F416405

General Info

Members Datasets Scaffolds Average Seq Length
345 204 690 296

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10105788|Ga0207687_101057882
Length 330
Sequence MGISDAGFSLRALVRARPKGHRLKRFKMRINDPELMAAIADLGVEHRVGVSLAQKTSLEIGGTSDLLVIHKHEVLPPLIQLLKQTGTPHRFLGGGSNVLLPDGELPWVILQLARQDPDVRIEGNNVYVDCAADLGRTVTTCAKHDLGGMEGLIGVPGSVGGALRMNAGAYGTQIGTFVREVQVYRAATGRIEILRGAEINFEYRHTSFAVDDIMLSVRLELPSKPYSEILQGIRICNEKRRASQPLNQKSAGCIFKNPPGGSAGRMIDELGLKGHSVGDARVSDRHANFFINAGHASQADMLALIADVRLRVRDRFGVELEEEVIVWKDR

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
102 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.61
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10105788 3300025927 Bacteria 2079
2 Ga0065707_10141688 3300005295 Bacteria 1763
3 Ga0070658_10065428 3300005327 Bacteria 2967
4 Ga0070683_100036491 3300005329 Bacteria 4498
5 Ga0070677_10053205 3300005333 Bacteria 1645
6 Ga0068869_100200551 3300005334 Bacteria 1573
7 Ga0070680_100143754 3300005336 Bacteria 2001
8 Ga0070660_100013408 3300005339 Bacteria 5880
9 Ga0070660_100044719 3300005339 Bacteria 3388
10 Ga0070661_100000438 3300005344 Bacteria 31889
11 Ga0070674_100091369 3300005356 Bacteria 2198
12 Ga0070659_100028632 3300005366 Bacteria 4304
13 Ga0070703_10004762 3300005406 Bacteria 3796
14 Ga0070709_10001225 3300005434 Bacteria 14082
15 Ga0070709_10051778 3300005434 Bacteria 2578
16 Ga0070709_10076348 3300005434 Bacteria 2176
17 Ga0070709_10123650 3300005434 Unclassified 1757
18 Ga0070714_100015950 3300005435 Bacteria 6058
19 Ga0070714_100078816 3300005435 Bacteria 2864
20 Ga0070714_100172208 3300005435 Unclassified 1965
21 Ga0070713_100023052 3300005436 Bacteria 4822
22 Ga0070713_100051604 3300005436 Bacteria 3401
23 Ga0070713_100062265 3300005436 Unclassified 3125
24 Ga0070713_100066726 3300005436 Unclassified 3026
25 Ga0070713_100162248 3300005436 Bacteria 1996
26 Ga0070710_10015557 3300005437 Unclassified 3853
27 Ga0070711_100012407 3300005439 Bacteria 5323
28 Ga0070711_100445586 3300005439 Bacteria 1059
29 Ga0070711_100452788 3300005439 Bacteria 1051
30 Ga0070705_100004643 3300005440 Bacteria 6689
31 Ga0070705_100104986 3300005440 Bacteria 1793
32 Ga0070694_100001117 3300005444 Bacteria 15354
33 Ga0070708_100008307 3300005445 Bacteria 8336
34 Ga0070708_100024401 3300005445 Bacteria 5159
35 Ga0070708_100075922 3300005445 Unclassified 3034
36 Ga0070708_100089188 3300005445 Bacteria 2806
37 Ga0070706_100001800 3300005467 Bacteria 22190
38 Ga0070706_100009011 3300005467 Bacteria 9288
39 Ga0070706_100118540 3300005467 Bacteria 2466
40 Ga0070707_100000272 3300005468 Bacteria 51273
41 Ga0070707_100000399 3300005468 Bacteria 42939
42 Ga0070707_100396582 3300005468 Unclassified 1340
43 Ga0070698_100012524 3300005471 Bacteria 8981
44 Ga0070698_100017437 3300005471 Bacteria 7569
45 Ga0070699_100012403 3300005518 Bacteria 7354
46 Ga0070699_100057450 3300005518 Bacteria 3370
47 Ga0070699_100149928 3300005518 Bacteria 2062
48 Ga0070699_100269135 3300005518 Bacteria 1524
49 Ga0070684_100001168 3300005535 Bacteria 18835
50 Ga0070697_100010134 3300005536 Bacteria 7353
51 Ga0070697_100048008 3300005536 Bacteria 3461
52 Ga0070697_100167290 3300005536 Bacteria 1859
53 Ga0070697_100254951 3300005536 Bacteria 1501
54 Ga0070686_100238649 3300005544 Bacteria 1322
55 Ga0070695_100000842 3300005545 Bacteria 16570
56 Ga0070696_100003231 3300005546 Bacteria 10854
57 Ga0070693_100000160 3300005547 Bacteria 30875
58 Ga0070693_100080176 3300005547 Unclassified 1944
59 Ga0070693_100103971 3300005547 Bacteria 1735
60 Ga0070693_100249412 3300005547 Bacteria 1176
61 Ga0068855_100010041 3300005563 Bacteria 11411
