F416362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 345 | 274 | 243 | 389 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10031716|Ga0105237_100317163 |
| Length | 439 |
| Sequence | VEDLHRSPQTIERDNRLIVIFRDAPIKFAVGGGCPWRRAAETIMFEGHDPWLVALSVAIAILGGYTGFSLAARVRAAPGGGRRVLLAGAAAFLAVGIWTMHFVGVLAAPIPSDAVYLVLPTIISFLICALVVGISLFFVSIGEPTLLRVASSAVLLGLGIVSMHYAGIHGLAGNFVIAHDWSMVVLSIAVAIGTAYGGLRAFLARQDGVRLIASSIAFGVAVSGMHYTAMHGMHFEPISAAGHXXXGGGLAASPQILSIVVSVLCFVIAAGFLLSLVPDPRRQASPAVGPVAEPALPEAGPVTLTSPRLMPAPLGGLGQPPRPSPVPRLPVEGANGTHFIDATEVRSVRADAHYTRVHDGTRERMCPWSISEAEAQLDPGLFVRVHRSHIVAIPHVTFVRKEGDGAVIELDGPTPHRVPVSRAKIAEVKARLGLARKHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 4 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 5 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 6 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 7 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 10 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 11 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 12 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 13 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 14 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 15 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 16 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 17 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 18 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 19 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 20 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 21 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 22 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 23 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 24 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 25 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 26 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 27 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 28 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 29 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 30 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 31 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 32 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 33 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 34 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 35 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 36 | 2922368715 | |||
| 37 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 38 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 39 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 40 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 41 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 42 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 43 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 44 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 45 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 46 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 47 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 48 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 49 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 50 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 51 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 52 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 53 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 54 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 55 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 56 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 57 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 58 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 59 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 60 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 61 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 62 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 63 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 64 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 65 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 66 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 67 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 68 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 69 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 70 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 71 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 72 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 73 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 74 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 75 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 76 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 77 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 78 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 79 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 80 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 81 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 82 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 83 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 84 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 85 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 86 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 87 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 88 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 89 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 90 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 91 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 92 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 122 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 123 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 159 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 229 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 247 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 248 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 