665_100000939 3300005548 Bacteria 37232
60 Ga0070665_100006429 3300005548 Bacteria 11958
61 Ga0070665_100024545 3300005548 Bacteria 6074
62 Ga0070665_100317608 3300005548 Bacteria 1562
63 Ga0068855_100016452 3300005563 Bacteria 8893
64 Ga0068859_100003874 3300005617 Bacteria 15281
65 Ga0068864_100000257 3300005618 Bacteria 47415
66 Ga0068861_100024556 3300005719 Bacteria 4360
67 Ga0068863_100000167 3300005841 Bacteria 70943
68 Ga0068863_100001641 3300005841 Bacteria 22133
69 Ga0068863_100083990 3300005841 Bacteria 3018
70 Ga0068858_100000198 3300005842 Bacteria 64645
71 Ga0068858_100003849 3300005842 Bacteria 14837
72 Ga0068860_100009293 3300005843 Bacteria 9768
73 Ga0068860_100016085 3300005843 Bacteria 7298
74 Ga0081455_10001615 3300005937 Bacteria 27557
75 Ga0081455_10021725 3300005937 Bacteria 6011
76 Ga0081539_10001495 3300005985 Bacteria 39548
77 Ga0070717_10189291 3300006028 Bacteria 1797
78 Ga0070715_10055098 3300006163 Bacteria 1724
79 Ga0070712_100021870 3300006175 Bacteria 4207
80 Ga0070712_100089267 3300006175 Bacteria 2254
81 Ga0075428_100054776 3300006844 Bacteria 4370
82 Ga0075428_100188296 3300006844 Bacteria 2232
83 Ga0097620_100003874 3300006931 Bacteria 15281
84 Ga0099794_10005140 3300007265 Bacteria 5223
85 Ga0105250_10028014 3300009092 Bacteria 2269
86 Ga0105240_10012470 3300009093 Bacteria 11727
87 Ga0105240_10046538 3300009093 Bacteria 5496
88 Ga0105240_10169945 3300009093 Bacteria 2583
89 Ga0111539_10457418 3300009094 Bacteria 1486
90 Ga0105245_10123482 3300009098 Bacteria 2421
91 Ga0114129_10255978 3300009147 Bacteria 2348
92 Ga0114129_10429386 3300009147 Bacteria 1736
93 Ga0105243_10166102 3300009148 Bacteria 1907
94 Ga0105248_10000489 3300009177 Bacteria 45002
95 Ga0105248_10009341 3300009177 Bacteria 10796
96 Ga0105238_10102617 3300009551 Bacteria 2841
97 Ga0105238_10172571 3300009551 Bacteria 2139
98 Ga0105239_10018257 3300010375 Bacteria 7755
99 Ga0157375_10121012 3300013308 Bacteria 2727
100 Ga0157375_10130655 3300013308 Bacteria 2630
101 Ga0163163_10184536 3300014325 Bacteria 2134
102 Ga0163163_10211032 3300014325 Bacteria 1991
103 Ga0157379_10031450 3300014968 Bacteria 4728
104 Ga0213873_10000006 3300021358 Bacteria 408723
105 Ga0213876_10000004 3300021384 Bacteria 943822
106 Ga0213876_10000217 3300021384 Bacteria 57767
107 Ga0213876_10003872 3300021384 Bacteria 8458
108 Ga0213876_10012866 3300021384 Bacteria 4449
109 Ga0213876_10031924 3300021384 Bacteria 2778
110 Ga0213875_10000011 3300021388 Bacteria 332447
111 Ga0213875_10001172 3300021388 Bacteria 17976
112 Ga0209026_1007229 3300025250 Bacteria 2545
113 Ga0209758_1000217 3300025297 Bacteria 124619
114 Ga0209758_1002042 3300025297 Bacteria 21647
115 Ga0209758_1005471 3300025297 Bacteria 9758
116 Ga0209050_1000029 3300025298 Bacteria 465801
117 Ga0207426_1028672 3300025302 Bacteria 1843
118 Ga0209257_1000271 3300025304 Bacteria 118632
119 Ga0207697_10054875 3300025315 Bacteria 1651
120 Ga0207682_10000533 3300025893 Bacteria 17501
121 Ga0207682_10057623 3300025893 Bacteria 1620
122 Ga0207710_10000861 3300025900 Bacteria 16327
123 Ga0207688_10037649 3300025901 Bacteria 2684
124 Ga0207645_10029447 3300025907 Bacteria 3540
125 Ga0207705_10000002 3300025909 Bacteria 2046852
126 Ga0207705_10003884 3300025909 Bacteria 11370
127 Ga0207684_10022465 3300025910 Bacteria 5384
128 Ga0207684_10120508 3300025910 Bacteria 2249
129 Ga0207654_10009330 3300025911 Bacteria 4980
130 Ga0207707_10003322 3300025912 Bacteria 14290
131 Ga0207707_10008145 3300025912 Bacteria 9097
132 Ga0207707_10040713 3300025912 Bacteria 4058
133 Ga0207695_10003032 3300025913 Bacteria 24100
134 Ga0207695_10007406 3300025913 Bacteria 13985
135 Ga0207695_10066465 3300025913 Bacteria 3702
136 Ga0207671_10073980 3300025914 Bacteria 2546
137 Ga0207671_10213235 3300025914 Bacteria 1511
138 Ga0207693_10022458 3300025915 Bacteria 5014
139 Ga0207693_10025163 3300025915 Bacteria 4721
140 Ga0207693_10072296 3300025915 Bacteria 2701
141 Ga0207660_10005447 3300025917 Bacteria 8259
142 Ga0207660_10018746 3300025917 Bacteria 4619
143 Ga0207660_10027484 3300025917 Bacteria 3883
144 Ga0207662_10050811 3300025918 Bacteria 2465
145 Ga0207657_10002491 3300025919 Bacteria 19909
146 Ga0207657_10010246 3300025919 Bacteria 9364
147 Ga0207657_10013159 3300025919 Bacteria 8123
148 Ga0207657_10185010 3300025919 Bacteria 1682
149 Ga0207649_10000106 3300025920 Bacteria 69452
150 Ga0207649_10058140 3300025920 Bacteria 2420