62 Ga0068855_100037412 3300005563 Bacteria 5771
63 Ga0070664_100000572 3300005564 Bacteria 28020
64 Ga0068857_100002092 3300005577 Bacteria 16226
65 Ga0068854_100006703 3300005578 Bacteria 7341
66 Ga0068856_100000962 3300005614 Bacteria 30736
67 Ga0068852_100005676 3300005616 Bacteria 8948
68 Ga0068852_100037543 3300005616 Bacteria 4062
69 Ga0068851_10007808 3300005834 Bacteria 4925
70 Ga0068863_100002290 3300005841 Bacteria 19023
71 Ga0068858_100039559 3300005842 Bacteria 4372
72 Ga0068860_100004519 3300005843 Bacteria 14199
73 Ga0070715_10144895 3300006163 Bacteria 1158
74 Ga0070716_100000121 3300006173 Bacteria 30983
75 Ga0070716_100016285 3300006173 Bacteria 3833
76 Ga0070716_100028433 3300006173 Bacteria 3012
77 Ga0070716_100046642 3300006173 Bacteria 2440
78 Ga0070716_100098139 3300006173 Bacteria 1789
79 Ga0070716_100113095 3300006173 Bacteria 1686
80 Ga0070712_100058425 3300006175 Bacteria 2713
81 Ga0097621_100004726 3300006237 Bacteria 9511
82 Ga0068871_100032648 3300006358 Bacteria 4115
83 Ga0075433_10089997 3300006852 Bacteria 2713
84 Ga0075434_100051104 3300006871 Bacteria 4107
85 Ga0075436_100012709 3300006914 Bacteria 5770
86 Ga0075436_100033704 3300006914 Bacteria 3530
87 Ga0075436_100102110 3300006914 Bacteria 1997
88 Ga0075435_100134101 3300007076 Bacteria 2073
89 Ga0099794_10004672 3300007265 Bacteria 5418
90 Ga0099794_10004938 3300007265 Bacteria 5304
91 Ga0099794_10010594 3300007265 Bacteria 3920
92 Ga0099794_10016770 3300007265 Bacteria 3253
93 Ga0099794_10019882 3300007265 Bacteria 3033
94 Ga0099794_10042764 3300007265 Bacteria 2161
95 Ga0099794_10066134 3300007265 Unclassified 1764
96 Ga0099795_10003701 3300007788 Bacteria 3829
97 Ga0099795_10085186 3300007788 Bacteria 1216
98 Ga0105240_10014668 3300009093 Bacteria 10693
99 Ga0105240_10677030 3300009093 Unclassified 1128
100 Ga0105245_10009887 3300009098 Bacteria 8307
101 Ga0105242_10386658 3300009176 Bacteria 1302
102 Ga0105248_10094690 3300009177 Bacteria 3363
103 Ga0105248_10454667 3300009177 Unclassified 1443
104 Ga0105238_10000817 3300009551 Bacteria 32236
105 Ga0105249_10261341 3300009553 Bacteria 1720
106 Ga0105239_10093302 3300010375 Bacteria 3323
107 Ga0157373_10052356 3300013100 Bacteria 2905
108 Ga0157371_10083732 3300013102 Bacteria 2258
109 Ga0157370_10019199 3300013104 Bacteria 6868
110 Ga0157369_10007682 3300013105 Bacteria 12405
111 Ga0157369_10162322 3300013105 Bacteria 2358
112 Ga0157374_10191932 3300013296 Bacteria 1998
113 Ga0157378_10000053 3300013297 Bacteria 99982
114 Ga0157378_10030582 3300013297 Bacteria 4758
115 Ga0157378_10033291 3300013297 Bacteria 4555
116 Ga0163162_10026403 3300013306 Bacteria 5738
117 Ga0157372_10013594 3300013307 Bacteria 8701
118 Ga0157379_10376078 3300014968 Bacteria 1303
119 Ga0157376_10000036 3300014969 Bacteria 145496
120 Ga0157376_10003815 3300014969 Bacteria 10421
121 Ga0206353_11928148 3300020082 Bacteria 1483
122 Ga0213876_10041919 3300021384 Bacteria 2419
123 Ga0207682_10103752 3300025893 Bacteria 1245
124 Ga0207692_10164363 3300025898 Unclassified 1281
125 Ga0207710_10085235 3300025900 Unclassified 1471
126 Ga0207685_10009225 3300025905 Bacteria 2856
127 Ga0207699_10043384 3300025906 Bacteria 2612
128 Ga0207705_10008674 3300025909 Bacteria 7409
129 Ga0207684_10021912 3300025910 Bacteria 5455
130 Ga0207684_10117906 3300025910 Bacteria 2274
131 Ga0207684_10266829 3300025910 Bacteria 1477
132 Ga0207695_10501002 3300025913 Unclassified 1096
133 Ga0207663_10022377 3300025916 Bacteria 3612
134 Ga0207663_10035981 3300025916 Bacteria 2975
135 Ga0207663_10130273 3300025916 Unclassified 1737