249 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 250 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 251 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 252 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 253 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 254 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 255 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 256 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 257 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 259 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 260 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 261 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 262 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 263 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 264 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 265 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 266 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 267 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 268 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 269 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 270 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 271 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 272 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 273 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 274 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.35 |
| Metatranscriptomes | 0.29 |
| Isolates | 29.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.41 |
| Nodule | 24.64 |
| Rhizoplane | 4.06 |
| Rhizosphere | 49.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10116622 | 3300003323 | Bacteria | 1464 |
| 2 | JGI25404J52841_10005926 | 3300003659 | Bacteria | 2538 |
| 3 | JGI25404J52841_10008905 | 3300003659 | Bacteria | 2143 |
| 4 | Ga0070683_100025576 | 3300005329 | Bacteria | 5303 |
| 5 | Ga0070683_100072246 | 3300005329 | Bacteria | 3220 |
| 6 | Ga0070680_100045758 | 3300005336 | Bacteria | 3558 |
| 7 | Ga0070671_100111823 | 3300005355 | Bacteria | 2294 |
| 8 | Ga0070709_10003812 | 3300005434 | Bacteria | 8109 |
| 9 | Ga0070709_10015240 | 3300005434 | Bacteria | 4369 |
| 10 | Ga0070714_100017621 | 3300005435 | Bacteria | 5788 |
| 11 | Ga0070714_100081343 | 3300005435 | Bacteria | 2819 |
| 12 | Ga0070714_100103159 | 3300005435 | Bacteria | 2515 |
| 13 | Ga0070714_100240419 | 3300005435 | Bacteria | 1671 |
| 14 | Ga0070713_100040332 | 3300005436 | Bacteria | 3795 |
| 15 | Ga0070713_100080516 | 3300005436 | Bacteria | 2777 |
| 16 | Ga0070710_10009715 | 3300005437 | Bacteria | 4713 |
| 17 | Ga0070710_10051742 | 3300005437 | Bacteria | 2307 |
| 18 | Ga0070711_100006521 | 3300005439 | Bacteria | 7041 |
| 19 | Ga0070711_100100135 | 3300005439 | Bacteria | 2107 |
| 20 | Ga0070663_100220024 | 3300005455 | Bacteria | 1490 |
| 21 | Ga0070681_10037152 | 3300005458 | Bacteria | 4888 |
| 22 | Ga0070681_10107989 | 3300005458 | Bacteria | 2723 |
| 23 | Ga0070679_100068438 | 3300005530 | Bacteria | 3541 |
| 24 | Ga0070679_100125293 | 3300005530 | Bacteria | 2551 |
| 25 | Ga0070684_100025988 | 3300005535 | Bacteria | 4928 |
| 26 | Ga0070684_100123789 | 3300005535 | Bacteria | 2327 |
| 27 | Ga0070697_100089071 | 3300005536 | Bacteria | 2549 |
| 28 | Ga0068857_100058358 | 3300005577 | Bacteria | 3427 |
| 29 | Ga0068856_100223586 | 3300005614 | Bacteria | 1898 |
| 30 | Ga0068863_100138846 | 3300005841 | Bacteria | 2323 |
| 31 | Ga0081455_10010152 | 3300005937 | Bacteria | 9592 |
| 32 | Ga0081455_10083839 | 3300005937 | Bacteria | 2603 |
| 33 | Ga0081540_1002134 | 3300005983 | Bacteria | 16458 |
| 34 | Ga0081540_1006679 | 3300005983 | Bacteria | 8346 |
| 35 | Ga0081540_1022175 | 3300005983 | Bacteria | 3754 |
| 36 | Ga0081540_1043573 | 3300005983 | Bacteria | 2300 |
| 37 | Ga0081540_1061513 | 3300005983 | Bacteria | 1789 |
| 38 | Ga0070715_10005070 | 3300006163 | Bacteria | 4369 |
| 39 | Ga0070716_100023688 | 3300006173 | Bacteria | 3258 |
| 40 | Ga0070712_100023454 | 3300006175 | Bacteria | 4077 |
| 41 | Ga0075434_100007552 | 3300006871 | Bacteria | 10072 |
| 42 | Ga0079104_1001597 | 3300006946 | Bacteria | 14779 |
| 43 | Ga0075435_100164925 | 3300007076 | Bacteria | 1868 |
| 44 | Ga0099794_10056257 | 3300007265 | Bacteria | 1903 |
| 45 | Ga0105240_10095810 | 3300009093 | Bacteria | 3618 |
| 46 | Ga0105240_10203403 | 3300009093 | Bacteria | 2319 |
| 47 | Ga0105237_10031716 | 3300009545 | Bacteria | 5353 |
| 48 | Ga0105238_10111854 | 3300009551 | Bacteria | 2711 |
| 49 | Ga0123340_1004720 | 3300009763 | Bacteria | 12964 |
| 50 | Ga0123341_1003157 | 3300009765 | Bacteria | 13995 |
| 51 | Ga0099796_10059257 | 3300010159 | Bacteria | 1352 |
| 52 | Ga0105239_10065045 | 3300010375 | Bacteria | 4004 |
| 53 | Ga0105239_10157760 | 3300010375 | Bacteria | 2535 |
| 54 | Ga0157374_10076445 | 3300013296 | Bacteria | 3166 |
| 55 | Ga0157378_10058109 | 3300013297 | Bacteria | 3449 |
| 56 | Ga0157379_10044776 | 3300014968 | Bacteria | 3950 |
| 57 | Ga0213872_10007142 | 3300021361 | Bacteria | 5521 |
| 58 | Ga0213876_10051081 | 3300021384 | Bacteria | 2185 |
| 59 | Ga0209677_100233 | 3300025253 | Bacteria | 39376 |
| 60 | Ga0209148_1000232 | 3300025254 | Bacteria | 90923 |
| 61 | Ga0209148_1009243 | 3300025254 | Bacteria | 1932 |
| 62 | Ga0209233_1003242 | 3300025261 | Bacteria | 5767 |
| 63 | Ga0209233_1005429 | 3300025261 | Bacteria | 4230 |
| 64 | Ga0209455_1002829 | 3300025272 | Bacteria | 6449 |
| 65 | Ga0209455_1004954 | 3300025272 | Bacteria | 4225 |
| 66 | Ga0209455_1012677 | 3300025272 | Bacteria | 2001 |
| 67 | Ga0207692_10007305 | 3300025898 | Bacteria | 4522 |
| 68 | Ga0207699_10050329 | 3300025906 | Bacteria | 2456 |
| 69 | Ga0207699_10133964 | 3300025906 | Bacteria | 1620 |
| 70 | Ga0207707_10012581 | 3300025912 | Bacteria | 7354 |
| 71 | Ga0207693_10002911 | 3300025915 | Bacteria | 14822 |
| 72 | Ga0207693_10012587 | 3300025915 | Bacteria | 6834 |