151 Ga0207649_10144205 3300025920 Bacteria 1633
152 Ga0207652_10000036 3300025921 Bacteria 134949
153 Ga0207652_10006620 3300025921 Bacteria 9338
154 Ga0207652_10011908 3300025921 Bacteria 7017
155 Ga0207646_10005677 3300025922 Bacteria 13087
156 Ga0207646_10251922 3300025922 Bacteria 1595
157 Ga0207650_10032603 3300025925 Bacteria 3768
158 Ga0207659_10138602 3300025926 Bacteria 1886
159 Ga0207659_10164139 3300025926 Bacteria 1747
160 Ga0207659_10177617 3300025926 Bacteria 1684
161 Ga0207664_10092391 3300025929 Bacteria 2484
162 Ga0207644_10010597 3300025931 Bacteria 6078
163 Ga0207644_10019606 3300025931 Unclassified 4590
164 Ga0207690_10000018 3300025932 Bacteria 238992
165 Ga0207690_10000283 3300025932 Bacteria 36051
166 Ga0207690_10002077 3300025932 Bacteria 12273
167 Ga0207690_10031232 3300025932 Bacteria 3406
168 Ga0207706_10023646 3300025933 Bacteria 5517
169 Ga0207706_10030469 3300025933 Bacteria 4811
170 Ga0207706_10138678 3300025933 Bacteria 2139
171 Ga0207709_10088079 3300025935 Bacteria 2020
172 Ga0207669_10015295 3300025937 Bacteria 3867
173 Ga0207704_10001720 3300025938 Bacteria 9796
174 Ga0207665_10174697 3300025939 Bacteria 1553
175 Ga0207691_10005669 3300025940 Bacteria 12069
176 Ga0207711_10001294 3300025941 Bacteria 23722
177 Ga0207711_10025144 3300025941 Bacteria 4996
178 Ga0207711_10037098 3300025941 Bacteria 4138
179 Ga0207711_10072708 3300025941 Bacteria 2987
180 Ga0207661_10049557 3300025944 Bacteria 3343
181 Ga0207661_10265926 3300025944 Bacteria 1529
182 Ga0207667_10066555 3300025949 Bacteria 3755
183 Ga0207712_10006854 3300025961 Bacteria 7191
184 Ga0207668_10011930 3300025972 Bacteria 5302
185 Ga0207668_10175855 3300025972 Bacteria 1683
186 Ga0207658_10002499 3300025986 Bacteria 13396
187 Ga0207677_10000024 3300026023 Bacteria 127407
188 Ga0207703_10000189 3300026035 Bacteria 72189
189 Ga0207703_10003511 3300026035 Bacteria 13115
190 Ga0207703_10061776 3300026035 Bacteria 3068
191 Ga0207678_10068879 3300026067 Bacteria 3035
192 Ga0207641_10000120 3300026088 Bacteria 116070
193 Ga0207641_10006678 3300026088 Bacteria 9679
194 Ga0207641_10011694 3300026088 Bacteria 7206
195 Ga0207648_10017971 3300026089 Bacteria 6413
196 Ga0207676_10000424 3300026095 Bacteria 35638
197 Ga0207674_10164084 3300026116 Bacteria 2176
198 Ga0207683_10000755 3300026121 Bacteria 29385
199 Ga0207683_10024201 3300026121 Bacteria 5227
200 Ga0207683_10075026 3300026121 Bacteria 2993
201 Ga0207428_10025214 3300027907 Bacteria 4978
202 Ga0268266_10000003 3300028379 Bacteria 1701703
203 Ga0268266_10000063 3300028379 Bacteria 253339
204 Ga0268266_10000592 3300028379 Bacteria 49766
205 Ga0268266_10007933 3300028379 Bacteria 9499
206 Ga0268266_10041823 3300028379 Bacteria 3912
207 Ga0268266_10126621 3300028379 Bacteria 2280
208 Ga0268264_10019593 3300028381 Bacteria 5527
209 Ga0268264_10183883 3300028381 Unclassified 1900
210 Ga0265334_10007691 3300028573 Bacteria 4615
211 Ga0265318_10002314 3300028577 Bacteria 10231
212 Ga0265323_10001191 3300028653 Bacteria 13249
213 Ga0265336_10000091 3300028666 Bacteria 69365
214 Ga0307517_10000235 3300028786 Bacteria 93944
215 Ga0265338_10000094 3300028800 Bacteria 168366
216 Ga0265324_10011294 3300029957 Bacteria 3408
217 Ga0307511_10000937 3300030521 Bacteria 30868
218 Ga0265325_10004144 3300031241 Bacteria 9218
219 Ga0307509_10000003 3300031507 Bacteria 577578
220 Ga0307408_100075879 3300031548 Bacteria 2499
221 Ga0307405_10113796 3300031731 Bacteria 1838
222 Ga0307405_10145320 3300031731 Bacteria 1660
223 Ga0307413_10049587 3300031824 Bacteria 2517
224 Ga0307413_10065900 3300031824 Bacteria 2257
225 Ga0307410_10040236 3300031852 Bacteria 3075
226 Ga0307409_100037173 3300031995 Bacteria 3587
227 Ga0307411_10042769 3300032005 Bacteria 2894
228 Ga0307411_10043179 3300032005 Bacteria 2883
229 Ga0307411_10147990 3300032005 Bacteria 1741
230 Ga0307411_10222800 3300032005 Bacteria 1464
231 Ga0307415_100016602 3300032126 Bacteria 4393
232 Ga0307415_100074296 3300032126 Bacteria 2402
233 Ga0307510_10013610 3300033180 Bacteria 9646
234 Ga0373946_0014163 3300035171 Bacteria 3005
235 Ga0373931_0002608 3300035691 Bacteria 8026
236 Ga0373931_0057854 3300035691 Bacteria 2080
237 Ga0373935_0014691 3300035692 Bacteria 4726
238 Ga0373927_0000155 3300035695 Bacteria 53529
239 Ga0373927_0139703 3300035695 Bacteria 1584
240 Ga0373947_0135902 3300035725 Bacteria 1573
241 Ga0373947_0190731 3300035725 Bacteria 1337