136 Ga0207663_10368627 3300025916 Unclassified 1091
137 Ga0207663_10393184 3300025916 Bacteria 1059
138 Ga0207660_10176706 3300025917 Bacteria 1656
139 Ga0207657_10014525 3300025919 Bacteria 7679
140 Ga0207657_10015280 3300025919 Bacteria 7443
141 Ga0207649_10001556 3300025920 Bacteria 13422
142 Ga0207652_10056430 3300025921 Bacteria 3381
143 Ga0207652_10106626 3300025921 Unclassified 2480
144 Ga0207646_10000294 3300025922 Bacteria 67765
145 Ga0207646_10001298 3300025922 Bacteria 31112
146 Ga0207646_10002659 3300025922 Bacteria 20965
147 Ga0207694_10001640 3300025924 Bacteria 18831
148 Ga0207700_10118305 3300025928 Unclassified 2144
149 Ga0207700_10126924 3300025928 Bacteria 2077
150 Ga0207700_10127684 3300025928 Unclassified 2071
151 Ga0207700_10339972 3300025928 Unclassified 1305
152 Ga0207664_10002668 3300025929 Bacteria 11834
153 Ga0207690_10016087 3300025932 Bacteria 4547
154 Ga0207665_10000014 3300025939 Bacteria 137803
155 Ga0207665_10012199 3300025939 Bacteria 5643
156 Ga0207711_10325270 3300025941 Bacteria 1421
157 Ga0207679_10002117 3300025945 Bacteria 12310
158 Ga0207667_10000842 3300025949 Bacteria 39549
159 Ga0207640_10003132 3300025981 Bacteria 8898
160 Ga0207703_10020105 3300026035 Bacteria 5219
161 Ga0207702_10008088 3300026078 Bacteria 8896
162 Ga0207641_10003776 3300026088 Bacteria 13301
163 Ga0207674_10000182 3300026116 Bacteria 77228
164 Ga0207698_10004733 3300026142 Bacteria 8325
165 Ga0207698_10086747 3300026142 Bacteria 2546
166 Ga0209179_1012772 3300027512 Unclassified 1514
167 Ga0209179_1026700 3300027512 Bacteria 1160
168 Ga0209588_1000797 3300027671 Bacteria 7991
169 Ga0209588_1003493 3300027671 Bacteria 4366
170 Ga0209588_1007053 3300027671 Unclassified 3294
171 Ga0265354_1000040 3300028016 Bacteria 20750
172 Ga0265357_1004737 3300028023 Bacteria 1238
173 Ga0268266_10001848 3300028379 Bacteria 23892
174 Ga0268264_10023656 3300028381 Bacteria 5010
175 Ga0265319_1000537 3300028563 Bacteria 25933
176 Ga0265318_10001648 3300028577 Bacteria 12870
177 Ga0265338_10101139 3300028800 Bacteria 2348
178 Ga0265760_10000055 3300031090 Bacteria 32416
179 Ga0265332_10042037 3300031238 Bacteria 1976
180 Ga0265328_10052362 3300031239 Bacteria 1498
181 Ga0265320_10001066 3300031240 Bacteria 20316
182 Ga0265325_10005964 3300031241 Bacteria 7462
183 Ga0265329_10000040 3300031242 Bacteria 53851
184 Ga0265339_10000708 3300031249 Bacteria 25868
185 Ga0265331_10000021 3300031250 Bacteria 242632
186 Ga0265331_10016245 3300031250 Bacteria 3912
187 Ga0265316_10002466 3300031344 Bacteria 19192
188 Ga0265316_10015768 3300031344 Bacteria 6590
189 Ga0307408_100036309 3300031548 Bacteria 3464
190 Ga0265313_10002982 3300031595 Bacteria 14113
191 Ga0265313_10014989 3300031595 Bacteria 4546
192 Ga0265314_10007169 3300031711 Bacteria 9705
193 Ga0265342_10000032 3300031712 Bacteria 150633
194 Ga0307405_10151366 3300031731 Bacteria 1632
195 Ga0307413_10083216 3300031824 Bacteria 2058
196 Ga0307410_10150917 3300031852 Bacteria 1730
197 Ga0307406_10096387 3300031901 Bacteria 2004
198 Ga0307412_10089163 3300031911 Bacteria 2153
199 Ga0307409_100033808 3300031995 Bacteria 3726
200 Ga0307409_100041003 3300031995 Bacteria 3454
201 Ga0307409_100303040 3300031995 Bacteria 1487
202 Ga0307414_10385577 3300032004 Bacteria 1213
203 Ga0307411_10024637 3300032005 Bacteria 3590
204 Ga0307411_10030817 3300032005 Bacteria 3292
205 Ga0307415_100039719 3300032126 Bacteria 3113
206 Ga0373926_0004993 3300035083 Bacteria 4358
207 Ga0373926_0010260 3300035083 Bacteria 3137
208 Ga0373923_0007329 3300035111 Bacteria 3873
209 Ga0373953_0059106 3300035117 Unclassified 1564