| 73 | Ga0207693_10021873 | 3300025915 | Bacteria | 5086 |
| 74 | Ga0207693_10136801 | 3300025915 | Bacteria | 1926 |
| 75 | Ga0207663_10000363 | 3300025916 | Bacteria | 19735 |
| 76 | Ga0207660_10034677 | 3300025917 | Bacteria | 3498 |
| 77 | Ga0207652_10058569 | 3300025921 | Bacteria | 3319 |
| 78 | Ga0207652_10150701 | 3300025921 | Bacteria | 2082 |
| 79 | Ga0207700_10016813 | 3300025928 | Bacteria | 4871 |
| 80 | Ga0207700_10205827 | 3300025928 | Bacteria | 1661 |
| 81 | Ga0207664_10008514 | 3300025929 | Bacteria | 7162 |
| 82 | Ga0207664_10090088 | 3300025929 | Bacteria | 2513 |
| 83 | Ga0207664_10099721 | 3300025929 | Bacteria | 2397 |
| 84 | Ga0207665_10000530 | 3300025939 | Bacteria | 25694 |
| 85 | Ga0207691_10135790 | 3300025940 | Bacteria | 2169 |
| 86 | Ga0207661_10025500 | 3300025944 | Bacteria | 4494 |
| 87 | Ga0207703_10116034 | 3300026035 | Bacteria | 2291 |
| 88 | Ga0207639_10097574 | 3300026041 | Bacteria | 2367 |
| 89 | Ga0207641_10208533 | 3300026088 | Bacteria | 1806 |
| 90 | Ga0207674_10063749 | 3300026116 | Bacteria | 3719 |
| 91 | Ga0209281_1000487 | 3300027111 | Bacteria | 54997 |
| 92 | Ga0268266_10019067 | 3300028379 | Bacteria | 5842 |
| 93 | Ga0268266_10030070 | 3300028379 | Bacteria | 4615 |
| 94 | Ga0265323_10002038 | 3300028653 | Bacteria | 9496 |
| 95 | Ga0265336_10001646 | 3300028666 | Bacteria | 9902 |
| 96 | Ga0265338_10000271 | 3300028800 | Bacteria | 94819 |
| 97 | Ga0265339_10010425 | 3300031249 | Bacteria | 5774 |
| 98 | Ga0307508_10000019 | 3300031616 | Bacteria | 197575 |
| 99 | Ga0265314_10006217 | 3300031711 | Bacteria | 10603 |
| 100 | Ga0307516_10016366 | 3300031730 | Bacteria | 7759 |
| 101 | Ga0307507_10071012 | 3300033179 | Bacteria | 3152 |
| 102 | Ga0373926_0007685 | 3300035083 | Bacteria | 3591 |
| 103 | Ga0373923_0001927 | 3300035111 | Bacteria | 6212 |
| 104 | Ga0373936_0006606 | 3300035113 | Bacteria | 4366 |
| 105 | Ga0373936_0007244 | 3300035113 | Bacteria | 4174 |
| 106 | Ga0373945_0039929 | 3300035116 | Bacteria | 1693 |
| 107 | Ga0373943_0079926 | 3300035170 | Bacteria | 1675 |
| 108 | Ga0373943_0083799 | 3300035170 | Bacteria | 1639 |
| 109 | Ga0373946_0009653 | 3300035171 | Bacteria | 3561 |
| 110 | Ga0373935_0001695 | 3300035692 | Bacteria | 12321 |
| 111 | Ga0373935_0035375 | 3300035692 | Bacteria | 3117 |
| 112 | Ga0373927_0000792 | 3300035695 | Bacteria | 24123 |
| 113 | Ga0373927_0005011 | 3300035695 | Bacteria | 9172 |
| 114 | Ga0373927_0020802 | 3300035695 | Bacteria | 4300 |
| 115 | Ga0373933_0065664 | 3300035724 | Bacteria | 2197 |
| 116 | Ga0373947_0010797 | 3300035725 | Bacteria | 5239 |
| 117 | Ga0373937_0002152 | 3300036401 | Bacteria | 16491 |
| 118 | Ga0372808_004471 | 3300036459 | Bacteria | 1788 |
| 119 | Ga0373925_0006315 | 3300037068 | Bacteria | 8733 |
| 120 | Ga0373925_0119863 | 3300037068 | Bacteria | 2042 |
| 121 | Ga0395898_0004066 | 3300037466 | Bacteria | 16063 |
| 122 | Ga0395898_0176525 | 3300037466 | Bacteria | 2042 |
| 123 | Ga0395905_0049498 | 3300037471 | Bacteria | 3938 |
| 124 | Ga0395901_0359797 | 3300038443 | Bacteria | 1501 |
| 125 | Ga0436365_1717494 | 3300039437 | Bacteria | 2096 |
| 126 | Ga0436361_0586007 | 3300039447 | Bacteria | 3838 |
| 127 | Ga0466966_0118653 | 3300044684 | Bacteria | 1627 |
| 128 | Ga0466958_0076020 | 3300045836 | Bacteria | 2061 |
| 129 | Ga0466967_0078624 | 3300045976 | Bacteria | 2972 |
| 130 | Ga0495592_0207933 | 3300046454 | Bacteria | 1316 |
| 131 | Ga0495603_0001070 | 3300046455 | Bacteria | 15886 |
| 132 | Ga0495629_0001441 | 3300046459 | Bacteria | 18767 |
| 133 | Ga0495629_0217498 | 3300046459 | Bacteria | 1318 |
| 134 | Ga0495638_0010779 | 3300046460 | Bacteria | 6324 |
| 135 | Ga0495641_0004779 | 3300046461 | Bacteria | 9427 |
| 136 | Ga0495580_0025029 | 3300046472 | Bacteria | 4364 |
| 137 | Ga0495582_0004432 | 3300046473 | Bacteria | 7895 |
| 138 | Ga0495582_0013563 | 3300046473 | Bacteria | 4486 |
| 139 | Ga0495639_0000231 | 3300046475 | Bacteria | 27804 |
| 140 | Ga0495662_0000454 | 3300046476 | Bacteria | 18465 |
| 141 | Ga0495662_0011816 | 3300046476 | Bacteria | 4266 |
| 142 | Ga0495664_0005763 | 3300046477 | Bacteria | 6818 |
| 143 | Ga0495664_0085355 | 3300046477 | Bacteria | 1895 |
| 144 | Ga0495594_0001871 | 3300046499 | Bacteria | 10951 |
| 145 | Ga0495610_0086044 | 3300046512 | Bacteria | 1433 |
| 146 | Ga0495630_0023671 | 3300046517 | Bacteria | 4540 |
| 147 | Ga0495643_0001376 | 3300046522 | Bacteria | 22761 |
| 148 | Ga0495648_0000621 | 3300046524 | Bacteria | 37988 |
| 149 | Ga0495666_0050397 | 3300046526 | Bacteria | 2001 |
| 150 | Ga0495652_0042232 | 3300046529 | Bacteria | 3933 |
| 151 | Ga0495665_0002780 | 3300046531 | Bacteria | 9444 |
| 152 | Ga0495640_0004041 | 3300046533 | Bacteria | 11737 |
| 153 | Ga0495640_0075715 | 3300046533 | Bacteria | 2247 |
| 154 | Ga0495645_0078718 | 3300046543 | Bacteria | 2369 |
| 155 | Ga0495667_0022696 | 3300046559 | Bacteria | 4228 |
| 156 | Ga0495634_0000633 | 3300046642 | Bacteria | 34239 |
| 157 | Ga0495635_0001529 | 3300046663 | Bacteria | 15481 |
| 158 | Ga0495588_0061691 | 3300046674 | Bacteria | 1942 |
| 159 | Ga0495599_0048335 | 3300046678 | Bacteria | 2667 |
| 160 | Ga0495646_0009029 | 3300046680 | Bacteria | 6321 |
| 161 | Ga0495647_0002687 | 3300046681 | Bacteria | 5650 |
| 162 | Ga0495647_0029564 | 3300046681 | Bacteria | 2027 |
| 163 | Ga0495658_0001643 | 3300046683 | Bacteria | 11621 |
| 164 | Ga0495658_0070467 | 3300046683 | Bacteria | 2029 |
| 165 | Ga0495613_0011777 | 3300046689 | Bacteria | 6500 |
| 166 | Ga0495624_0068244 | 3300046690 | Bacteria | 2217 |
| 167 | Ga0495660_0073835 | 3300046810 | Bacteria | 1803 |
| 168 | Ga0495581_0000174 | 3300047315 | Bacteria | 29174 |
| 169 | Ga0495581_0037788 | 3300047315 | Bacteria | 2794 |
| 170 | Ga0495674_0008776 | 3300047319 | Bacteria | 9618 |
| 171 | Ga0495674_0025856 | 3300047319 | Bacteria | 5374 |
| 172 | Ga0495676_0008428 | 3300047321 | Bacteria | 9451 |
| 173 | Ga0495676_0137628 | 3300047321 | Bacteria | 1754 |