242 Ga0373925_0000050 3300037068 Bacteria 127678
243 Ga0373925_0074277 3300037068 Bacteria 2575
244 Ga0395898_0008597 3300037466 Bacteria 10775
245 Ga0395905_0148897 3300037471 Bacteria 2202
246 Ga0395905_0173888 3300037471 Bacteria 2022
247 Ga0436364_0622718 3300037853 Bacteria 37563
248 Ga0436364_0883536 3300037853 Bacteria 58970
249 Ga0436365_0862833 3300039437 Bacteria 88455
250 Ga0436365_1095116 3300039437 Bacteria 3910
251 Ga0436365_1189040 3300039437 Bacteria 29791
252 Ga0436365_1259102 3300039437 Bacteria 59061
253 Ga0436360_1222596 3300039438 Bacteria 1408
254 Ga0436363_0387523 3300039450 Bacteria 1770
255 Ga0436362_0949954 3300039453 Bacteria 89092
256 Ga0466969_0005562 3300044656 Bacteria 6701
257 Ga0466966_0002380 3300044684 Bacteria 12282
258 Ga0466961_0005117 3300044693 Bacteria 8253
259 Ga0466963_0217495 3300044694 Bacteria 1338
260 Ga0466964_0001940 3300044706 Bacteria 7245
261 Ga0466970_0011980 3300044765 Bacteria 4426
262 Ga0466957_0005029 3300044842 Bacteria 7402
263 Ga0495603_0024477 3300046455 Bacteria 3651
264 Ga0495644_0060955 3300046523 Bacteria 1418
265 Ga0495668_0064252 3300046616 Bacteria 2021
266 Ga0495669_0001626 3300046684 Bacteria 9228
267 Ga0496100_0001424 3300048903 Bacteria 11698
268 Ga0496101_0003301 3300048904 Bacteria 10039
269 Ga0496101_0059353 3300048904 Bacteria 2772
270 Ga0496102_0004527 3300048905 Bacteria 11748
271 Ga0496102_0127544 3300048905 Bacteria 2379
272 Ga0496103_0045817 3300048906 Bacteria 2699
273 Ga0496104_0016626 3300048907 Bacteria 6686
274 Ga0496104_0031776 3300048907 Bacteria 4911
275 Ga0496104_0258406 3300048907 Bacteria 1655
276 Ga0496105_0020513 3300048908 Bacteria 5341
277 Ga0496105_0043069 3300048908 Bacteria 3723
278 Ga0496105_0158547 3300048908 Bacteria 1858
279 Ga0496106_0021256 3300048909 Bacteria 4818
280 Ga0496106_0025932 3300048909 Bacteria 4360
281 Ga0496106_0122188 3300048909 Bacteria 2036
282 Ga0496107_0009209 3300048910 Bacteria 6842
283 Ga0496107_0142707 3300048910 Bacteria 1770
284 Ga0496108_0046267 3300048911 Bacteria 3635
285 Ga0496108_0130426 3300048911 Bacteria 2161
286 Ga0496108_0133318 3300048911 Bacteria 2135
287 Ga0496109_0015946 3300048912 Bacteria 6563
288 Ga0496109_0040197 3300048912 Bacteria 4235
289 Ga0496109_0041321 3300048912 Bacteria 4177
290 Ga0496109_0046107 3300048912 Bacteria 3958
291 Ga0496109_0254023 3300048912 Bacteria 1655
292 Ga0496110_0000935 3300048913 Bacteria 20529
293 Ga0496110_0003779 3300048913 Bacteria 11663
294 Ga0496110_0018818 3300048913 Bacteria 5800
295 Ga0496110_0211544 3300048913 Bacteria 1763
296 Ga0496111_0107641 3300048914 Bacteria 2052
297 Ga0496112_0027672 3300048915 Bacteria 5468
298 Ga0496112_0071174 3300048915 Bacteria 3437
299 Ga0496113_0003554 3300048916 Bacteria 9353
300 Ga0496113_0013045 3300048916 Bacteria 5610
301 Ga0496114_0017451 3300048917 Bacteria 5792
302 Ga0496115_0000562 3300048918 Bacteria 28823
303 Ga0496115_0001274 3300048918 Bacteria 18022
304 Ga0496115_0003355 3300048918 Bacteria 11493
305 Ga0496115_0016550 3300048918 Bacteria 5618
306 Ga0496118_0011991 3300048921 Bacteria 8376
307 Ga0496119_0005547 3300048922 Bacteria 12012
308 Ga0496121_0000053 3300048924 Bacteria 312611
309 Ga0496121_0009984 3300048924 Bacteria 10794
310 Ga0496121_0085820 3300048924 Bacteria 2476
311 Ga0496125_0000090 3300048928 Bacteria 214433
312 Ga0496125_0000877 3300048928 Bacteria 47865
313 Ga0496126_0002898 3300048929 Bacteria 22361
314 Ga0496126_0058883 3300048929 Bacteria 3462
315 Ga0501047_0000771 3300049581 Bacteria 33529
316 Ga0501047_0083006 3300049581 Bacteria 3080
317 Ga0501044_0001492 3300049823 Bacteria 27394
318 nmdc:mga0yw44_121991_c1 3300050492 Bacteria 1679
319 nmdc:mga0yw44_129829_c1 3300050492 Bacteria 1630
320 nmdc:mga05p37_296602_c1 3300050507 Bacteria 1922
321 nmdc:mga0n895_139276_c1 3300050512 Bacteria 2454
322 nmdc:mga0rr50_142659_c1 3300050513 Bacteria 1928
323 Ga0495601_0037592 3300053077 Bacteria 3027
324 Ga0495601_0055809 3300053077 Bacteria 2501
325 Ga0500651_0057201 3300053093 Bacteria 2441
326 Ga0500555_003662 3300053103 Bacteria 4374
327 Ga0500562_001102 3300053108 Bacteria 6638
328 Ga0500595_002066 3300053119 Bacteria 10256
329 Ga0500652_000002 3300053131 Bacteria 273315
330 Ga0500655_009436 3300053133 Bacteria 1760
331 Ga0500577_0000038 3300053142 Bacteria 29648
332 Ga0500634_0078890 3300053161 Bacteria 1702
333 Ga0500637_0001638 3300053178 Bacteria 9615
334 Ga0501082_0000074 3300060353 Bacteria 73246