210 Ga0373954_0013855 3300035118 Bacteria 3594
211 Ga0373957_0004156 3300035120 Bacteria 4375
212 Ga0373946_0014590 3300035171 Bacteria 2964
213 Ga0373955_0021628 3300035172 Bacteria 3251
214 Ga0373955_0159791 3300035172 Unclassified 1329
215 Ga0373931_0248264 3300035691 Bacteria 1081
216 Ga0373935_0007240 3300035692 Bacteria 6630
217 Ga0373927_0002942 3300035695 Bacteria 12372
218 Ga0373927_0009347 3300035695 Bacteria 6576
219 Ga0373933_0000092 3300035724 Bacteria 56195
220 Ga0373947_0003075 3300035725 Bacteria 9937
221 Ga0373937_0002321 3300036401 Bacteria 15898
222 Ga0373937_0104525 3300036401 Bacteria 2631
223 Ga0373937_0217201 3300036401 Unclassified 1799
224 Ga0373937_0218479 3300036401 Unclassified 1794
225 Ga0373937_0280699 3300036401 Bacteria 1573
226 Ga0373925_0015455 3300037068 Bacteria 5519
227 Ga0436365_1180636 3300039437 Unclassified 1444
228 Ga0436365_1855943 3300039437 Bacteria 4707
229 Ga0436363_1384523 3300039450 Bacteria 2482
230 Ga0436362_0721113 3300039453 Unclassified 1563
231 Ga0451577_0029224 3300042876 Bacteria 4982
232 Ga0451577_0416626 3300042876 Bacteria 1219
233 Ga0453683_0002452 3300044673 Bacteria 14370
234 Ga0453683_0006740 3300044673 Bacteria 7851
235 Ga0453683_0191323 3300044673 Bacteria 1298
236 Ga0453683_0278962 3300044673 Unclassified 1067
237 Ga0453684_0031173 3300044712 Bacteria 7501
238 Ga0453684_0138270 3300044712 Bacteria 2913
239 Ga0466967_0616923 3300045976 Bacteria 1071
240 Ga0495592_0020281 3300046454 Bacteria 5056
241 Ga0495629_0023289 3300046459 Bacteria 4413
242 Ga0495641_0030764 3300046461 Bacteria 2570
243 Ga0495651_0000242 3300046462 Bacteria 42232
244 Ga0495651_0004295 3300046462 Bacteria 10926
245 Ga0495651_0014501 3300046462 Bacteria 6093
246 Ga0495651_0027645 3300046462 Bacteria 4420
247 Ga0495653_0004996 3300046463 Bacteria 10762
248 Ga0495653_0012085 3300046463 Bacteria 7044
249 Ga0495653_0073068 3300046463 Bacteria 2560
250 Ga0495580_0002568 3300046472 Bacteria 15791
251 Ga0495580_0087997 3300046472 Bacteria 2163
252 Ga0495580_0091958 3300046472 Bacteria 2111
253 Ga0495582_0000161 3300046473 Bacteria 36312
254 Ga0495582_0011495 3300046473 Bacteria 4877
255 Ga0495639_0042694 3300046475 Bacteria 2046
256 Ga0495662_0183100 3300046476 Bacteria 1032
257 Ga0495594_0111631 3300046499 Bacteria 1541
258 Ga0495608_0004687 3300046511 Bacteria 9783
259 Ga0495608_0007148 3300046511 Bacteria 7898
260 Ga0495608_0060337 3300046511 Bacteria 2496
261 Ga0495618_0019657 3300046514 Bacteria 4157
262 Ga0495618_0081239 3300046514 Bacteria 2069
263 Ga0495628_0001873 3300046516 Bacteria 19116
264 Ga0495628_0024772 3300046516 Bacteria 4908
265 Ga0495630_0021854 3300046517 Bacteria 4724
266 Ga0495630_0025576 3300046517 Bacteria 4366
267 Ga0495630_0070264 3300046517 Bacteria 2634
268 Ga0495630_0081122 3300046517 Bacteria 2448
269 Ga0495666_0007852 3300046526 Bacteria 5343
270 Ga0495666_0019946 3300046526 Bacteria 3326
271 Ga0495652_0002087 3300046529 Bacteria 21124
272 Ga0495665_0009111 3300046531 Bacteria 5379
273 Ga0495586_0009816 3300046535 Bacteria 5097
274 Ga0495587_0001224 3300046536 Bacteria 16987
275 Ga0495587_0004384 3300046536 Bacteria 9306
276 Ga0495587_0033456 3300046536 Bacteria 3104
277 Ga0495645_0001670 3300046543 Bacteria 15078
278 Ga0495667_0002611 3300046559 Bacteria 12032
279 Ga0495667_0013345 3300046559 Bacteria 5561
280 Ga0495634_0025630 3300046642 Bacteria 4120
281 Ga0495657_0004063 3300046675 Bacteria 11736
282 Ga0495657_0080205 3300046675 Bacteria 2112
283 Ga0495657_0099259 3300046675 Unclassified 1857
284 Ga0495599_0002738 3300046678 Bacteria 10279
285 Ga0495599_0058424 3300046678 Bacteria 2413