| 174 | Ga0495684_0094112 | 3300047471 | Bacteria | 2269 |
| 175 | Ga0495686_0121872 | 3300047472 | Bacteria | 1553 |
| 176 | Ga0495593_0006361 | 3300047673 | Bacteria | 6927 |
| 177 | Ga0495593_0034853 | 3300047673 | Bacteria | 2735 |
| 178 | Ga0496101_0052853 | 3300048904 | Bacteria | 2930 |
| 179 | Ga0496101_0063179 | 3300048904 | Bacteria | 2695 |
| 180 | Ga0496102_0058896 | 3300048905 | Bacteria | 3511 |
| 181 | Ga0496104_0200267 | 3300048907 | Bacteria | 1909 |
| 182 | Ga0496105_0015051 | 3300048908 | Bacteria | 6156 |
| 183 | Ga0496106_0002973 | 3300048909 | Bacteria | 12618 |
| 184 | Ga0496109_0085195 | 3300048912 | Bacteria | 2917 |
| 185 | Ga0496111_0063253 | 3300048914 | Bacteria | 2684 |
| 186 | Ga0496112_0017162 | 3300048915 | Bacteria | 6798 |
| 187 | Ga0496112_0033000 | 3300048915 | Bacteria | 5027 |
| 188 | Ga0496112_0185424 | 3300048915 | Bacteria | 2044 |
| 189 | Ga0496113_0094579 | 3300048916 | Bacteria | 2309 |
| 190 | Ga0496113_0153430 | 3300048916 | Bacteria | 1818 |
| 191 | Ga0496115_0013834 | 3300048918 | Bacteria | 6111 |
| 192 | Ga0496116_0084007 | 3300048919 | Bacteria | 1963 |
| 193 | Ga0496117_0093368 | 3300048920 | Bacteria | 1930 |
| 194 | Ga0496117_0121964 | 3300048920 | Bacteria | 1599 |
| 195 | Ga0496118_0007271 | 3300048921 | Bacteria | 11791 |
| 196 | Ga0496118_0011124 | 3300048921 | Bacteria | 8821 |
| 197 | Ga0496121_0000418 | 3300048924 | Bacteria | 84182 |
| 198 | Ga0496121_0006985 | 3300048924 | Bacteria | 13732 |
| 199 | Ga0496121_0046583 | 3300048924 | Bacteria | 3710 |
| 200 | Ga0496121_0153554 | 3300048924 | Bacteria | 1691 |
| 201 | Ga0496124_0001129 | 3300048927 | Bacteria | 42006 |
| 202 | Ga0496125_0000731 | 3300048928 | Bacteria | 54449 |
| 203 | Ga0496125_0024409 | 3300048928 | Bacteria | 5561 |
| 204 | Ga0496126_0004045 | 3300048929 | Bacteria | 17839 |
| 205 | Ga0496126_0008269 | 3300048929 | Bacteria | 11234 |
| 206 | Ga0496126_0090991 | 3300048929 | Bacteria | 2684 |
| 207 | Ga0496126_0091020 | 3300048929 | Bacteria | 2683 |
| 208 | Ga0496126_0112288 | 3300048929 | Bacteria | 2373 |
| 209 | Ga0496126_0214116 | 3300048929 | Bacteria | 1621 |
| 210 | Ga0496126_0258359 | 3300048929 | Bacteria | 1449 |
| 211 | Ga0501032_0095936 | 3300049569 | Bacteria | 1966 |
| 212 | Ga0501033_0002458 | 3300049570 | Bacteria | 15740 |
| 213 | Ga0501037_0034789 | 3300049573 | Bacteria | 3717 |
| 214 | Ga0501043_0100638 | 3300049579 | Bacteria | 2272 |
| 215 | Ga0501046_0051992 | 3300049580 | Bacteria | 3231 |
| 216 | Ga0501047_0131742 | 3300049581 | Bacteria | 2380 |
| 217 | Ga0501074_0042345 | 3300049590 | Bacteria | 3295 |
| 218 | Ga0501080_0014365 | 3300049742 | Bacteria | 7291 |
| 219 | Ga0501044_0014478 | 3300049823 | Bacteria | 8514 |
| 220 | nmdc:mga0n895_258870_c1 | 3300050512 | Bacteria | 1766 |
| 221 | nmdc:mga0n895_27060_c1 | 3300050512 | Bacteria | 5443 |
| 222 | Ga0495619_0055770 | 3300053085 | Bacteria | 2618 |
| 223 | Ga0500578_0005240 | 3300053086 | Bacteria | 8860 |
| 224 | Ga0500583_0117210 | 3300053092 | Bacteria | 1315 |
| 225 | Ga0500566_0000588 | 3300053094 | Bacteria | 20372 |
| 226 | Ga0500641_0030543 | 3300053096 | Bacteria | 2118 |
| 227 | Ga0500572_000359 | 3300053111 | Bacteria | 16208 |
| 228 | Ga0500572_001838 | 3300053111 | Bacteria | 5378 |
| 229 | Ga0500595_036910 | 3300053119 | Bacteria | 1598 |
| 230 | Ga0500614_002737 | 3300053123 | Bacteria | 3886 |
| 231 | Ga0500642_0010021 | 3300053130 | Bacteria | 3322 |
| 232 | Ga0500559_0006335 | 3300053136 | Bacteria | 5343 |
| 233 | Ga0500559_0016000 | 3300053136 | Bacteria | 3167 |
| 234 | Ga0500603_000114 | 3300053150 | Bacteria | 18972 |
| 235 | Ga0500603_001059 | 3300053150 | Bacteria | 6462 |
| 236 | Ga0500604_0035601 | 3300053151 | Bacteria | 1482 |
| 237 | Ga0500616_0002973 | 3300053153 | Bacteria | 13433 |
| 238 | Ga0500630_002671 | 3300053159 | Bacteria | 8576 |
| 239 | Ga0500639_000006 | 3300053163 | Bacteria | 165068 |
| 240 | Ga0500639_090090 | 3300053163 | Bacteria | 1529 |
| 241 | Ga0500637_0020779 | 3300053178 | Bacteria | 3560 |
| 242 | Ga0500576_046938 | 3300053725 | Bacteria | 1928 |
| 243 | Ga0500596_000335 | 3300053735 | Bacteria | 8490 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035113 | Ga0373936_0006606 | Ga0373936_0006606_1804_3045 | 334 |
| 2 | 3300035116 | Ga0373945_0039929 | Ga0373945_0039929_439_1680 | 334 |
| 3 | 3300035171 | Ga0373946_0009653 | Ga0373946_0009653_886_2127 | 334 |
| 4 | 3300035692 | Ga0373935_0001695 | Ga0373935_0001695_7825_9066 | 334 |
| 5 | 3300035695 | Ga0373927_0000792 | Ga0373927_0000792_6312_7553 | 334 |
| 6 | 3300035725 | Ga0373947_0010797 | Ga0373947_0010797_797_2038 | 334 |
| 7 | 3300036401 | Ga0373937_0002152 | Ga0373937_0002152_1583_2824 | 334 |
| 8 | 3300037068 | Ga0373925_0006315 | Ga0373925_0006315_2472_3713 | 334 |
| 9 | 3300046455 | Ga0495603_0001070 | Ga0495603_0001070_13856_15097 | 334 |
| 10 | 3300046459 | Ga0495629_0001441 | Ga0495629_0001441_6414_7655 | 334 |
| 11 | 3300046461 | Ga0495641_0004779 | Ga0495641_0004779_2095_3336 | 334 |
| 12 | 3300046472 | Ga0495580_0025029 | Ga0495580_0025029_2079_3320 | 334 |
| 13 | 3300046473 | Ga0495582_0004432 | Ga0495582_0004432_1634_2875 | 334 |
| 14 | 3300046475 | Ga0495639_0000231 | Ga0495639_0000231_25337_26578 | 334 |
| 15 | 3300046476 | Ga0495662_0000454 | Ga0495662_0000454_2425_3666 | 334 |
| 16 | 3300046477 | Ga0495664_0005763 | Ga0495664_0005763_1990_3231 | 334 |
| 17 | 3300046499 | Ga0495594_0001871 | Ga0495594_0001871_5708_6949 | 334 |
| 18 | 3300046517 | Ga0495630_0023671 | Ga0495630_0023671_2029_3270 | 334 |
| 19 | 3300046526 | Ga0495666_0050397 | Ga0495666_0050397_619_1860 | 334 |
| 20 | 3300046531 | Ga0495665_0002780 | Ga0495665_0002780_1962_3203 | 334 |
| 21 | 3300046533 | Ga0495640_0004041 | Ga0495640_0004041_4478_5719 | 334 |
| 22 | 3300046559 | Ga0495667_0022696 | Ga0495667_0022696_2691_3932 | 334 |
| 23 | 3300046642 | Ga0495634_0000633 | Ga0495634_0000633_32203_33444 | 334 |