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10005140 Ga0099794_100051405 370
2 3300035725 Ga0373947_0190731 Ga0373947_0190731_42_1232 396
3 3300005295 Ga0065707_10120068 Ga0065707_101200682 397
4 3300025926 Ga0207659_10138602 Ga0207659_101386021 397
5 3300025913 Ga0207695_10003032 Ga0207695_1000303219 400
6 3300030521 Ga0307511_10000937 Ga0307511_1000093728 406
7 3300053178 Ga0500637_0001638 Ga0500637_0001638_253_1515 406
8 3300025297 Ga0209758_1002042 Ga0209758_10020425 408
9 3300025910 Ga0207684_10120508 Ga0207684_101205081 409
10 3300025939 Ga0207665_10174697 Ga0207665_101746971 409
11 iso_pu_bacteria 8006984368 8006989575 412
12 iso_pu_bacteria 8054563764 8054564420 412
13 iso_pu_bacteria 2643221699 2644549819 413
14 3300025944 Ga0207661_10265926 Ga0207661_102659261 414
15 3300048907 Ga0496104_0258406 Ga0496104_0258406_124_1368 414
16 iso_pu_bacteria 2513237139 2513875143 414
17 iso_pu_bacteria 2802429603 2805919513 414
18 iso_pu_bacteria 2824696289 2824699969 414
19 iso_pu_bacteria 2847939898 2847943698 414
20 iso_pu_bacteria 2881364244 2881371307 414
21 3300003215 JGI25153J46596_10001651 JGI25153J46596_100016512 415
22 3300025297 Ga0209758_1005471 Ga0209758_10054715 415
23 3300025920 Ga0207649_10144205 Ga0207649_101442052 415
24 3300039438 Ga0436360_1222596 Ga0436360_1222596_128_1381 415
25 3300044656 Ga0466969_0005562 Ga0466969_0005562_333_1580 415
26 3300044684 Ga0466966_0002380 Ga0466966_0002380_10946_12193 415
27 3300044693 Ga0466961_0005117 Ga0466961_0005117_4864_6111 415
28 3300044706 Ga0466964_0001940 Ga0466964_0001940_2244_3491 415
29 3300044765 Ga0466970_0011980 Ga0466970_0011980_1131_2378 415
30 3300044842 Ga0466957_0005029 Ga0466957_0005029_2848_4095 415
31 iso_pu_bacteria 2894232714 2894236129 415
32 iso_pu_bacteria 2917554339 2917554542 415
33 iso_pu_bacteria 2939669807 2939673603 415
34 3300005344 Ga0070661_100145566 Ga0070661_1001455662 416
35 3300005436 Ga0070713_100125533 Ga0070713_1001255332 416
36 3300005455 Ga0070663_100055367 Ga0070663_1000553672 416
37 3300005455 Ga0070663_100094659 Ga0070663_1000946592 416
38 3300005456 Ga0070678_100053244 Ga0070678_1000532442 416
39 3300005548 Ga0070665_100024545 Ga0070665_1000245454 416
40 3300005618 Ga0068864_100000257 Ga0068864_1000002578 416
41 3300005719 Ga0068861_100024556 Ga0068861_1000245563 416
42 3300005841 Ga0068863_100000167 Ga0068863_10000016735 416
43 3300005842 Ga0068858_100000198 Ga0068858_10000019825 416
44 3300005937 Ga0081455_10021725 Ga0081455_100217252 416
45 3300006163 Ga0070715_10055098 Ga0070715_100550982 416
46 3300006844 Ga0075428_100054776 Ga0075428_1000547762 416
47 3300009092 Ga0105250_10028014 Ga0105250_100280142 416
48 3300009094 Ga0111539_10457418 Ga0111539_104574181 416
49 3300009098 Ga0105245_10123482 Ga0105245_101234821 416
50 3300009147 Ga0114129_10255978 Ga0114129_102559782 416
51 3300009148 Ga0105243_10166102 Ga0105243_101661021 416
52 3300009177 Ga0105248_10009341 Ga0105248_1000934112 416
53 3300013308 Ga0157375_10121012 Ga0157375_101210122 416
54 3300014325 Ga0163163_10211032 Ga0163163_102110322 416
55 3300014968 Ga0157379_10031450 Ga0157379_100314504 416
56 3300021384 Ga0213876_10031924 Ga0213876_100319242 416
57 3300021388 Ga0213875_10000011 Ga0213875_10000011231 416
58 3300025315 Ga0207697_10054875 Ga0207697_100548751 416
59 3300025901 Ga0207688_10037649 Ga0207688_100376492 416
60 3300025907 Ga0207645_10029447 Ga0207645_100294472 416
61 3300025911 Ga0207654_10009330 Ga0207654_100093302 416
62 3300025914 Ga0207671_10073980 Ga0207671_100739803 416
63 3300025918 Ga0207662_10050811 Ga0207662_100508112 416
64 3300025920 Ga0207649_10058140 Ga0207649_100581402 416
65 3300025933 Ga0207706_10030469 Ga0207706_100304694 416
66 3300025933 Ga0207706_10138678 Ga0207706_101386782 416
67 3300025941 Ga0207711_10025144 Ga0207711_100251443 416
68 3300025941 Ga0207711_10037098 Ga0207711_100370982 416
69 3300025972 Ga0207668_10175855 Ga0207668_101758551 416
70 3300026035 Ga0207703_10000189 Ga0207703_1000018932 416
71 3300026035 Ga0207703_10061776 Ga0207703_100617762 416
72 3300026067 Ga0207678_10068879 Ga0207678_100688792 416
73 3300026088 Ga0207641_10000120 Ga0207641_1000012070 416
74 3300026095 Ga0207676_10000424 Ga0207676_1000042432 416
75 3300026116 Ga0207674_10164084 Ga0207674_101640843 416
76 3300026121 Ga0207683_10075026 Ga0207683_100750262 416
77 3300028379 Ga0268266_10007933 Ga0268266_100079338 416
78 3300028379 Ga0268266_10041823 Ga0268266_100418233 416
79 3300028379 Ga0268266_10126621 Ga0268266_101266212 416
80 3300028786 Ga0307517_10000235 Ga0307517_1000023578 416
81 3300031241 Ga0265325_10004144 Ga0265325_100041444 416
82 3300031731 Ga0307405_10113796 Ga0307405_101137961 416
83 3300031824 Ga0307413_10049587 Ga0307413_100495872 416
84 3300031995 Ga0307409_100037173 Ga0307409_1000371732 416
85 3300032005 Ga0307411_10043179 Ga0307411_100431793 416
86 3300032005 Ga0307411_10222800 Ga0307411_102228001 416
87 3300032126 Ga0307415_100016602 Ga0307415_1000166023 416
88 3300033180 Ga0307510_10013610 Ga0307510_100136102 416
89 3300035692 Ga0373935_0014691 Ga0373935_0014691_1371_2621 416
90 3300035695 Ga0373927_0139703 Ga0373927_0139703_307_1557 416
91 3300035725 Ga0373947_0135902 Ga0373947_0135902_59_1309 416