286 Ga0495646_0004322 3300046680 Bacteria 8955
287 Ga0495646_0277037 3300046680 Bacteria 892
288 Ga0495647_0002014 3300046681 Bacteria 6345
289 Ga0495658_0108500 3300046683 Bacteria 1666
290 Ga0495613_0004013 3300046689 Bacteria 11017
291 Ga0495613_0050180 3300046689 Bacteria 3078
292 Ga0495613_0056673 3300046689 Bacteria 2877
293 Ga0495613_0113870 3300046689 Unclassified 1947
294 Ga0495624_0046652 3300046690 Bacteria 2754
295 Ga0495624_0256837 3300046690 Bacteria 1056
296 Ga0495600_0056660 3300046809 Bacteria 2561
297 Ga0495581_0021740 3300047315 Bacteria 3716
298 Ga0495604_0000536 3300047317 Bacteria 33451
299 Ga0495604_0010192 3300047317 Bacteria 7445
300 Ga0495604_0016979 3300047317 Bacteria 5822
301 Ga0495604_0069892 3300047317 Bacteria 2660
302 Ga0495674_0002456 3300047319 Bacteria 18112
303 Ga0495674_0020281 3300047319 Bacteria 6156
304 Ga0495674_0024337 3300047319 Bacteria 5564
305 Ga0495674_0042265 3300047319 Bacteria 4067
306 Ga0495676_0019693 3300047321 Bacteria 5932
307 Ga0495676_0101993 3300047321 Bacteria 2121
308 Ga0495680_0000126 3300047322 Bacteria 75130
309 Ga0495680_0004585 3300047322 Bacteria 13178
310 Ga0495680_0016290 3300047322 Bacteria 6392
311 Ga0495675_0000296 3300047444 Bacteria 35737
312 Ga0495675_0246874 3300047444 Bacteria 1073
313 Ga0495684_0013372 3300047471 Bacteria 6319
314 Ga0495684_0016034 3300047471 Bacteria 5768
315 Ga0495684_0033415 3300047471 Bacteria 3945
316 Ga0495684_0111660 3300047471 Unclassified 2062
317 Ga0495593_0020914 3300047673 Bacteria 3658
318 Ga0495593_0108294 3300047673 Bacteria 1420
319 Ga0495602_0010126 3300048088 Bacteria 9787
320 Ga0495602_0011526 3300048088 Bacteria 9135
321 Ga0495602_0050578 3300048088 Bacteria 3711
322 Ga0495614_0014626 3300048089 Bacteria 3432
323 Ga0495614_0016856 3300048089 Bacteria 3178
324 Ga0495614_0117323 3300048089 Bacteria 1172
325 Ga0496101_0145810 3300048904 Bacteria 1808
326 Ga0496102_0003185 3300048905 Bacteria 13912
327 Ga0496106_0064157 3300048909 Bacteria 2794
328 Ga0496107_0204375 3300048910 Bacteria 1468
329 Ga0496112_0102162 3300048915 Bacteria 2837
330 Ga0496114_0005942 3300048917 Bacteria 9596
331 Ga0496115_0001445 3300048918 Bacteria 17029
332 Ga0496115_0006220 3300048918 Bacteria 8734
333 Ga0496115_0025039 3300048918 Bacteria 4643
334 Ga0501076_0231951 3300049592 Bacteria 1509
335 nmdc:mga0n895_149796_c1 3300050512 Bacteria 2363
336 nmdc:mga0n895_18369_c1 3300050512 Bacteria 6468
337 nmdc:mga08x19_18613_c2 3300050514 Bacteria 3594
338 nmdc:mga08x19_202658_c1 3300050514 Bacteria 1360
339 nmdc:mga08x19_3010_c1 3300050514 Bacteria 10130
340 nmdc:mga08x19_3396_c1 3300050514 Bacteria 9497
341 nmdc:mga0a205_144453_c1 3300050515 Bacteria 2279
342 nmdc:mga0a205_518723_c1 3300050515 Bacteria 1048
343 Ga0495601_0107823 3300053077 Bacteria 1802
344 Ga0495612_0003642 3300053078 Bacteria 6387
345 Ga0495619_0012146 3300053085 Bacteria 5423
346 Ga0207687_10105788
347 Ga0065707_10141688
348 Ga0070658_10065428
349 Ga0070683_100036491
350 Ga0070677_10053205
351 Ga0068869_100200551
352 Ga0070680_100143754
353 Ga0070660_100013408
354 Ga0070660_100044719
355 Ga0070661_100000438
356 Ga0070674_100091369
357 Ga0070659_100028632
358 Ga0070703_10004762
359 Ga0070709_10001225
360 Ga0070709_10051778
361 Ga0070709_10076348
362 Ga0070709_10123650
363 Ga0070714_100015950
364 Ga0070714_100078816
365 Ga0070714_100172208
366 Ga0070713_100023052
367 Ga0070713_100051604
368 Ga0070713_100062265
369 Ga0070713_100066726
370 Ga0070713_100162248
371 Ga0070710_10015557
372 Ga0070711_100012407
373 Ga0070711_100445586
374 Ga0070711_100452788
375 Ga0070705_100004643
376 Ga0070705_100104986
377 Ga0070694_100001117