| 24 | 3300046663 | Ga0495635_0001529 | Ga0495635_0001529_3722_4963 | 334 |
| 25 | 3300046678 | Ga0495599_0048335 | Ga0495599_0048335_588_1829 | 334 |
| 26 | 3300046680 | Ga0495646_0009029 | Ga0495646_0009029_1708_2949 | 334 |
| 27 | 3300046681 | Ga0495647_0002687 | Ga0495647_0002687_834_2075 | 334 |
| 28 | 3300046683 | Ga0495658_0001643 | Ga0495658_0001643_3964_5205 | 334 |
| 29 | 3300046689 | Ga0495613_0011777 | Ga0495613_0011777_3193_4434 | 334 |
| 30 | 3300047315 | Ga0495581_0000174 | Ga0495581_0000174_6405_7646 | 334 |
| 31 | 3300047319 | Ga0495674_0008776 | Ga0495674_0008776_2118_3359 | 334 |
| 32 | 3300047321 | Ga0495676_0008428 | Ga0495676_0008428_6248_7489 | 334 |
| 33 | 3300047673 | Ga0495593_0006361 | Ga0495593_0006361_785_2026 | 334 |
| 34 | 3300053085 | Ga0495619_0055770 | Ga0495619_0055770_995_2236 | 334 |
| 35 | 3300021361 | Ga0213872_10007142 | Ga0213872_100071425 | 336 |
| 36 | 3300039447 | Ga0436361_0586007 | Ga0436361_0586007_2390_3652 | 336 |
| 37 | 3300005355 | Ga0070671_100111823 | Ga0070671_1001118232 | 337 |
| 38 | 3300025940 | Ga0207691_10135790 | Ga0207691_101357902 | 337 |
| 39 | 3300028379 | Ga0268266_10019067 | Ga0268266_100190674 | 337 |
| 40 | 3300037466 | Ga0395898_0004066 | Ga0395898_0004066_8013_9245 | 337 |
| 41 | 3300038443 | Ga0395901_0359797 | Ga0395901_0359797_257_1489 | 337 |
| 42 | 3300005841 | Ga0068863_100138846 | Ga0068863_1001388461 | 340 |
| 43 | 3300026088 | Ga0207641_10208533 | Ga0207641_102085331 | 340 |
| 44 | 3300031616 | Ga0307508_10000019 | Ga0307508_100000194 | 343 |
| 45 | 3300048918 | Ga0496115_0013834 | Ga0496115_0013834_444_1670 | 346 |
| 46 | 3300005983 | Ga0081540_1002134 | Ga0081540_10021346 | 347 |
| 47 | 3300037466 | Ga0395898_0176525 | Ga0395898_0176525_670_1872 | 347 |
| 48 | 3300037471 | Ga0395905_0049498 | Ga0395905_0049498_214_1416 | 347 |
| 49 | 3300053096 | Ga0500641_0030543 | Ga0500641_0030543_17_1234 | 347 |
| 50 | 3300025915 | Ga0207693_10021873 | Ga0207693_100218734 | 348 |
| 51 | 3300035113 | Ga0373936_0007244 | Ga0373936_0007244_2098_3306 | 348 |
| 52 | 3300053094 | Ga0500566_0000588 | Ga0500566_0000588_4226_5434 | 348 |
| 53 | 3300053111 | Ga0500572_001838 | Ga0500572_001838_893_2101 | 348 |
| 54 | 3300053123 | Ga0500614_002737 | Ga0500614_002737_201_1409 | 348 |
| 55 | 3300053136 | Ga0500559_0016000 | Ga0500559_0016000_872_2080 | 348 |
| 56 | 3300053150 | Ga0500603_000114 | Ga0500603_000114_13264_14472 | 348 |
| 57 | 3300053159 | Ga0500630_002671 | Ga0500630_002671_3153_4361 | 348 |
| 58 | 3300053163 | Ga0500639_000006 | Ga0500639_000006_79901_81109 | 348 |
| 59 | 3300053735 | Ga0500596_000335 | Ga0500596_000335_3256_4464 | 348 |
| 60 | 3300005458 | Ga0070681_10037152 | Ga0070681_100371523 | 349 |
| 61 | 3300005530 | Ga0070679_100125293 | Ga0070679_1001252931 | 349 |
| 62 | 3300025912 | Ga0207707_10012581 | Ga0207707_100125813 | 349 |
| 63 | 3300025921 | Ga0207652_10058569 | Ga0207652_100585692 | 349 |
| 64 | 3300046454 | Ga0495592_0207933 | Ga0495592_0207933_53_1246 | 349 |
| 65 | 3300048907 | Ga0496104_0200267 | Ga0496104_0200267_445_1638 | 349 |
| 66 | 3300053092 | Ga0500583_0117210 | Ga0500583_0117210_17_1219 | 349 |
| 67 | 3300053130 | Ga0500642_0010021 | Ga0500642_0010021_1483_2685 | 349 |
| 68 | 3300053151 | Ga0500604_0035601 | Ga0500604_0035601_18_1220 | 349 |
| 69 | 3300047472 | Ga0495686_0121872 | Ga0495686_0121872_68_1261 | 350 |
| 70 | 3300005983 | Ga0081540_1061513 | Ga0081540_10615131 | 353 |
| 71 | 3300005536 | Ga0070697_100089071 | Ga0070697_1000890712 | 354 |
| 72 | 3300010375 | Ga0105239_10157760 | Ga0105239_101577601 | 354 |
| 73 | 3300026035 | Ga0207703_10116034 | Ga0207703_101160341 | 354 |
| 74 | 3300048914 | Ga0496111_0063253 | Ga0496111_0063253_1192_2400 | 354 |
| 75 | iso_pu_bacteria | 8019576017 | 8019578545 | 354 |
| 76 | 3300005329 | Ga0070683_100072246 | Ga0070683_1000722464 | 358 |
| 77 | 3300005336 | Ga0070680_100045758 | Ga0070680_1000457584 | 358 |
| 78 | 3300005458 | Ga0070681_10107989 | Ga0070681_101079893 | 358 |
| 79 | 3300005530 | Ga0070679_100068438 | Ga0070679_1000684382 | 358 |
| 80 | 3300005535 | Ga0070684_100025988 | Ga0070684_1000259883 | 358 |
| 81 | 3300005577 | Ga0068857_100058358 | Ga0068857_1000583583 | 358 |
| 82 | 3300025917 | Ga0207660_10034677 | Ga0207660_100346773 | 358 |
| 83 | 3300026116 | Ga0207674_10063749 | Ga0207674_100637493 | 358 |
| 84 | 3300005435 | Ga0070714_100103159 | Ga0070714_1001031591 | 359 |
| 85 | 3300005436 | Ga0070713_100040332 | Ga0070713_1000403323 | 359 |
| 86 | 3300025928 | Ga0207700_10016813 | Ga0207700_100168134 | 359 |
| 87 | 3300025929 | Ga0207664_10090088 | Ga0207664_100900882 | 359 |
| 88 | 3300053136 | Ga0500559_0006335 | Ga0500559_0006335_2032_3249 | 360 |
| 89 | 3300053725 | Ga0500576_046938 | Ga0500576_046938_170_1387 | 360 |
| 90 | 3300025261 | Ga0209233_1003242 | Ga0209233_10032424 | 361 |
| 91 | 3300025254 | Ga0209148_1000232 | Ga0209148_100023271 | 362 |
| 92 | 3300025272 | Ga0209455_1002829 | Ga0209455_10028292 | 362 |
| 93 | 3300048928 | Ga0496125_0000731 | Ga0496125_0000731_39213_40448 | 362 |
| 94 | iso_pu_bacteria | 2921201388 | 2921204312 | 362 |
| 95 | 3300007265 | Ga0099794_10056257 | Ga0099794_100562571 | 363 |
| 96 | 3300025921 | Ga0207652_10150701 | Ga0207652_101507012 | 363 |
| 97 | 3300031249 | Ga0265339_10010425 | Ga0265339_100104255 | 363 |
| 98 | 3300005435 | Ga0070714_100240419 | Ga0070714_1002404192 | 364 |
| 99 | 3300005437 | Ga0070710_10051742 | Ga0070710_100517422 | 364 |
| 100 | 3300005439 | Ga0070711_100006521 | Ga0070711_1000065216 | 364 |
| 101 | 3300005455 | Ga0070663_100220024 | Ga0070663_1002200241 | 364 |
| 102 | 3300028653 | Ga0265323_10002038 | Ga0265323_100020388 | 364 |
| 103 | 3300028666 | Ga0265336_10001646 | Ga0265336_100016468 | 364 |
| 104 | 3300028800 | Ga0265338_10000271 | Ga0265338_1000027155 | 364 |
| 105 | 3300046512 | Ga0495610_0086044 | Ga0495610_0086044_76_1275 | 364 |
| 106 | 3300046522 | Ga0495643_0001376 | Ga0495643_0001376_11976_13175 | 364 |