92 3300037853 Ga0436364_0622718 Ga0436364_0622718_4788_6038 416
93 3300046455 Ga0495603_0024477 Ga0495603_0024477_1360_2610 416
94 3300046523 Ga0495644_0060955 Ga0495644_0060955_109_1359 416
95 3300046684 Ga0495669_0001626 Ga0495669_0001626_1417_2667 416
96 3300048903 Ga0496100_0001424 Ga0496100_0001424_7541_8791 416
97 3300048904 Ga0496101_0003301 Ga0496101_0003301_6105_7355 416
98 3300048905 Ga0496102_0127544 Ga0496102_0127544_438_1688 416
99 3300048906 Ga0496103_0045817 Ga0496103_0045817_810_2060 416
100 3300048907 Ga0496104_0016626 Ga0496104_0016626_1716_2966 416
101 3300048908 Ga0496105_0020513 Ga0496105_0020513_2384_3634 416
102 3300048908 Ga0496105_0043069 Ga0496105_0043069_775_2025 416
103 3300048908 Ga0496105_0158547 Ga0496105_0158547_159_1409 416
104 3300048909 Ga0496106_0025932 Ga0496106_0025932_344_1594 416
105 3300048909 Ga0496106_0122188 Ga0496106_0122188_611_1861 416
106 3300048910 Ga0496107_0009209 Ga0496107_0009209_427_1677 416
107 3300048911 Ga0496108_0046267 Ga0496108_0046267_643_1893 416
108 3300048911 Ga0496108_0130426 Ga0496108_0130426_35_1285 416
109 3300048911 Ga0496108_0133318 Ga0496108_0133318_720_1970 416
110 3300048912 Ga0496109_0040197 Ga0496109_0040197_407_1657 416
111 3300048912 Ga0496109_0046107 Ga0496109_0046107_1163_2413 416
112 3300048912 Ga0496109_0254023 Ga0496109_0254023_185_1435 416
113 3300048913 Ga0496110_0000935 Ga0496110_0000935_13887_15137 416
114 3300048913 Ga0496110_0018818 Ga0496110_0018818_1719_2969 416
115 3300048914 Ga0496111_0107641 Ga0496111_0107641_350_1600 416
116 3300048915 Ga0496112_0027672 Ga0496112_0027672_3713_4963 416
117 3300048915 Ga0496112_0071174 Ga0496112_0071174_1726_2976 416
118 3300048916 Ga0496113_0003554 Ga0496113_0003554_6024_7274 416
119 3300048916 Ga0496113_0013045 Ga0496113_0013045_2760_4010 416
120 3300048918 Ga0496115_0016550 Ga0496115_0016550_3718_4968 416
121 3300048921 Ga0496118_0011991 Ga0496118_0011991_1809_3059 416
122 3300048922 Ga0496119_0005547 Ga0496119_0005547_8760_10010 416
123 3300048924 Ga0496121_0000053 Ga0496121_0000053_186116_187366 416
124 3300048924 Ga0496121_0085820 Ga0496121_0085820_303_1553 416
125 3300048929 Ga0496126_0002898 Ga0496126_0002898_113_1456 416
126 3300050507 nmdc:mga05p37_296602_c1 nmdc:mga05p37_296602_c1_19_1269 416
127 3300053093 Ga0500651_0057201 Ga0500651_0057201_485_1735 416
128 3300053119 Ga0500595_002066 Ga0500595_002066_8537_9787 416
129 3300053161 Ga0500634_0078890 Ga0500634_0078890_271_1521 416
130 3300005329 Ga0070683_100041446 Ga0070683_1000414462 417
131 3300005336 Ga0070680_100004826 Ga0070680_1000048268 417
132 3300005336 Ga0070680_100013160 Ga0070680_1000131604 417
133 3300005344 Ga0070661_100130242 Ga0070661_1001302421 417
134 3300005353 Ga0070669_100131763 Ga0070669_1001317632 417
135 3300005354 Ga0070675_100053785 Ga0070675_1000537852 417
136 3300005355 Ga0070671_100114771 Ga0070671_1001147711 417
137 3300005436 Ga0070713_100083952 Ga0070713_1000839523 417
138 3300005445 Ga0070708_100018692 Ga0070708_1000186924 417
139 3300005457 Ga0070662_100021304 Ga0070662_1000213044 417
140 3300005458 Ga0070681_10004132 Ga0070681_100041328 417
141 3300005467 Ga0070706_100037262 Ga0070706_1000372622 417
142 3300005468 Ga0070707_100009420 Ga0070707_1000094209 417
143 3300005471 Ga0070698_100011791 Ga0070698_1000117918 417
144 3300005518 Ga0070699_100040986 Ga0070699_1000409861 417
145 3300005530 Ga0070679_100016698 Ga0070679_1000166982 417
146 3300005536 Ga0070697_100009354 Ga0070697_1000093545 417
147 3300005547 Ga0070693_100079284 Ga0070693_1000792842 417
148 3300005548 Ga0070665_100000939 Ga0070665_1000009393 417
149 3300006175 Ga0070712_100021870 Ga0070712_1000218703 417
150 3300006175 Ga0070712_100089267 Ga0070712_1000892672 417
151 3300006844 Ga0075428_100188296 Ga0075428_1001882962 417
152 3300009093 Ga0105240_10012470 Ga0105240_1001247011 417
153 3300010375 Ga0105239_10018257 Ga0105239_100182579 417
154 3300021388 Ga0213875_10001172 Ga0213875_100011722 417
155 3300025910 Ga0207684_10022465 Ga0207684_100224652 417
156 3300025912 Ga0207707_10003322 Ga0207707_100033227 417
157 3300025913 Ga0207695_10066465 Ga0207695_100664654 417
158 3300025914 Ga0207671_10213235 Ga0207671_102132351 417
159 3300025915 Ga0207693_10022458 Ga0207693_100224583 417
160 3300025915 Ga0207693_10025163 Ga0207693_100251633 417
161 3300025917 Ga0207660_10027484 Ga0207660_100274843 417
162 3300025921 Ga0207652_10006620 Ga0207652_100066205 417
163 3300025922 Ga0207646_10005677 Ga0207646_1000567711 417
164 3300025926 Ga0207659_10177617 Ga0207659_101776171 417
165 3300025929 Ga0207664_10092391 Ga0207664_100923911 417
166 3300025931 Ga0207644_10010597 Ga0207644_100105975 417
167 3300025933 Ga0207706_10023646 Ga0207706_100236465 417
168 3300025937 Ga0207669_10015295 Ga0207669_100152951 417
169 3300025944 Ga0207661_10049557 Ga0207661_100495571 417
170 3300025972 Ga0207668_10011930 Ga0207668_100119302 417
171 3300026121 Ga0207683_10024201 Ga0207683_100242014 417
172 3300027907 Ga0207428_10025214 Ga0207428_100252144 417
173 3300035691 Ga0373931_0002608 Ga0373931_0002608_4494_5747 417
174 3300035691 Ga0373931_0057854 Ga0373931_0057854_574_1827 417
175 3300037068 Ga0373925_0074277 Ga0373925_0074277_157_1410 417
176 3300037853 Ga0436364_0883536 Ga0436364_0883536_38280_39545 417
177 3300039437 Ga0436365_1095116 Ga0436365_1095116_2280_3533 417
178 3300048904 Ga0496101_0059353 Ga0496101_0059353_154_1407 417
179 3300048905 Ga0496102_0004527 Ga0496102_0004527_3027_4280 417
180 3300048907 Ga0496104_0031776 Ga0496104_0031776_626_1879 417
181 3300048909 Ga0496106_0021256 Ga0496106_0021256_3469_4722 417
182 3300048910 Ga0496107_0142707 Ga0496107_0142707_303_1556 417
183 3300048912 Ga0496109_0015946 Ga0496109_0015946_4116_5369 417
184 3300048912 Ga0496109_0041321 Ga0496109_0041321_2099_3352 417
185 3300048913 Ga0496110_0003779 Ga0496110_0003779_2150_3403 417
186 3300048917 Ga0496114_0017451 Ga0496114_0017451_3513_4766 417
187 3300048918 Ga0496115_0001274 Ga0496115_0001274_12779_14032 417
188 3300050492 nmdc:mga0yw44_121991_c1 nmdc:mga0yw44_121991_c1_89_1342 417
189 3300053077 Ga0495601_0037592 Ga0495601_0037592_1197_2450 417
190 3300053077 Ga0495601_0055809 Ga0495601_0055809_1141_2394 417
191 3300003791 Ga0055530_10000091 Ga0055530_100000914 418
192 3300005327 Ga0070658_10091198 Ga0070658_100911981 418
193 3300005335 Ga0070666_10056486 Ga0070666_100564862 418
194 3300005341 Ga0070691_10007112 Ga0070691_100071124 418
195 3300005355 Ga0070671_100012454 Ga0070671_1000124545 418
196 3300005356 Ga0070674_100006032 Ga0070674_1000060322 418
197 3300005366 Ga0070659_100000143 Ga0070659_10000014318 418
198 3300005366 Ga0070659_100007260 Ga0070659_1000072604 418
199 3300005367 Ga0070667_100033395 Ga0070667_1000333954 418
200 3300005436 Ga0070713_100284087 Ga0070713_1002840871 418
201 3300005445 Ga0070708_100059730 Ga0070708_1000597302 418
202 3300005456 Ga0070678_100002683 Ga0070678_10000268310 418
203 3300005458 Ga0070681_10009948 Ga0070681_100099483 418
204 3300005458 Ga0070681_10032905 Ga0070681_100329053 418
205 3300005468 Ga0070707_100255987 Ga0070707_1002559872 418
206 3300005530 Ga0070679_100033350 Ga0070679_1000333503 418
207 3300005548 Ga0070665_100000144 Ga0070665_10000014441 418
208 3300005548 Ga0070665_100000265 Ga0070665_1000002655 418
209 3300005548 Ga0070665_100006429 Ga0070665_10000642910 418
210 3300005548 Ga0070665_100317608 Ga0070665_1003176082 418
211 3300005563 Ga0068855_100016452 Ga0068855_1000164523 418
212 3300005617 Ga0068859_100003874 Ga0068859_1000038748 418
213 3300005841 Ga0068863_100001641 Ga0068863_10000164113 418
214 3300005842 Ga0068858_100003849 Ga0068858_1000038496 418
215 3300005843 Ga0068860_100009293 Ga0068860_1000092933 418
216 3300005937 Ga0081455_10001615 Ga0081455_100016155 418
217 3300005985 Ga0081539_10001495 Ga0081539_1000149525 418
218 3300006028 Ga0070717_10189291 Ga0070717_101892912 418
219 3300006931 Ga0097620_100003874 Ga0097620_1000038748 418
220 3300009093 Ga0105240_10046538 Ga0105240_100465384 418
221 3300009093 Ga0105240_10169945 Ga0105240_101699452 418
222 3300009147 Ga0114129_10429386 Ga0114129_104293862 418
223 3300009177 Ga0105248_10000489 Ga0105248_1000048939 418
224 3300009551 Ga0105238_10102617 Ga0105238_101026172 418
225 3300013308 Ga0157375_10130655 Ga0157375_101306552 418
226 3300014325 Ga0163163_10184536 Ga0163163_101845362 418
227 3300025250 Ga0209026_1007229 Ga0209026_10072293 418
228 3300025297 Ga0209758_1000217 Ga0209758_1000217109 418
229 3300025298 Ga0209050_1000029 Ga0209050_10000295 418
230 3300025302 Ga0207426_1028672 Ga0207426_10286722 418
231 3300025304 Ga0209257_1000271 Ga0209257_1000271117 418
232 3300025893 Ga0207682_10057623 Ga0207682_100576232 418
233 3300025900 Ga0207710_10000861 Ga0207710_100008618 418
234 3300025909 Ga0207705_10003884 Ga0207705_1000388411 418
235 3300025912 Ga0207707_10008145 Ga0207707_100081457 418
236 3300025913 Ga0207695_10007406 Ga0207695_1000740611 418
237 3300025915 Ga0207693_10072296 Ga0207693_100722963 418
238 3300025917 Ga0207660_10018746 Ga0207660_100187462 418
239 3300025921 Ga0207652_10011908 Ga0207652_100119083 418
240 3300025922 Ga0207646_10251922 Ga0207646_102519221 418
241 3300025925 Ga0207650_10032603 Ga0207650_100326033 418
242 3300025931 Ga0207644_10019606 Ga0207644_100196062 418
243 3300025932 Ga0207690_10000283 Ga0207690_1000028317 418
244 3300025932 Ga0207690_10031232 Ga0207690_100312324 418
245 3300025935 Ga0207709_10088079 Ga0207709_100880791 418
246 3300025938 Ga0207704_10001720 Ga0207704_100017206 418
247 3300025940 Ga0207691_10005669 Ga0207691_100056696 418
248 3300025941 Ga0207711_10001294 Ga0207711_1000129418 418
249 3300025941 Ga0207711_10072708 Ga0207711_100727081 418
250 3300025949 Ga0207667_10066555 Ga0207667_100665553 418
251 3300025961 Ga0207712_10006854 Ga0207712_100068542 418
252 3300025986 Ga0207658_10002499 Ga0207658_100024995 418
253 3300026035 Ga0207703_10003511 Ga0207703_100035115 418
254 3300026088 Ga0207641_10011694 Ga0207641_100116945 418
255 3300026089 Ga0207648_10017971 Ga0207648_100179714 418
256 3300026121 Ga0207683_10000755 Ga0207683_100007554 418
257 3300028379 Ga0268266_10000003 Ga0268266_10000003333 418
258 3300028379 Ga0268266_10000592 Ga0268266_1000059246 418
259 3300028381 Ga0268264_10183883 Ga0268264_101838832 418
260 3300028573 Ga0265334_10007691 Ga0265334_100076912 418
261 3300028577 Ga0265318_10002314 Ga0265318_100023144 418
262 3300028653 Ga0265323_10001191 Ga0265323_100011918 418
263 3300028666 Ga0265336_10000091 Ga0265336_1000009116 418
264 3300028800 Ga0265338_10000094 Ga0265338_1000009477 418
265 3300029957 Ga0265324_10011294 Ga0265324_100112943 418
266 3300031507 Ga0307509_10000003 Ga0307509_10000003298 418
267 3300031824 Ga0307413_10065900 Ga0307413_100659003 418
268 3300035171 Ga0373946_0014163 Ga0373946_0014163_672_1928 418
269 3300035695 Ga0373927_0000155 Ga0373927_0000155_15146_16402 418
270 3300037068 Ga0373925_0000050 Ga0373925_0000050_14870_16126 418
271 3300037466 Ga0395898_0008597 Ga0395898_0008597_486_1742 418
272 3300037471 Ga0395905_0148897 Ga0395905_0148897_700_1956 418
273 3300037471 Ga0395905_0173888 Ga0395905_0173888_458_1714 418
274 3300044694 Ga0466963_0217495 Ga0466963_0217495_64_1320 418
275 3300048913 Ga0496110_0211544 Ga0496110_0211544_162_1418 418
276 3300048918 Ga0496115_0000562 Ga0496115_0000562_14198_15454 418
277 3300048918 Ga0496115_0003355 Ga0496115_0003355_2339_3595 418
278 3300048924 Ga0496121_0009984 Ga0496121_0009984_2300_3556 418
279 3300048928 Ga0496125_0000090 Ga0496125_0000090_95481_96737 418
280 3300048928 Ga0496125_0000877 Ga0496125_0000877_17586_18842 418
281 3300048929 Ga0496126_0058883 Ga0496126_0058883_1874_3130 418
282 3300049581 Ga0501047_0000771 Ga0501047_0000771_24724_26058 418
283 3300049581 Ga0501047_0083006 Ga0501047_0083006_1487_2743 418
284 3300049823 Ga0501044_0001492 Ga0501044_0001492_27_1283 418
285 3300050492 nmdc:mga0yw44_129829_c1 nmdc:mga0yw44_129829_c1_61_1317 418
286 3300050513 nmdc:mga0rr50_142659_c1 nmdc:mga0rr50_142659_c1_400_1656 418
287 3300053103 Ga0500555_003662 Ga0500555_003662_445_1701 418
288 3300053108 Ga0500562_001102 Ga0500562_001102_863_2119 418
289 3300053131 Ga0500652_000002 Ga0500652_000002_63383_64639 418
290 3300053133 Ga0500655_009436 Ga0500655_009436_457_1713 418
291 3300053142 Ga0500577_0000038 Ga0500577_0000038_23608_24864 418
292 3300060353 Ga0501082_0000074 Ga0501082_0000074_69016_70275 418
293 3300025919 Ga0207657_10185010 Ga0207657_101850102 419
294 3300031852 Ga0307410_10040236 Ga0307410_100402362 419
295 3300032005 Ga0307411_10147990 Ga0307411_101479901 419
296 3300032126 Ga0307415_100074296 Ga0307415_1000742961 419
297 3300046616 Ga0495668_0064252 Ga0495668_0064252_641_1900 419
298 3300005327 Ga0070658_10000029 Ga0070658_1000002970 420
299 3300005333 Ga0070677_10000312 Ga0070677_100003128 420
300 3300005336 Ga0070680_100007661 Ga0070680_1000076618 420
301 3300005338 Ga0068868_100000001 Ga0068868_100000001257 420
302 3300005339 Ga0070660_100000437 Ga0070660_1000004379 420
303 3300005339 Ga0070660_100007310 Ga0070660_1000073108 420
304 3300005344 Ga0070661_100001016 Ga0070661_1000010166 420
305 3300005354 Ga0070675_100004415 Ga0070675_1000044154 420
306 3300005366 Ga0070659_100000001 Ga0070659_10000000198 420
307 3300005366 Ga0070659_100000968 Ga0070659_10000096816 420
308 3300005458 Ga0070681_10025926 Ga0070681_100259262 420
309 3300005530 Ga0070679_100000005 Ga0070679_10000000560 420
310 3300005544 Ga0070686_100000252 Ga0070686_10000025232 420
311 3300005548 Ga0070665_100000011 Ga0070665_1000000116 420
312 3300005841 Ga0068863_100083990 Ga0068863_1000839902 420
313 3300005843 Ga0068860_100016085 Ga0068860_1000160859 420
314 3300009551 Ga0105238_10172571 Ga0105238_101725712 420
315 3300021358 Ga0213873_10000006 Ga0213873_10000006170 420
316 3300021384 Ga0213876_10000004 Ga0213876_10000004676 420
317 3300021384 Ga0213876_10000217 Ga0213876_1000021737 420
318 3300021384 Ga0213876_10003872 Ga0213876_100038728 420
319 3300021384 Ga0213876_10012866 Ga0213876_100128661 420
320 3300025893 Ga0207682_10000533 Ga0207682_100005335 420
321 3300025909 Ga0207705_10000002 Ga0207705_10000002803 420
322 3300025912 Ga0207707_10040713 Ga0207707_100407134 420
323 3300025917 Ga0207660_10005447 Ga0207660_100054477 420
324 3300025919 Ga0207657_10002491 Ga0207657_100024912 420
325 3300025919 Ga0207657_10010246 Ga0207657_100102466 420
326 3300025919 Ga0207657_10013159 Ga0207657_100131598 420
327 3300025920 Ga0207649_10000106 Ga0207649_1000010662 420
328 3300025921 Ga0207652_10000036 Ga0207652_1000003659 420
329 3300025926 Ga0207659_10164139 Ga0207659_101641392 420
330 3300025932 Ga0207690_10000018 Ga0207690_10000018166 420
331 3300025932 Ga0207690_10002077 Ga0207690_1000207710 420
332 3300026023 Ga0207677_10000024 Ga0207677_1000002477 420
333 3300026088 Ga0207641_10006678 Ga0207641_100066786 420
334 3300028379 Ga0268266_10000063 Ga0268266_100000633 420
335 3300028381 Ga0268264_10019593 Ga0268264_100195936 420
336 3300031548 Ga0307408_100075879 Ga0307408_1000758792 420
337 3300031731 Ga0307405_10145320 Ga0307405_101453201 420
338 3300032005 Ga0307411_10042769 Ga0307411_100427692 420
339 3300039437 Ga0436365_0862833 Ga0436365_0862833_76653_77918 420
340 3300039437 Ga0436365_1189040 Ga0436365_1189040_4476_5741 420
341 3300039437 Ga0436365_1259102 Ga0436365_1259102_45560_46828 420
342 3300039450 Ga0436363_0387523 Ga0436363_0387523_391_1656 420
343 3300039453 Ga0436362_0949954 Ga0436362_0949954_25984_27249 420
344 3300050512 nmdc:mga0n895_139276_c1 nmdc:mga0n895_139276_c1_125_1390 420
345 3300000549 LJQas_1005695 LJQas_10056952 421

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12471

GTP_CH_N

GTP cyclohydrolase N terminal

7

195

0.98

PF00925

GTP_cyclohydro2

GTP cyclohydrolase II

220

372

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ej3-assembly1.cif.gz_B utp cyclohydrolase 0.9439 25 418
7ej3-assembly1.cif.gz_B utp cyclohydrolase 0.9235 25 418
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.6642 129 379
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.6578 129 379
2bz1-assembly1.cif.gz_A-2 crystal structure of apo e. coli gtp cyclohydrolase ii 0.6492 129 379
ID Description Score Start End Superfamily
af_Q9US41_242_400_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.8687 217 378 3.40.50.10990
af_Q9US41_242_400_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.8636 217 378 3.40.50.10990
4i14B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.716 221 376 3.40.50.10990
af_A0A1D6LPG1_1_132_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.7086 335 376 3.30.420.80
af_A0A0R0GI97_331_502_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.6786 221 379 3.40.50.10990
ID Description Score Start End GO Terms
AF-A0A258TEC2-F1-model_v4 deleted 0.949 29 275
AF-A0A1R1YIC3-F1-model_v4 Uracil-regulated protein 1 0.9454 25 417 GO:0003935
GO:0005525
GO:0009231
AF-A0A536VGU3-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.9441 73 418 GO:0003935
GO:0005525
GO:0009231
AF-A0A2T1D035-F1-model_v4 GTP cyclohydrolase II 0.9439 33 419 GO:0003935
GO:0005525
GO:0009231
AF-A0A7S1WIU3-F1-model_v4 GTP cyclohydrolase II 0.9376 13 417

Feature Viewer

pLDDT pTM Quality
80.71 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map