378 Ga0070708_100008307
379 Ga0070708_100024401
380 Ga0070708_100075922
381 Ga0070708_100089188
382 Ga0070706_100001800
383 Ga0070706_100009011
384 Ga0070706_100118540
385 Ga0070707_100000272
386 Ga0070707_100000399
387 Ga0070707_100396582
388 Ga0070698_100012524
389 Ga0070698_100017437
390 Ga0070699_100012403
391 Ga0070699_100057450
392 Ga0070699_100149928
393 Ga0070699_100269135
394 Ga0070684_100001168
395 Ga0070697_100010134
396 Ga0070697_100048008
397 Ga0070697_100167290
398 Ga0070697_100254951
399 Ga0070686_100238649
400 Ga0070695_100000842
401 Ga0070696_100003231
402 Ga0070693_100000160
403 Ga0070693_100080176
404 Ga0070693_100103971
405 Ga0070693_100249412
406 Ga0068855_100010041
407 Ga0068855_100037412
408 Ga0070664_100000572
409 Ga0068857_100002092
410 Ga0068854_100006703
411 Ga0068856_100000962
412 Ga0068852_100005676
413 Ga0068852_100037543
414 Ga0068851_10007808
415 Ga0068863_100002290
416 Ga0068858_100039559
417 Ga0068860_100004519
418 Ga0070715_10144895
419 Ga0070716_100000121
420 Ga0070716_100016285
421 Ga0070716_100028433
422 Ga0070716_100046642
423 Ga0070716_100098139
424 Ga0070716_100113095
425 Ga0070712_100058425
426 Ga0097621_100004726
427 Ga0068871_100032648
428 Ga0075433_10089997
429 Ga0075434_100051104
430 Ga0075436_100012709
431 Ga0075436_100033704
432 Ga0075436_100102110
433 Ga0075435_100134101
434 Ga0099794_10004672
435 Ga0099794_10004938
436 Ga0099794_10010594
437 Ga0099794_10016770
438 Ga0099794_10019882
439 Ga0099794_10042764
440 Ga0099794_10066134
441 Ga0099795_10003701
442 Ga0099795_10085186
443 Ga0105240_10014668
444 Ga0105240_10677030
445 Ga0105245_10009887
446 Ga0105242_10386658
447 Ga0105248_10094690
448 Ga0105248_10454667
449 Ga0105238_10000817
450 Ga0105249_10261341
451 Ga0105239_10093302
452 Ga0157373_10052356
453 Ga0157371_10083732
454 Ga0157370_10019199
455 Ga0157369_10007682
456 Ga0157369_10162322
457 Ga0157374_10191932
458 Ga0157378_10000053
459 Ga0157378_10030582
460 Ga0157378_10033291
461 Ga0163162_10026403
462 Ga0157372_10013594
463 Ga0157379_10376078
464 Ga0157376_10000036
465 Ga0157376_10003815
466 Ga0206353_11928148
467 Ga0213876_10041919
468 Ga0207682_10103752
469 Ga0207692_10164363
470 Ga0207710_10085235
471 Ga0207685_10009225
472 Ga0207699_10043384
473 Ga0207705_10008674
474 Ga0207684_10021912
475 Ga0207684_10117906
476 Ga0207684_10266829
477 Ga0207695_10501002
478 Ga0207663_10022377
479 Ga0207663_10035981
480 Ga0207663_10130273
481 Ga0207663_10368627
482 Ga0207663_10393184
483 Ga0207660_10176706
484 Ga0207657_10014525
485 Ga0207657_10015280
486 Ga0207649_10001556
487 Ga0207652_10056430
488 Ga0207652_10106626
489 Ga0207646_10000294
490 Ga0207646_10001298
491 Ga0207646_10002659
492 Ga0207694_10001640
493 Ga0207700_10118305
494 Ga0207700_10126924
495 Ga0207700_10127684
496 Ga0207700_10339972
497 Ga0207664_10002668
498 Ga0207690_10016087
499 Ga0207665_10000014
500 Ga0207665_10012199
501 Ga0207711_10325270
502 Ga0207679_10002117
503 Ga0207667_10000842
504 Ga0207640_10003132
505 Ga0207703_10020105
506 Ga0207702_10008088
507 Ga0207641_10003776
508 Ga0207674_10000182
509 Ga0207698_10004733
510 Ga0207698_10086747
511 Ga0209179_1012772
512 Ga0209179_1026700
513 Ga0209588_1000797
514 Ga0209588_1003493
515 Ga0209588_1007053
516 Ga0265354_1000040
517 Ga0265357_1004737
518 Ga0268266_10001848
519 Ga0268264_10023656
520 Ga0265319_1000537
521 Ga0265318_10001648
522 Ga0265338_10101139
523 Ga0265760_10000055
524 Ga0265332_10042037
525 Ga0265328_10052362
526 Ga0265320_10001066
527 Ga0265325_10005964
528 Ga0265329_10000040
529 Ga0265339_10000708
530 Ga0265331_10000021
531 Ga0265331_10016245
532 Ga0265316_10002466