| 107 | 3300046810 | Ga0495660_0073835 | Ga0495660_0073835_83_1282 | 364 |
| 108 | 3300053086 | Ga0500578_0005240 | Ga0500578_0005240_1103_2302 | 364 |
| 109 | 3300053153 | Ga0500616_0002973 | Ga0500616_0002973_11020_12219 | 364 |
| 110 | iso_pu_bacteria | 2852387548 | 2852393262 | 364 |
| 111 | 3300036459 | Ga0372808_004471 | Ga0372808_004471_481_1686 | 368 |
| 112 | 3300045976 | Ga0466967_0078624 | Ga0466967_0078624_1680_2903 | 368 |
| 113 | 3300046524 | Ga0495648_0000621 | Ga0495648_0000621_2957_4207 | 368 |
| 114 | 3300049569 | Ga0501032_0095936 | Ga0501032_0095936_620_1822 | 368 |
| 115 | 3300049580 | Ga0501046_0051992 | Ga0501046_0051992_112_1314 | 368 |
| 116 | 3300049581 | Ga0501047_0131742 | Ga0501047_0131742_305_1507 | 368 |
| 117 | 3300049590 | Ga0501074_0042345 | Ga0501074_0042345_572_1774 | 368 |
| 118 | 3300049742 | Ga0501080_0014365 | Ga0501080_0014365_3949_5151 | 368 |
| 119 | 3300049823 | Ga0501044_0014478 | Ga0501044_0014478_1270_2472 | 368 |
| 120 | 3300005937 | Ga0081455_10083839 | Ga0081455_100838392 | 369 |
| 121 | 3300005983 | Ga0081540_1022175 | Ga0081540_10221753 | 369 |
| 122 | 3300025906 | Ga0207699_10133964 | Ga0207699_101339641 | 369 |
| 123 | 3300039437 | Ga0436365_1717494 | Ga0436365_1717494_679_1893 | 369 |
| 124 | 3300048924 | Ga0496121_0153554 | Ga0496121_0153554_327_1526 | 369 |
| 125 | 3300026041 | Ga0207639_10097574 | Ga0207639_100975741 | 370 |
| 126 | 3300031730 | Ga0307516_10016366 | Ga0307516_100163662 | 370 |
| 127 | 3300046683 | Ga0495658_0070467 | Ga0495658_0070467_777_1988 | 370 |
| 128 | iso_pu_bacteria | 2517093001 | 2517104403 | 370 |
| 129 | 3300009763 | Ga0123340_1004720 | Ga0123340_10047203 | 371 |
| 130 | 3300009765 | Ga0123341_1003157 | Ga0123341_10031576 | 371 |
| 131 | 3300048920 | Ga0496117_0093368 | Ga0496117_0093368_35_1258 | 371 |
| 132 | 3300048924 | Ga0496121_0006985 | Ga0496121_0006985_8542_9765 | 371 |
| 133 | 3300009093 | Ga0105240_10203403 | Ga0105240_102034031 | 372 |
| 134 | 3300009551 | Ga0105238_10111854 | Ga0105238_101118541 | 372 |
| 135 | 3300048909 | Ga0496106_0002973 | Ga0496106_0002973_9526_10749 | 372 |
| 136 | 3300048919 | Ga0496116_0084007 | Ga0496116_0084007_395_1618 | 372 |
| 137 | 3300048921 | Ga0496118_0007271 | Ga0496118_0007271_3576_4799 | 372 |
| 138 | 3300048924 | Ga0496121_0000418 | Ga0496121_0000418_28694_29917 | 372 |
| 139 | 3300048927 | Ga0496124_0001129 | Ga0496124_0001129_7426_8649 | 372 |
| 140 | 3300048928 | Ga0496125_0024409 | Ga0496125_0024409_1484_2707 | 372 |
| 141 | 3300048929 | Ga0496126_0091020 | Ga0496126_0091020_203_1402 | 372 |
| 142 | 3300053111 | Ga0500572_000359 | Ga0500572_000359_10615_11832 | 372 |
| 143 | 3300053163 | Ga0500639_090090 | Ga0500639_090090_98_1315 | 372 |
| 144 | iso_pu_bacteria | 2824753945 | 2824761434 | 373 |
| 145 | iso_pu_bacteria | 2824763712 | 2824771218 | 373 |
| 146 | iso_pu_bacteria | 2876761206 | 2876767472 | 373 |
| 147 | iso_pu_bacteria | 2904711408 | 2904713726 | 373 |
| 148 | iso_pu_bacteria | 3003930520 | 3003934228 | 373 |
| 149 | iso_pu_bacteria | 8057575449 | 8057579483 | 373 |
| 150 | 3300003659 | JGI25404J52841_10005926 | JGI25404J52841_100059262 | 374 |
| 151 | 3300003659 | JGI25404J52841_10008905 | JGI25404J52841_100089052 | 374 |
| 152 | 3300005983 | Ga0081540_1006679 | Ga0081540_10066793 | 374 |
| 153 | 3300005983 | Ga0081540_1043573 | Ga0081540_10435732 | 374 |
| 154 | 3300007076 | Ga0075435_100164925 | Ga0075435_1001649252 | 374 |
| 155 | 3300009093 | Ga0105240_10095810 | Ga0105240_100958101 | 374 |
| 156 | 3300025915 | Ga0207693_10136801 | Ga0207693_101368012 | 374 |
| 157 | 3300025928 | Ga0207700_10205827 | Ga0207700_102058271 | 374 |
| 158 | 3300050512 | nmdc:mga0n895_258870_c1 | nmdc:mga0n895_258870_c1_116_1291 | 374 |
| 159 | iso_pu_bacteria | 8046767195 | 8046772208 | 374 |
| 160 | 3300005435 | Ga0070714_100081343 | Ga0070714_1000813431 | 375 |
| 161 | 3300025929 | Ga0207664_10099721 | Ga0207664_100997212 | 375 |
| 162 | iso_pu_bacteria | 2513237104 | 2513717732 | 375 |
| 163 | iso_pu_bacteria | 2935959822 | 2935965673 | 375 |
| 164 | iso_pu_bacteria | 2967671571 | 2967676074 | 375 |
| 165 | iso_pu_bacteria | 2513237140 | 2513883624 | 376 |
| 166 | iso_pu_bacteria | 2513237143 | 2513903654 | 376 |
| 167 | iso_pu_bacteria | 2524023207 | 2524449078 | 376 |
| 168 | iso_pu_bacteria | 2551306089 | 2551710761 | 376 |
| 169 | iso_pu_bacteria | 2551306091 | 2551724457 | 376 |
| 170 | iso_pu_bacteria | 2915986958 | 2915990991 | 376 |
| 171 | iso_pu_bacteria | 2924193448 | 2924199968 | 376 |
| 172 | iso_pu_bacteria | 2937106411 | 2937112282 | 376 |
| 173 | iso_pu_bacteria | 2937113482 | 2937113561 | 376 |
| 174 | iso_pu_bacteria | 2957457609 | 2957459614 | 376 |
| 175 | iso_pu_bacteria | 2957491536 | 2957495040 | 376 |
| 176 | iso_pu_bacteria | 2960597568 | 2960597664 | 376 |
| 177 | iso_pu_bacteria | 2960617483 | 2960624023 | 376 |
| 178 | iso_pu_bacteria | 2960667422 | 2960671908 | 376 |
| 179 | iso_pu_bacteria | 2960674078 | 2960674330 | 376 |
| 180 | iso_pu_bacteria | 2964691889 | 2964691895 | 376 |
| 181 | iso_pu_bacteria | 2964698721 | 2964704948 | 376 |
| 182 | iso_pu_bacteria | 2964712639 | 2964716372 | 376 |
| 183 | iso_pu_bacteria | 2967664464 | 2967671267 | 376 |
| 184 | iso_pu_bacteria | 2967699805 | 2967700791 | 376 |
| 185 | iso_pu_bacteria | 2970076120 | 2970079462 | 376 |
| 186 | iso_pu_bacteria | 2970082768 | 2970084940 | 376 |
| 187 | iso_pu_bacteria | 648276728 | 648736047 | 376 |
| 188 | 3300021384 | Ga0213876_10051081 | Ga0213876_100510812 | 377 |
| 189 | 3300048929 | Ga0496126_0008269 | Ga0496126_0008269_969_2207 | 377 |
| 190 | 3300053150 | Ga0500603_001059 | Ga0500603_001059_3342_4550 | 377 |
| 191 | 3300053178 | Ga0500637_0020779 | Ga0500637_0020779_90_1298 | 377 |
| 192 | iso_pu_bacteria | 2515154107 | 2515609583 | 377 |
| 193 | iso_pu_bacteria | 2528768022 | 2528854623 | 377 |
| 194 | iso_pu_bacteria | 2824600985 | 2824607190 | 377 |