533 Ga0265316_10015768
534 Ga0307408_100036309
535 Ga0265313_10002982
536 Ga0265313_10014989
537 Ga0265314_10007169
538 Ga0265342_10000032
539 Ga0307405_10151366
540 Ga0307413_10083216
541 Ga0307410_10150917
542 Ga0307406_10096387
543 Ga0307412_10089163
544 Ga0307409_100033808
545 Ga0307409_100041003
546 Ga0307409_100303040
547 Ga0307414_10385577
548 Ga0307411_10024637
549 Ga0307411_10030817
550 Ga0307415_100039719
551 Ga0373926_0004993
552 Ga0373926_0010260
553 Ga0373923_0007329
554 Ga0373953_0059106
555 Ga0373954_0013855
556 Ga0373957_0004156
557 Ga0373946_0014590
558 Ga0373955_0021628
559 Ga0373955_0159791
560 Ga0373931_0248264
561 Ga0373935_0007240
562 Ga0373927_0002942
563 Ga0373927_0009347
564 Ga0373933_0000092
565 Ga0373947_0003075
566 Ga0373937_0002321
567 Ga0373937_0104525
568 Ga0373937_0217201
569 Ga0373937_0218479
570 Ga0373937_0280699
571 Ga0373925_0015455
572 Ga0436365_1180636
573 Ga0436365_1855943
574 Ga0436363_1384523
575 Ga0436362_0721113
576 Ga0451577_0029224
577 Ga0451577_0416626
578 Ga0453683_0002452
579 Ga0453683_0006740
580 Ga0453683_0191323
581 Ga0453683_0278962
582 Ga0453684_0031173
583 Ga0453684_0138270
584 Ga0466967_0616923
585 Ga0495592_0020281
586 Ga0495629_0023289
587 Ga0495641_0030764
588 Ga0495651_0000242
589 Ga0495651_0004295
590 Ga0495651_0014501
591 Ga0495651_0027645
592 Ga0495653_0004996
593 Ga0495653_0012085
594 Ga0495653_0073068
595 Ga0495580_0002568
596 Ga0495580_0087997
597 Ga0495580_0091958
598 Ga0495582_0000161
599 Ga0495582_0011495
600 Ga0495639_0042694
601 Ga0495662_0183100
602 Ga0495594_0111631
603 Ga0495608_0004687
604 Ga0495608_0007148
605 Ga0495608_0060337
606 Ga0495618_0019657
607 Ga0495618_0081239
608 Ga0495628_0001873
609 Ga0495628_0024772
610 Ga0495630_0021854
611 Ga0495630_0025576
612 Ga0495630_0070264
613 Ga0495630_0081122
614 Ga0495666_0007852
615 Ga0495666_0019946
616 Ga0495652_0002087
617 Ga0495665_0009111
618 Ga0495586_0009816
619 Ga0495587_0001224
620 Ga0495587_0004384
621 Ga0495587_0033456
622 Ga0495645_0001670
623 Ga0495667_0002611
624 Ga0495667_0013345
625 Ga0495634_0025630
626 Ga0495657_0004063
627 Ga0495657_0080205
628 Ga0495657_0099259
629 Ga0495599_0002738
630 Ga0495599_0058424
631 Ga0495646_0004322
632 Ga0495646_0277037
633 Ga0495647_0002014
634 Ga0495658_0108500
635 Ga0495613_0004013
636 Ga0495613_0050180
637 Ga0495613_0056673
638 Ga0495613_0113870
639 Ga0495624_0046652
640 Ga0495624_0256837
641 Ga0495600_0056660
642 Ga0495581_0021740
643 Ga0495604_0000536
644 Ga0495604_0010192
645 Ga0495604_0016979
646 Ga0495604_0069892
647 Ga0495674_0002456
648 Ga0495674_0020281
649 Ga0495674_0024337
650 Ga0495674_0042265
651 Ga0495676_0019693
652 Ga0495676_0101993
653 Ga0495680_0000126
654 Ga0495680_0004585
655 Ga0495680_0016290
656 Ga0495675_0000296
657 Ga0495675_0246874
658 Ga0495684_0013372
659 Ga0495684_0016034
660 Ga0495684_0033415
661 Ga0495684_0111660
662 Ga0495593_0020914
663 Ga0495593_0108294
664 Ga0495602_0010126
665 Ga0495602_0011526
666 Ga0495602_0050578
667 Ga0495614_0014626
668 Ga0495614_0016856
669 Ga0495614_0117323
670 Ga0496101_0145810
671 Ga0496102_0003185
672 Ga0496106_0064157
673 Ga0496107_0204375
674 Ga0496112_0102162
675 Ga0496114_0005942
676 Ga0496115_0001445
677 Ga0496115_0006220
678 Ga0496115_0025039
679 Ga0501076_0231951
680 nmdc:mga0n895_149796_c1
681 nmdc:mga0n895_18369_c1
682 nmdc:mga08x19_18613_c2
683 nmdc:mga08x19_202658_c1
684 nmdc:mga08x19_3010_c1
685 nmdc:mga08x19_3396_c1
686 nmdc:mga0a205_144453_c1
687 nmdc:mga0a205_518723_c1
688 Ga0495601_0107823
689 Ga0495612_0003642
690 Ga0495619_0012146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02873

MurB_C

UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain

228

327

0.95

PF01565

FAD_binding_4

FAD binding domain

66

195

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyt-assembly1.cif.gz_A crystal structure of a murb family ep-udp-n-acetylglucosamine reductase 0.9131 5 302
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.9103 5 302
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.9015 8 302
1hsk-assembly1.cif.gz_A crystal structure of s. aureus murb 0.896 5 302
3tx1-assembly1.cif.gz_A x-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb) 0.8899 8 302
ID Description Score Start End Superfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9737 218 302 3.90.78.10
3i99A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9508 223 297 3.90.78.10
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9413 218 302 3.90.78.10
2gquA03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.8995 220 301 3.90.78.10
3tx1A02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8966 92 217 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A1V5TW97-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.3.1.98) (UDP-N-acetylmuramate dehydrogenase) 0.9829 203 297 GO:0005829
GO:0008360
GO:0008762
GO:0009252
GO:0050660
GO:0051301
GO:0071555
AF-A0A3N5RV35-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9825 225 302 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A353CRP8-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.982 194 302 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-X1F496-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase C-terminal domain-containing protein 0.9783 225 302 GO:0005829
GO:0008762
GO:0050660
GO:0071555
AF-A0A0S8A7P8-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase 0.9771 200 302 GO:0005829
GO:0008762
GO:0050660
GO:0071555

Map