| 195 | iso_pu_bacteria | 2824609381 | 2824615110 | 377 |
| 196 | iso_pu_bacteria | 2824653114 | 2824660170 | 377 |
| 197 | iso_pu_bacteria | 2824661429 | 2824668453 | 377 |
| 198 | iso_pu_bacteria | 2888419890 | 2888426661 | 377 |
| 199 | iso_pu_bacteria | 2929615660 | 2929620080 | 377 |
| 200 | iso_pu_bacteria | 2929624759 | 2929629393 | 377 |
| 201 | iso_pu_bacteria | 2933577622 | 2933581997 | 377 |
| 202 | iso_pu_bacteria | 8006926726 | 8006929298 | 377 |
| 203 | iso_pu_bacteria | 8055742211 | 8055750167 | 377 |
| 204 | 3300010159 | Ga0099796_10059257 | Ga0099796_100592571 | 378 |
| 205 | 3300013296 | Ga0157374_10076445 | Ga0157374_100764452 | 378 |
| 206 | 3300035695 | Ga0373927_0005011 | Ga0373927_0005011_6112_7329 | 378 |
| 207 | 3300037068 | Ga0373925_0119863 | Ga0373925_0119863_775_1992 | 378 |
| 208 | iso_pu_bacteria | 2524023210 | 2524464863 | 378 |
| 209 | iso_pu_bacteria | 2885383462 | 2885389671 | 378 |
| 210 | 3300005329 | Ga0070683_100025576 | Ga0070683_1000255764 | 379 |
| 211 | 3300005535 | Ga0070684_100123789 | Ga0070684_1001237892 | 379 |
| 212 | 3300025944 | Ga0207661_10025500 | Ga0207661_100255003 | 379 |
| 213 | 3300046674 | Ga0495588_0061691 | Ga0495588_0061691_478_1695 | 379 |
| 214 | 3300048929 | Ga0496126_0090991 | Ga0496126_0090991_310_1533 | 379 |
| 215 | 3300048929 | Ga0496126_0214116 | Ga0496126_0214116_77_1297 | 379 |
| 216 | iso_pu_bacteria | 2508501128 | 2509146569 | 379 |
| 217 | iso_pu_bacteria | 2513237098 | 2513671556 | 379 |
| 218 | 3300005937 | Ga0081455_10010152 | Ga0081455_100101527 | 380 |
| 219 | 3300006946 | Ga0079104_1001597 | Ga0079104_10015974 | 380 |
| 220 | 3300027111 | Ga0209281_1000487 | Ga0209281_100048762 | 380 |
| 221 | 3300048915 | Ga0496112_0033000 | Ga0496112_0033000_1335_2543 | 380 |
| 222 | 3300048929 | Ga0496126_0112288 | Ga0496126_0112288_583_1788 | 380 |
| 223 | 3300050512 | nmdc:mga0n895_27060_c1 | nmdc:mga0n895_27060_c1_3207_4442 | 380 |
| 224 | 3300048924 | Ga0496121_0046583 | Ga0496121_0046583_1459_2793 | 381 |
| 225 | 3300005434 | Ga0070709_10003812 | Ga0070709_100038122 | 382 |
| 226 | 3300005435 | Ga0070714_100017621 | Ga0070714_1000176211 | 382 |
| 227 | 3300005436 | Ga0070713_100080516 | Ga0070713_1000805161 | 382 |
| 228 | 3300005437 | Ga0070710_10009715 | Ga0070710_100097154 | 382 |
| 229 | 3300006163 | Ga0070715_10005070 | Ga0070715_100050703 | 382 |
| 230 | 3300006173 | Ga0070716_100023688 | Ga0070716_1000236883 | 382 |
| 231 | 3300025898 | Ga0207692_10007305 | Ga0207692_100073052 | 382 |
| 232 | 3300025915 | Ga0207693_10012587 | Ga0207693_100125876 | 382 |
| 233 | 3300025916 | Ga0207663_10000363 | Ga0207663_1000036310 | 382 |
| 234 | 3300025929 | Ga0207664_10008514 | Ga0207664_100085145 | 382 |
| 235 | 3300025939 | Ga0207665_10000530 | Ga0207665_1000053017 | 382 |
| 236 | 3300028379 | Ga0268266_10030070 | Ga0268266_100300702 | 382 |
| 237 | 3300031711 | Ga0265314_10006217 | Ga0265314_100062179 | 382 |
| 238 | 3300035170 | Ga0373943_0079926 | Ga0373943_0079926_272_1489 | 382 |
| 239 | 3300053119 | Ga0500595_036910 | Ga0500595_036910_317_1555 | 382 |
| 240 | 3300046460 | Ga0495638_0010779 | Ga0495638_0010779_648_1862 | 383 |
| 241 | 3300048912 | Ga0496109_0085195 | Ga0496109_0085195_455_1666 | 383 |
| 242 | 3300048915 | Ga0496112_0017162 | Ga0496112_0017162_4674_5885 | 383 |
| 243 | 3300048916 | Ga0496113_0153430 | Ga0496113_0153430_106_1317 | 383 |
| 244 | iso_pu_bacteria | 2899803654 | 2899808248 | 383 |
| 245 | iso_pu_bacteria | 8056967851 | 8056975948 | 383 |
| 246 | 3300005614 | Ga0068856_100223586 | Ga0068856_1002235862 | 384 |
| 247 | 3300009545 | Ga0105237_10031716 | Ga0105237_100317163 | 384 |
| 248 | 3300010375 | Ga0105239_10065045 | Ga0105239_100650452 | 384 |
| 249 | 3300014968 | Ga0157379_10044776 | Ga0157379_100447763 | 384 |
| 250 | 3300033179 | Ga0307507_10071012 | Ga0307507_100710122 | 384 |
| 251 | 3300035083 | Ga0373926_0007685 | Ga0373926_0007685_409_1617 | 384 |
| 252 | 3300035111 | Ga0373923_0001927 | Ga0373923_0001927_3313_4521 | 384 |
| 253 | 3300035170 | Ga0373943_0083799 | Ga0373943_0083799_272_1480 | 384 |
| 254 | 3300035692 | Ga0373935_0035375 | Ga0373935_0035375_1716_2924 | 384 |
| 255 | 3300035724 | Ga0373933_0065664 | Ga0373933_0065664_939_2147 | 384 |
| 256 | 3300046459 | Ga0495629_0217498 | Ga0495629_0217498_62_1270 | 384 |
| 257 | 3300046473 | Ga0495582_0013563 | Ga0495582_0013563_431_1639 | 384 |
| 258 | 3300046476 | Ga0495662_0011816 | Ga0495662_0011816_1982_3190 | 384 |
| 259 | 3300046477 | Ga0495664_0085355 | Ga0495664_0085355_271_1479 | 384 |
| 260 | 3300046529 | Ga0495652_0042232 | Ga0495652_0042232_1974_3182 | 384 |
| 261 | 3300046533 | Ga0495640_0075715 | Ga0495640_0075715_478_1686 | 384 |
| 262 | 3300046543 | Ga0495645_0078718 | Ga0495645_0078718_361_1569 | 384 |
| 263 | 3300046681 | Ga0495647_0029564 | Ga0495647_0029564_422_1630 | 384 |
| 264 | 3300046690 | Ga0495624_0068244 | Ga0495624_0068244_608_1816 | 384 |
| 265 | 3300047315 | Ga0495581_0037788 | Ga0495581_0037788_1299_2507 | 384 |
| 266 | 3300047319 | Ga0495674_0025856 | Ga0495674_0025856_2963_4171 | 384 |
| 267 | 3300047321 | Ga0495676_0137628 | Ga0495676_0137628_521_1729 | 384 |
| 268 | 3300047471 | Ga0495684_0094112 | Ga0495684_0094112_969_2177 | 384 |
| 269 | 3300047673 | Ga0495593_0034853 | Ga0495593_0034853_83_1291 | 384 |
| 270 | 3300048904 | Ga0496101_0063179 | Ga0496101_0063179_472_1707 | 384 |
| 271 | 3300048905 | Ga0496102_0058896 | Ga0496102_0058896_290_1525 | 384 |
| 272 | 3300048908 | Ga0496105_0015051 | Ga0496105_0015051_2702_3937 | 384 |
| 273 | 3300048915 | Ga0496112_0185424 | Ga0496112_0185424_327_1562 | 384 |
| 274 | 3300048916 | Ga0496113_0094579 | Ga0496113_0094579_740_1975 | 384 |
| 275 | iso_pu_bacteria | 3005718088 | 3005724182 | 384 |
| 276 | 3300025253 | Ga0209677_100233 | Ga0209677_1002332 | 385 |
| 277 | 3300048920 | Ga0496117_0121964 | Ga0496117_0121964_310_1533 | 385 |
| 278 | 3300048921 | Ga0496118_0011124 | Ga0496118_0011124_854_2077 | 385 |
| 279 | 3300048929 | Ga0496126_0004045 | Ga0496126_0004045_12176_13399 | 385 |
| 280 | iso_pu_bacteria | 2844315083 | 2844321151 | 385 |
| 281 | iso_pu_bacteria | 2903727486 | 2903728575 | 385 |
| 282 | iso_pu_bacteria | 2906602504 | 2906607766 | 385 |
| 283 | 3300025272 | Ga0209455_1012677 | Ga0209455_10126772 | 387 |
| 284 | 3300048929 | Ga0496126_0258359 | Ga0496126_0258359_195_1418 | 387 |
| 285 | 3300049570 | Ga0501033_0002458 | Ga0501033_0002458_1357_2592 | 387 |
| 286 | 3300049573 | Ga0501037_0034789 | Ga0501037_0034789_264_1502 | 387 |
| 287 | 3300049579 | Ga0501043_0100638 | Ga0501043_0100638_581_1819 | 387 |
| 288 | iso_pu_bacteria | 2513237141 | 2513887795 | 387 |
| 289 | iso_pu_bacteria | 2879099564 | 2879106332 | 387 |
| 290 | iso_pu_bacteria | 2922368715 | 2922370500 | 387 |
| 291 | iso_pu_bacteria | 2932784394 | 2932791436 | 387 |
| 292 | iso_pu_bacteria | 2932809354 | 2932815015 | 387 |
| 293 | iso_pu_bacteria | 2932818245 | 2932824128 | 387 |
| 294 | iso_pu_bacteria | 2932828146 | 2932835338 | 387 |
| 295 | iso_pu_bacteria | 2935616580 | 2935621081 | 387 |
| 296 | iso_pu_bacteria | 2935638405 | 2935643612 | 387 |
| 297 | iso_pu_bacteria | 2935665750 | 2935671078 | 387 |
| 298 | iso_pu_bacteria | 2935675223 | 2935681316 | 387 |
| 299 | iso_pu_bacteria | 2935684952 | 2935689338 | 387 |
| 300 | iso_pu_bacteria | 2935694250 | 2935699916 | 387 |
| 301 | iso_pu_bacteria | 2935703347 | 2935712153 | 387 |
| 302 | iso_pu_bacteria | 2935713505 | 2935720284 | 387 |
| 303 | iso_pu_bacteria | 2935722832 | 2935728099 | 387 |
| 304 | iso_pu_bacteria | 2935732158 | 2935737304 | 387 |
| 305 | iso_pu_bacteria | 2935741537 | 2935746635 | 387 |
| 306 | iso_pu_bacteria | 2935750917 | 2935757602 | 387 |
| 307 | iso_pu_bacteria | 2935760218 | 2935763978 | 387 |
| 308 | iso_pu_bacteria | 2935801545 | 2935807953 | 387 |
| 309 | iso_pu_bacteria | 2935810662 | 2935818711 | 387 |
| 310 | iso_pu_bacteria | 2935827899 | 2935833129 | 387 |
| 311 | iso_pu_bacteria | 2935837841 | 2935844215 | 387 |
| 312 | iso_pu_bacteria | 2935855204 | 2935859726 | 387 |
| 313 | iso_pu_bacteria | 2935864058 | 2935872124 | 387 |
| 314 | iso_pu_bacteria | 2935873716 | 2935878952 | 387 |
| 315 | iso_pu_bacteria | 2935992306 | 2936000299 | 387 |
| 316 | iso_pu_bacteria | 2936002035 | 2936008457 | 387 |
| 317 | iso_pu_bacteria | 2936037263 | 2936045521 | 387 |
| 318 | iso_pu_bacteria | 2940556831 | 2940563576 | 387 |
| 319 | iso_pu_bacteria | 2941531003 | 2941537327 | 387 |
| 320 | iso_pu_bacteria | 2941538514 | 2941542547 | 387 |
| 321 | iso_pu_bacteria | 8016511872 | 8016519433 | 387 |
| 322 | iso_pu_bacteria | 8017057580 | 8017066088 | 387 |
| 323 | iso_pu_bacteria | 8019586578 | 8019596595 | 387 |
| 324 | iso_pu_bacteria | 8019597564 | 8019605111 | 387 |
| 325 | iso_pu_bacteria | 8019608314 | 8019613426 | 387 |
| 326 | 3300005434 | Ga0070709_10015240 | Ga0070709_100152402 | 388 |
| 327 | 3300005439 | Ga0070711_100100135 | Ga0070711_1001001351 | 388 |
| 328 | 3300006175 | Ga0070712_100023454 | Ga0070712_1000234542 | 388 |
| 329 | 3300006871 | Ga0075434_100007552 | Ga0075434_1000075523 | 388 |
| 330 | 3300025906 | Ga0207699_10050329 | Ga0207699_100503292 | 388 |
| 331 | 3300025915 | Ga0207693_10002911 | Ga0207693_100029114 | 388 |
| 332 | 3300044684 | Ga0466966_0118653 | Ga0466966_0118653_344_1561 | 388 |
| 333 | 3300045836 | Ga0466958_0076020 | Ga0466958_0076020_661_1878 | 388 |
| 334 | iso_pu_bacteria | 2858800743 | 2858804564 | 388 |
| 335 | iso_pu_bacteria | 2964643177 | 2964648980 | 388 |
| 336 | 3300035695 | Ga0373927_0020802 | Ga0373927_0020802_2412_3650 | 389 |
| 337 | iso_pu_bacteria | 2524023205 | 2524438370 | 389 |
| 338 | iso_pu_bacteria | 2744054633 | 2745078479 | 389 |
| 339 | 3300048904 | Ga0496101_0052853 | Ga0496101_0052853_907_2223 | 390 |
| 340 | iso_pu_bacteria | 2738543024 | 2739306713 | 390 |
| 341 | 3300013297 | Ga0157378_10058109 | Ga0157378_100581093 | 392 |
| 342 | 3300025254 | Ga0209148_1009243 | Ga0209148_10092432 | 394 |
| 343 | 3300025261 | Ga0209233_1005429 | Ga0209233_10054292 | 394 |
| 344 | 3300025272 | Ga0209455_1004954 | Ga0209455_10049543 | 394 |
| 345 | 3300003323 | rootH1_10116622 | rootH1_101166221 | 396 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d6w-assembly1.cif.gz_A | lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. | 0.8369 | 282 | 390 |
| 4g4k-assembly1.cif.gz_A | structure of the staphylococcus aureus agra lyttr domain | 0.8353 | 285 | 384 |
| 3d6w-assembly1.cif.gz_A | lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. | 0.8233 | 282 | 390 |
| 4g4k-assembly1.cif.gz_A | structure of the staphylococcus aureus agra lyttr domain | 0.8122 | 285 | 384 |
| 4xxe-assembly1.cif.gz_D | structure of agra lyttr domain in complex with promoters | 0.8023 | 283 | 384 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3d6wB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.909 | 283 | 352 | 2.40.50.40 |
| 3d6wB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.897 | 283 | 352 | 2.40.50.40 |
| af_P0AE39_136_205_2.40.50.40 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8915 | 283 | 351 | 2.40.50.40 |
| af_P0AFT5_129_238_2.40.50.1020 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain | 0.8692 | 281 | 390 | 2.40.50.1020 |
| af_P0AE39_136_205_2.40.50.40 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8688 | 283 | 351 | 2.40.50.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6EZN5-F1-model_v4 | deleted | 0.939 | 12 | 125 |
|
| AF-A0A2N3S007-F1-model_v4 | deleted | 0.9247 | 282 | 387 |
|
| AF-A0A3B9NT71-F1-model_v4 | DNA-binding response regulator | 0.9147 | 281 | 351 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A523X618-F1-model_v4 | Response regulator | 0.9145 | 282 | 361 |
GO:0000156
GO:0003677 |
| AF-A0A1G5FD99-F1-model_v4 | Stage 0 sporulation protein A homolog | 0.9132 | 280 | 387 |
GO:0000156
GO:0003677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar