F416362

General Info

Members Datasets Scaffolds Average Seq Length
345 274 243 389

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10031716|Ga0105237_100317163
Length 439
Sequence VEDLHRSPQTIERDNRLIVIFRDAPIKFAVGGGCPWRRAAETIMFEGHDPWLVALSVAIAILGGYTGFSLAARVRAAPGGGRRVLLAGAAAFLAVGIWTMHFVGVLAAPIPSDAVYLVLPTIISFLICALVVGISLFFVSIGEPTLLRVASSAVLLGLGIVSMHYAGIHGLAGNFVIAHDWSMVVLSIAVAIGTAYGGLRAFLARQDGVRLIASSIAFGVAVSGMHYTAMHGMHFEPISAAGHXXXGGGLAASPQILSIVVSVLCFVIAAGFLLSLVPDPRRQASPAVGPVAEPALPEAGPVTLTSPRLMPAPLGGLGQPPRPSPVPRLPVEGANGTHFIDATEVRSVRADAHYTRVHDGTRERMCPWSISEAEAQLDPGLFVRVHRSHIVAIPHVTFVRKEGDGAVIELDGPTPHRVPVSRAKIAEVKARLGLARKHA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
7 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
11 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
12 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
13 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
14 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
15 2738543024 Aminobacter sp. AP02 Isolate Unclassified
16 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
17 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
18 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
19 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
20 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
21 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
22 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
23 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
24 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
25 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
26 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
27 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
28 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
29 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
30 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
31 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
32 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
33 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
34 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
35 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
36 2922368715
37 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
38 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
39 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
40 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
41 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
42 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
43 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
44 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
45 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
46 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
47 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
48 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
49 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
50 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
51 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
52 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
53 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
54 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
55 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
56 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
57 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
58 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
59 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
60 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
61 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
62 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
63 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
64 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
65 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
66 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
67 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
68 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
69 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
70 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
71 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
72 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
73 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
74 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
75 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
76 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
77 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
78 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
79 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
80 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
81 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
82 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
83 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
84 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
85 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
86 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
87 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
88 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
89 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
90 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
91 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
92 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
100 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
122 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
248 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
251 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
252 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
259 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
260 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
261 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
262 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
263 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
264 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
265 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
266 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
267 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
268 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
269 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
270 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
271 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
272 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
273 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
274 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.35
Metatranscriptomes 0.29
Isolates 29.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.41
Nodule 24.64
Rhizoplane 4.06
Rhizosphere 49.28
Stem 0
Stem Tuber 0
Unclassified 13.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10116622 3300003323 Bacteria 1464
2 JGI25404J52841_10005926 3300003659 Bacteria 2538
3 JGI25404J52841_10008905 3300003659 Bacteria 2143
4 Ga0070683_100025576 3300005329 Bacteria 5303
5 Ga0070683_100072246 3300005329 Bacteria 3220
6 Ga0070680_100045758 3300005336 Bacteria 3558
7 Ga0070671_100111823 3300005355 Bacteria 2294
8 Ga0070709_10003812 3300005434 Bacteria 8109
9 Ga0070709_10015240 3300005434 Bacteria 4369
10 Ga0070714_100017621 3300005435 Bacteria 5788
11 Ga0070714_100081343 3300005435 Bacteria 2819
12 Ga0070714_100103159 3300005435 Bacteria 2515
13 Ga0070714_100240419 3300005435 Bacteria 1671
14 Ga0070713_100040332 3300005436 Bacteria 3795
15 Ga0070713_100080516 3300005436 Bacteria 2777
16 Ga0070710_10009715 3300005437 Bacteria 4713
17 Ga0070710_10051742 3300005437 Bacteria 2307
18 Ga0070711_100006521 3300005439 Bacteria 7041
19 Ga0070711_100100135 3300005439 Bacteria 2107
20 Ga0070663_100220024 3300005455 Bacteria 1490
21 Ga0070681_10037152 3300005458 Bacteria 4888
22 Ga0070681_10107989 3300005458 Bacteria 2723
23 Ga0070679_100068438 3300005530 Bacteria 3541
24 Ga0070679_100125293 3300005530 Bacteria 2551
25 Ga0070684_100025988 3300005535 Bacteria 4928
26 Ga0070684_100123789 3300005535 Bacteria 2327
27 Ga0070697_100089071 3300005536 Bacteria 2549
28 Ga0068857_100058358 3300005577 Bacteria 3427
29 Ga0068856_100223586 3300005614 Bacteria 1898
30 Ga0068863_100138846 3300005841 Bacteria 2323
31 Ga0081455_10010152 3300005937 Bacteria 9592
32 Ga0081455_10083839 3300005937 Bacteria 2603
33 Ga0081540_1002134 3300005983 Bacteria 16458
34 Ga0081540_1006679 3300005983 Bacteria 8346
35 Ga0081540_1022175 3300005983 Bacteria 3754
36 Ga0081540_1043573 3300005983 Bacteria 2300
37 Ga0081540_1061513 3300005983 Bacteria 1789
38 Ga0070715_10005070 3300006163 Bacteria 4369
39 Ga0070716_100023688 3300006173 Bacteria 3258
40 Ga0070712_100023454 3300006175 Bacteria 4077
41 Ga0075434_100007552 3300006871 Bacteria 10072
42 Ga0079104_1001597 3300006946 Bacteria 14779
43 Ga0075435_100164925 3300007076 Bacteria 1868
44 Ga0099794_10056257 3300007265 Bacteria 1903
45 Ga0105240_10095810 3300009093 Bacteria 3618
46 Ga0105240_10203403 3300009093 Bacteria 2319
47 Ga0105237_10031716 3300009545 Bacteria 5353
48 Ga0105238_10111854 3300009551 Bacteria 2711
49 Ga0123340_1004720 3300009763 Bacteria 12964
50 Ga0123341_1003157 3300009765 Bacteria 13995
51 Ga0099796_10059257 3300010159 Bacteria 1352
52 Ga0105239_10065045 3300010375 Bacteria 4004
53 Ga0105239_10157760 3300010375 Bacteria 2535
54 Ga0157374_10076445 3300013296 Bacteria 3166
55 Ga0157378_10058109 3300013297 Bacteria 3449
56 Ga0157379_10044776 3300014968 Bacteria 3950
57 Ga0213872_10007142 3300021361 Bacteria 5521
58 Ga0213876_10051081 3300021384 Bacteria 2185
59 Ga0209677_100233 3300025253 Bacteria 39376
60 Ga0209148_1000232 3300025254 Bacteria 90923
61 Ga0209148_1009243 3300025254 Bacteria 1932
62 Ga0209233_1003242 3300025261 Bacteria 5767
63 Ga0209233_1005429 3300025261 Bacteria 4230
64 Ga0209455_1002829 3300025272 Bacteria 6449
65 Ga0209455_1004954 3300025272 Bacteria 4225
66 Ga0209455_1012677 3300025272 Bacteria 2001
67 Ga0207692_10007305 3300025898 Bacteria 4522
68 Ga0207699_10050329 3300025906 Bacteria 2456
69 Ga0207699_10133964 3300025906 Bacteria 1620
70 Ga0207707_10012581 3300025912 Bacteria 7354
71 Ga0207693_10002911 3300025915 Bacteria 14822
72 Ga0207693_10012587 3300025915 Bacteria 6834
73 Ga0207693_10021873 3300025915 Bacteria 5086
74 Ga0207693_10136801 3300025915 Bacteria 1926
75 Ga0207663_10000363 3300025916 Bacteria 19735
76 Ga0207660_10034677 3300025917 Bacteria 3498
77 Ga0207652_10058569 3300025921 Bacteria 3319
78 Ga0207652_10150701 3300025921 Bacteria 2082
79 Ga0207700_10016813 3300025928 Bacteria 4871
80 Ga0207700_10205827 3300025928 Bacteria 1661
81 Ga0207664_10008514 3300025929 Bacteria 7162
82 Ga0207664_10090088 3300025929 Bacteria 2513
83 Ga0207664_10099721 3300025929 Bacteria 2397
84 Ga0207665_10000530 3300025939 Bacteria 25694
85 Ga0207691_10135790 3300025940 Bacteria 2169
86 Ga0207661_10025500 3300025944 Bacteria 4494
87 Ga0207703_10116034 3300026035 Bacteria 2291
88 Ga0207639_10097574 3300026041 Bacteria 2367
89 Ga0207641_10208533 3300026088 Bacteria 1806
90 Ga0207674_10063749 3300026116 Bacteria 3719
91 Ga0209281_1000487 3300027111 Bacteria 54997
92 Ga0268266_10019067 3300028379 Bacteria 5842
93 Ga0268266_10030070 3300028379 Bacteria 4615
94 Ga0265323_10002038 3300028653 Bacteria 9496
95 Ga0265336_10001646 3300028666 Bacteria 9902
96 Ga0265338_10000271 3300028800 Bacteria 94819
97 Ga0265339_10010425 3300031249 Bacteria 5774
98 Ga0307508_10000019 3300031616 Bacteria 197575
99 Ga0265314_10006217 3300031711 Bacteria 10603
100 Ga0307516_10016366 3300031730 Bacteria 7759
101 Ga0307507_10071012 3300033179 Bacteria 3152
102 Ga0373926_0007685 3300035083 Bacteria 3591
103 Ga0373923_0001927 3300035111 Bacteria 6212
104 Ga0373936_0006606 3300035113 Bacteria 4366
105 Ga0373936_0007244 3300035113 Bacteria 4174
106 Ga0373945_0039929 3300035116 Bacteria 1693
107 Ga0373943_0079926 3300035170 Bacteria 1675
108 Ga0373943_0083799 3300035170 Bacteria 1639
109 Ga0373946_0009653 3300035171 Bacteria 3561
110 Ga0373935_0001695 3300035692 Bacteria 12321
111 Ga0373935_0035375 3300035692 Bacteria 3117
112 Ga0373927_0000792 3300035695 Bacteria 24123
113 Ga0373927_0005011 3300035695 Bacteria 9172
114 Ga0373927_0020802 3300035695 Bacteria 4300
115 Ga0373933_0065664 3300035724 Bacteria 2197
116 Ga0373947_0010797 3300035725 Bacteria 5239
117 Ga0373937_0002152 3300036401 Bacteria 16491
118 Ga0372808_004471 3300036459 Bacteria 1788
119 Ga0373925_0006315 3300037068 Bacteria 8733
120 Ga0373925_0119863 3300037068 Bacteria 2042
121 Ga0395898_0004066 3300037466 Bacteria 16063
122 Ga0395898_0176525 3300037466 Bacteria 2042
123 Ga0395905_0049498 3300037471 Bacteria 3938
124 Ga0395901_0359797 3300038443 Bacteria 1501
125 Ga0436365_1717494 3300039437 Bacteria 2096
126 Ga0436361_0586007 3300039447 Bacteria 3838
127 Ga0466966_0118653 3300044684 Bacteria 1627
128 Ga0466958_0076020 3300045836 Bacteria 2061
129 Ga0466967_0078624 3300045976 Bacteria 2972
130 Ga0495592_0207933 3300046454 Bacteria 1316
131 Ga0495603_0001070 3300046455 Bacteria 15886
132 Ga0495629_0001441 3300046459 Bacteria 18767
133 Ga0495629_0217498 3300046459 Bacteria 1318
134 Ga0495638_0010779 3300046460 Bacteria 6324
135 Ga0495641_0004779 3300046461 Bacteria 9427
136 Ga0495580_0025029 3300046472 Bacteria 4364
137 Ga0495582_0004432 3300046473 Bacteria 7895
138 Ga0495582_0013563 3300046473 Bacteria 4486
139 Ga0495639_0000231 3300046475 Bacteria 27804
140 Ga0495662_0000454 3300046476 Bacteria 18465
141 Ga0495662_0011816 3300046476 Bacteria 4266
142 Ga0495664_0005763 3300046477 Bacteria 6818
143 Ga0495664_0085355 3300046477 Bacteria 1895
144 Ga0495594_0001871 3300046499 Bacteria 10951
145 Ga0495610_0086044 3300046512 Bacteria 1433
146 Ga0495630_0023671 3300046517 Bacteria 4540
147 Ga0495643_0001376 3300046522 Bacteria 22761
148 Ga0495648_0000621 3300046524 Bacteria 37988
149 Ga0495666_0050397 3300046526 Bacteria 2001
150 Ga0495652_0042232 3300046529 Bacteria 3933
151 Ga0495665_0002780 3300046531 Bacteria 9444
152 Ga0495640_0004041 3300046533 Bacteria 11737
153 Ga0495640_0075715 3300046533 Bacteria 2247
154 Ga0495645_0078718 3300046543 Bacteria 2369
155 Ga0495667_0022696 3300046559 Bacteria 4228
156 Ga0495634_0000633 3300046642 Bacteria 34239
157 Ga0495635_0001529 3300046663 Bacteria 15481
158 Ga0495588_0061691 3300046674 Bacteria 1942
159 Ga0495599_0048335 3300046678 Bacteria 2667
160 Ga0495646_0009029 3300046680 Bacteria 6321
161 Ga0495647_0002687 3300046681 Bacteria 5650
162 Ga0495647_0029564 3300046681 Bacteria 2027
163 Ga0495658_0001643 3300046683 Bacteria 11621
164 Ga0495658_0070467 3300046683 Bacteria 2029
165 Ga0495613_0011777 3300046689 Bacteria 6500
166 Ga0495624_0068244 3300046690 Bacteria 2217
167 Ga0495660_0073835 3300046810 Bacteria 1803
168 Ga0495581_0000174 3300047315 Bacteria 29174
169 Ga0495581_0037788 3300047315 Bacteria 2794
170 Ga0495674_0008776 3300047319 Bacteria 9618
171 Ga0495674_0025856 3300047319 Bacteria 5374
172 Ga0495676_0008428 3300047321 Bacteria 9451
173 Ga0495676_0137628 3300047321 Bacteria 1754
174 Ga0495684_0094112 3300047471 Bacteria 2269
175 Ga0495686_0121872 3300047472 Bacteria 1553
176 Ga0495593_0006361 3300047673 Bacteria 6927
177 Ga0495593_0034853 3300047673 Bacteria 2735
178 Ga0496101_0052853 3300048904 Bacteria 2930
179 Ga0496101_0063179 3300048904 Bacteria 2695
180 Ga0496102_0058896 3300048905 Bacteria 3511
181 Ga0496104_0200267 3300048907 Bacteria 1909
182 Ga0496105_0015051 3300048908 Bacteria 6156
183 Ga0496106_0002973 3300048909 Bacteria 12618
184 Ga0496109_0085195 3300048912 Bacteria 2917
185 Ga0496111_0063253 3300048914 Bacteria 2684
186 Ga0496112_0017162 3300048915 Bacteria 6798
187 Ga0496112_0033000 3300048915 Bacteria 5027
188 Ga0496112_0185424 3300048915 Bacteria 2044
189 Ga0496113_0094579 3300048916 Bacteria 2309
190 Ga0496113_0153430 3300048916 Bacteria 1818
191 Ga0496115_0013834 3300048918 Bacteria 6111
192 Ga0496116_0084007 3300048919 Bacteria 1963
193 Ga0496117_0093368 3300048920 Bacteria 1930
194 Ga0496117_0121964 3300048920 Bacteria 1599
195 Ga0496118_0007271 3300048921 Bacteria 11791
196 Ga0496118_0011124 3300048921 Bacteria 8821
197 Ga0496121_0000418 3300048924 Bacteria 84182
198 Ga0496121_0006985 3300048924 Bacteria 13732
199 Ga0496121_0046583 3300048924 Bacteria 3710
200 Ga0496121_0153554 3300048924 Bacteria 1691
201 Ga0496124_0001129 3300048927 Bacteria 42006
202 Ga0496125_0000731 3300048928 Bacteria 54449
203 Ga0496125_0024409 3300048928 Bacteria 5561
204 Ga0496126_0004045 3300048929 Bacteria 17839
205 Ga0496126_0008269 3300048929 Bacteria 11234
206 Ga0496126_0090991 3300048929 Bacteria 2684
207 Ga0496126_0091020 3300048929 Bacteria 2683
208 Ga0496126_0112288 3300048929 Bacteria 2373
209 Ga0496126_0214116 3300048929 Bacteria 1621
210 Ga0496126_0258359 3300048929 Bacteria 1449
211 Ga0501032_0095936 3300049569 Bacteria 1966
212 Ga0501033_0002458 3300049570 Bacteria 15740
213 Ga0501037_0034789 3300049573 Bacteria 3717
214 Ga0501043_0100638 3300049579 Bacteria 2272
215 Ga0501046_0051992 3300049580 Bacteria 3231
216 Ga0501047_0131742 3300049581 Bacteria 2380
217 Ga0501074_0042345 3300049590 Bacteria 3295
218 Ga0501080_0014365 3300049742 Bacteria 7291
219 Ga0501044_0014478 3300049823 Bacteria 8514
220 nmdc:mga0n895_258870_c1 3300050512 Bacteria 1766
221 nmdc:mga0n895_27060_c1 3300050512 Bacteria 5443
222 Ga0495619_0055770 3300053085 Bacteria 2618
223 Ga0500578_0005240 3300053086 Bacteria 8860
224 Ga0500583_0117210 3300053092 Bacteria 1315
225 Ga0500566_0000588 3300053094 Bacteria 20372
226 Ga0500641_0030543 3300053096 Bacteria 2118
227 Ga0500572_000359 3300053111 Bacteria 16208
228 Ga0500572_001838 3300053111 Bacteria 5378
229 Ga0500595_036910 3300053119 Bacteria 1598
230 Ga0500614_002737 3300053123 Bacteria 3886
231 Ga0500642_0010021 3300053130 Bacteria 3322
232 Ga0500559_0006335 3300053136 Bacteria 5343
233 Ga0500559_0016000 3300053136 Bacteria 3167
234 Ga0500603_000114 3300053150 Bacteria 18972
235 Ga0500603_001059 3300053150 Bacteria 6462
236 Ga0500604_0035601 3300053151 Bacteria 1482
237 Ga0500616_0002973 3300053153 Bacteria 13433
238 Ga0500630_002671 3300053159 Bacteria 8576
239 Ga0500639_000006 3300053163 Bacteria 165068
240 Ga0500639_090090 3300053163 Bacteria 1529
241 Ga0500637_0020779 3300053178 Bacteria 3560
242 Ga0500576_046938 3300053725 Bacteria 1928
243 Ga0500596_000335 3300053735 Bacteria 8490

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035113 Ga0373936_0006606 Ga0373936_0006606_1804_3045 334
2 3300035116 Ga0373945_0039929 Ga0373945_0039929_439_1680 334
3 3300035171 Ga0373946_0009653 Ga0373946_0009653_886_2127 334
4 3300035692 Ga0373935_0001695 Ga0373935_0001695_7825_9066 334
5 3300035695 Ga0373927_0000792 Ga0373927_0000792_6312_7553 334
6 3300035725 Ga0373947_0010797 Ga0373947_0010797_797_2038 334
7 3300036401 Ga0373937_0002152 Ga0373937_0002152_1583_2824 334
8 3300037068 Ga0373925_0006315 Ga0373925_0006315_2472_3713 334
9 3300046455 Ga0495603_0001070 Ga0495603_0001070_13856_15097 334
10 3300046459 Ga0495629_0001441 Ga0495629_0001441_6414_7655 334
11 3300046461 Ga0495641_0004779 Ga0495641_0004779_2095_3336 334
12 3300046472 Ga0495580_0025029 Ga0495580_0025029_2079_3320 334
13 3300046473 Ga0495582_0004432 Ga0495582_0004432_1634_2875 334
14 3300046475 Ga0495639_0000231 Ga0495639_0000231_25337_26578 334
15 3300046476 Ga0495662_0000454 Ga0495662_0000454_2425_3666 334
16 3300046477 Ga0495664_0005763 Ga0495664_0005763_1990_3231 334
17 3300046499 Ga0495594_0001871 Ga0495594_0001871_5708_6949 334
18 3300046517 Ga0495630_0023671 Ga0495630_0023671_2029_3270 334
19 3300046526 Ga0495666_0050397 Ga0495666_0050397_619_1860 334
20 3300046531 Ga0495665_0002780 Ga0495665_0002780_1962_3203 334
21 3300046533 Ga0495640_0004041 Ga0495640_0004041_4478_5719 334
22 3300046559 Ga0495667_0022696 Ga0495667_0022696_2691_3932 334
23 3300046642 Ga0495634_0000633 Ga0495634_0000633_32203_33444 334
24 3300046663 Ga0495635_0001529 Ga0495635_0001529_3722_4963 334
25 3300046678 Ga0495599_0048335 Ga0495599_0048335_588_1829 334
26 3300046680 Ga0495646_0009029 Ga0495646_0009029_1708_2949 334
27 3300046681 Ga0495647_0002687 Ga0495647_0002687_834_2075 334
28 3300046683 Ga0495658_0001643 Ga0495658_0001643_3964_5205 334
29 3300046689 Ga0495613_0011777 Ga0495613_0011777_3193_4434 334
30 3300047315 Ga0495581_0000174 Ga0495581_0000174_6405_7646 334
31 3300047319 Ga0495674_0008776 Ga0495674_0008776_2118_3359 334
32 3300047321 Ga0495676_0008428 Ga0495676_0008428_6248_7489 334
33 3300047673 Ga0495593_0006361 Ga0495593_0006361_785_2026 334
34 3300053085 Ga0495619_0055770 Ga0495619_0055770_995_2236 334
35 3300021361 Ga0213872_10007142 Ga0213872_100071425 336
36 3300039447 Ga0436361_0586007 Ga0436361_0586007_2390_3652 336
37 3300005355 Ga0070671_100111823 Ga0070671_1001118232 337
38 3300025940 Ga0207691_10135790 Ga0207691_101357902 337
39 3300028379 Ga0268266_10019067 Ga0268266_100190674 337
40 3300037466 Ga0395898_0004066 Ga0395898_0004066_8013_9245 337
41 3300038443 Ga0395901_0359797 Ga0395901_0359797_257_1489 337
42 3300005841 Ga0068863_100138846 Ga0068863_1001388461 340
43 3300026088 Ga0207641_10208533 Ga0207641_102085331 340
44 3300031616 Ga0307508_10000019 Ga0307508_100000194 343
45 3300048918 Ga0496115_0013834 Ga0496115_0013834_444_1670 346
46 3300005983 Ga0081540_1002134 Ga0081540_10021346 347
47 3300037466 Ga0395898_0176525 Ga0395898_0176525_670_1872 347
48 3300037471 Ga0395905_0049498 Ga0395905_0049498_214_1416 347
49 3300053096 Ga0500641_0030543 Ga0500641_0030543_17_1234 347
50 3300025915 Ga0207693_10021873 Ga0207693_100218734 348
51 3300035113 Ga0373936_0007244 Ga0373936_0007244_2098_3306 348
52 3300053094 Ga0500566_0000588 Ga0500566_0000588_4226_5434 348
53 3300053111 Ga0500572_001838 Ga0500572_001838_893_2101 348
54 3300053123 Ga0500614_002737 Ga0500614_002737_201_1409 348
55 3300053136 Ga0500559_0016000 Ga0500559_0016000_872_2080 348
56 3300053150 Ga0500603_000114 Ga0500603_000114_13264_14472 348
57 3300053159 Ga0500630_002671 Ga0500630_002671_3153_4361 348
58 3300053163 Ga0500639_000006 Ga0500639_000006_79901_81109 348
59 3300053735 Ga0500596_000335 Ga0500596_000335_3256_4464 348
60 3300005458 Ga0070681_10037152 Ga0070681_100371523 349
61 3300005530 Ga0070679_100125293 Ga0070679_1001252931 349
62 3300025912 Ga0207707_10012581 Ga0207707_100125813 349
63 3300025921 Ga0207652_10058569 Ga0207652_100585692 349
64 3300046454 Ga0495592_0207933 Ga0495592_0207933_53_1246 349
65 3300048907 Ga0496104_0200267 Ga0496104_0200267_445_1638 349
66 3300053092 Ga0500583_0117210 Ga0500583_0117210_17_1219 349
67 3300053130 Ga0500642_0010021 Ga0500642_0010021_1483_2685 349
68 3300053151 Ga0500604_0035601 Ga0500604_0035601_18_1220 349
69 3300047472 Ga0495686_0121872 Ga0495686_0121872_68_1261 350
70 3300005983 Ga0081540_1061513 Ga0081540_10615131 353
71 3300005536 Ga0070697_100089071 Ga0070697_1000890712 354
72 3300010375 Ga0105239_10157760 Ga0105239_101577601 354
73 3300026035 Ga0207703_10116034 Ga0207703_101160341 354
74 3300048914 Ga0496111_0063253 Ga0496111_0063253_1192_2400 354
75 iso_pu_bacteria 8019576017 8019578545 354
76 3300005329 Ga0070683_100072246 Ga0070683_1000722464 358
77 3300005336 Ga0070680_100045758 Ga0070680_1000457584 358
78 3300005458 Ga0070681_10107989 Ga0070681_101079893 358
79 3300005530 Ga0070679_100068438 Ga0070679_1000684382 358
80 3300005535 Ga0070684_100025988 Ga0070684_1000259883 358
81 3300005577 Ga0068857_100058358 Ga0068857_1000583583 358
82 3300025917 Ga0207660_10034677 Ga0207660_100346773 358
83 3300026116 Ga0207674_10063749 Ga0207674_100637493 358
84 3300005435 Ga0070714_100103159 Ga0070714_1001031591 359
85 3300005436 Ga0070713_100040332 Ga0070713_1000403323 359
86 3300025928 Ga0207700_10016813 Ga0207700_100168134 359
87 3300025929 Ga0207664_10090088 Ga0207664_100900882 359
88 3300053136 Ga0500559_0006335 Ga0500559_0006335_2032_3249 360
89 3300053725 Ga0500576_046938 Ga0500576_046938_170_1387 360
90 3300025261 Ga0209233_1003242 Ga0209233_10032424 361
91 3300025254 Ga0209148_1000232 Ga0209148_100023271 362
92 3300025272 Ga0209455_1002829 Ga0209455_10028292 362
93 3300048928 Ga0496125_0000731 Ga0496125_0000731_39213_40448 362
94 iso_pu_bacteria 2921201388 2921204312 362
95 3300007265 Ga0099794_10056257 Ga0099794_100562571 363
96 3300025921 Ga0207652_10150701 Ga0207652_101507012 363
97 3300031249 Ga0265339_10010425 Ga0265339_100104255 363
98 3300005435 Ga0070714_100240419 Ga0070714_1002404192 364
99 3300005437 Ga0070710_10051742 Ga0070710_100517422 364
100 3300005439 Ga0070711_100006521 Ga0070711_1000065216 364
101 3300005455 Ga0070663_100220024 Ga0070663_1002200241 364
102 3300028653 Ga0265323_10002038 Ga0265323_100020388 364
103 3300028666 Ga0265336_10001646 Ga0265336_100016468 364
104 3300028800 Ga0265338_10000271 Ga0265338_1000027155 364
105 3300046512 Ga0495610_0086044 Ga0495610_0086044_76_1275 364
106 3300046522 Ga0495643_0001376 Ga0495643_0001376_11976_13175 364
107 3300046810 Ga0495660_0073835 Ga0495660_0073835_83_1282 364
108 3300053086 Ga0500578_0005240 Ga0500578_0005240_1103_2302 364
109 3300053153 Ga0500616_0002973 Ga0500616_0002973_11020_12219 364
110 iso_pu_bacteria 2852387548 2852393262 364
111 3300036459 Ga0372808_004471 Ga0372808_004471_481_1686 368
112 3300045976 Ga0466967_0078624 Ga0466967_0078624_1680_2903 368
113 3300046524 Ga0495648_0000621 Ga0495648_0000621_2957_4207 368
114 3300049569 Ga0501032_0095936 Ga0501032_0095936_620_1822 368
115 3300049580 Ga0501046_0051992 Ga0501046_0051992_112_1314 368
116 3300049581 Ga0501047_0131742 Ga0501047_0131742_305_1507 368
117 3300049590 Ga0501074_0042345 Ga0501074_0042345_572_1774 368
118 3300049742 Ga0501080_0014365 Ga0501080_0014365_3949_5151 368
119 3300049823 Ga0501044_0014478 Ga0501044_0014478_1270_2472 368
120 3300005937 Ga0081455_10083839 Ga0081455_100838392 369
121 3300005983 Ga0081540_1022175 Ga0081540_10221753 369
122 3300025906 Ga0207699_10133964 Ga0207699_101339641 369
123 3300039437 Ga0436365_1717494 Ga0436365_1717494_679_1893 369
124 3300048924 Ga0496121_0153554 Ga0496121_0153554_327_1526 369
125 3300026041 Ga0207639_10097574 Ga0207639_100975741 370
126 3300031730 Ga0307516_10016366 Ga0307516_100163662 370
127 3300046683 Ga0495658_0070467 Ga0495658_0070467_777_1988 370
128 iso_pu_bacteria 2517093001 2517104403 370
129 3300009763 Ga0123340_1004720 Ga0123340_10047203 371
130 3300009765 Ga0123341_1003157 Ga0123341_10031576 371
131 3300048920 Ga0496117_0093368 Ga0496117_0093368_35_1258 371
132 3300048924 Ga0496121_0006985 Ga0496121_0006985_8542_9765 371
133 3300009093 Ga0105240_10203403 Ga0105240_102034031 372
134 3300009551 Ga0105238_10111854 Ga0105238_101118541 372
135 3300048909 Ga0496106_0002973 Ga0496106_0002973_9526_10749 372
136 3300048919 Ga0496116_0084007 Ga0496116_0084007_395_1618 372
137 3300048921 Ga0496118_0007271 Ga0496118_0007271_3576_4799 372
138 3300048924 Ga0496121_0000418 Ga0496121_0000418_28694_29917 372
139 3300048927 Ga0496124_0001129 Ga0496124_0001129_7426_8649 372
140 3300048928 Ga0496125_0024409 Ga0496125_0024409_1484_2707 372
141 3300048929 Ga0496126_0091020 Ga0496126_0091020_203_1402 372
142 3300053111 Ga0500572_000359 Ga0500572_000359_10615_11832 372
143 3300053163 Ga0500639_090090 Ga0500639_090090_98_1315 372
144 iso_pu_bacteria 2824753945 2824761434 373
145 iso_pu_bacteria 2824763712 2824771218 373
146 iso_pu_bacteria 2876761206 2876767472 373
147 iso_pu_bacteria 2904711408 2904713726 373
148 iso_pu_bacteria 3003930520 3003934228 373
149 iso_pu_bacteria 8057575449 8057579483 373
150 3300003659 JGI25404J52841_10005926 JGI25404J52841_100059262 374
151 3300003659 JGI25404J52841_10008905 JGI25404J52841_100089052 374
152 3300005983 Ga0081540_1006679 Ga0081540_10066793 374
153 3300005983 Ga0081540_1043573 Ga0081540_10435732 374
154 3300007076 Ga0075435_100164925 Ga0075435_1001649252 374
155 3300009093 Ga0105240_10095810 Ga0105240_100958101 374
156 3300025915 Ga0207693_10136801 Ga0207693_101368012 374
157 3300025928 Ga0207700_10205827 Ga0207700_102058271 374
158 3300050512 nmdc:mga0n895_258870_c1 nmdc:mga0n895_258870_c1_116_1291 374
159 iso_pu_bacteria 8046767195 8046772208 374
160 3300005435 Ga0070714_100081343 Ga0070714_1000813431 375
161 3300025929 Ga0207664_10099721 Ga0207664_100997212 375
162 iso_pu_bacteria 2513237104 2513717732 375
163 iso_pu_bacteria 2935959822 2935965673 375
164 iso_pu_bacteria 2967671571 2967676074 375
165 iso_pu_bacteria 2513237140 2513883624 376
166 iso_pu_bacteria 2513237143 2513903654 376
167 iso_pu_bacteria 2524023207 2524449078 376
168 iso_pu_bacteria 2551306089 2551710761 376
169 iso_pu_bacteria 2551306091 2551724457 376
170 iso_pu_bacteria 2915986958 2915990991 376
171 iso_pu_bacteria 2924193448 2924199968 376
172 iso_pu_bacteria 2937106411 2937112282 376
173 iso_pu_bacteria 2937113482 2937113561 376
174 iso_pu_bacteria 2957457609 2957459614 376
175 iso_pu_bacteria 2957491536 2957495040 376
176 iso_pu_bacteria 2960597568 2960597664 376
177 iso_pu_bacteria 2960617483 2960624023 376
178 iso_pu_bacteria 2960667422 2960671908 376
179 iso_pu_bacteria 2960674078 2960674330 376
180 iso_pu_bacteria 2964691889 2964691895 376
181 iso_pu_bacteria 2964698721 2964704948 376
182 iso_pu_bacteria 2964712639 2964716372 376
183 iso_pu_bacteria 2967664464 2967671267 376
184 iso_pu_bacteria 2967699805 2967700791 376
185 iso_pu_bacteria 2970076120 2970079462 376
186 iso_pu_bacteria 2970082768 2970084940 376
187 iso_pu_bacteria 648276728 648736047 376
188 3300021384 Ga0213876_10051081 Ga0213876_100510812 377
189 3300048929 Ga0496126_0008269 Ga0496126_0008269_969_2207 377
190 3300053150 Ga0500603_001059 Ga0500603_001059_3342_4550 377
191 3300053178 Ga0500637_0020779 Ga0500637_0020779_90_1298 377
192 iso_pu_bacteria 2515154107 2515609583 377
193 iso_pu_bacteria 2528768022 2528854623 377
194 iso_pu_bacteria 2824600985 2824607190 377
195 iso_pu_bacteria 2824609381 2824615110 377
196 iso_pu_bacteria 2824653114 2824660170 377
197 iso_pu_bacteria 2824661429 2824668453 377
198 iso_pu_bacteria 2888419890 2888426661 377
199 iso_pu_bacteria 2929615660 2929620080 377
200 iso_pu_bacteria 2929624759 2929629393 377
201 iso_pu_bacteria 2933577622 2933581997 377
202 iso_pu_bacteria 8006926726 8006929298 377
203 iso_pu_bacteria 8055742211 8055750167 377
204 3300010159 Ga0099796_10059257 Ga0099796_100592571 378
205 3300013296 Ga0157374_10076445 Ga0157374_100764452 378
206 3300035695 Ga0373927_0005011 Ga0373927_0005011_6112_7329 378
207 3300037068 Ga0373925_0119863 Ga0373925_0119863_775_1992 378
208 iso_pu_bacteria 2524023210 2524464863 378
209 iso_pu_bacteria 2885383462 2885389671 378
210 3300005329 Ga0070683_100025576 Ga0070683_1000255764 379
211 3300005535 Ga0070684_100123789 Ga0070684_1001237892 379
212 3300025944 Ga0207661_10025500 Ga0207661_100255003 379
213 3300046674 Ga0495588_0061691 Ga0495588_0061691_478_1695 379
214 3300048929 Ga0496126_0090991 Ga0496126_0090991_310_1533 379
215 3300048929 Ga0496126_0214116 Ga0496126_0214116_77_1297 379
216 iso_pu_bacteria 2508501128 2509146569 379
217 iso_pu_bacteria 2513237098 2513671556 379
218 3300005937 Ga0081455_10010152 Ga0081455_100101527 380
219 3300006946 Ga0079104_1001597 Ga0079104_10015974 380
220 3300027111 Ga0209281_1000487 Ga0209281_100048762 380
221 3300048915 Ga0496112_0033000 Ga0496112_0033000_1335_2543 380
222 3300048929 Ga0496126_0112288 Ga0496126_0112288_583_1788 380
223 3300050512 nmdc:mga0n895_27060_c1 nmdc:mga0n895_27060_c1_3207_4442 380
224 3300048924 Ga0496121_0046583 Ga0496121_0046583_1459_2793 381
225 3300005434 Ga0070709_10003812 Ga0070709_100038122 382
226 3300005435 Ga0070714_100017621 Ga0070714_1000176211 382
227 3300005436 Ga0070713_100080516 Ga0070713_1000805161 382
228 3300005437 Ga0070710_10009715 Ga0070710_100097154 382
229 3300006163 Ga0070715_10005070 Ga0070715_100050703 382
230 3300006173 Ga0070716_100023688 Ga0070716_1000236883 382
231 3300025898 Ga0207692_10007305 Ga0207692_100073052 382
232 3300025915 Ga0207693_10012587 Ga0207693_100125876 382
233 3300025916 Ga0207663_10000363 Ga0207663_1000036310 382
234 3300025929 Ga0207664_10008514 Ga0207664_100085145 382
235 3300025939 Ga0207665_10000530 Ga0207665_1000053017 382
236 3300028379 Ga0268266_10030070 Ga0268266_100300702 382
237 3300031711 Ga0265314_10006217 Ga0265314_100062179 382
238 3300035170 Ga0373943_0079926 Ga0373943_0079926_272_1489 382
239 3300053119 Ga0500595_036910 Ga0500595_036910_317_1555 382
240 3300046460 Ga0495638_0010779 Ga0495638_0010779_648_1862 383
241 3300048912 Ga0496109_0085195 Ga0496109_0085195_455_1666 383
242 3300048915 Ga0496112_0017162 Ga0496112_0017162_4674_5885 383
243 3300048916 Ga0496113_0153430 Ga0496113_0153430_106_1317 383
244 iso_pu_bacteria 2899803654 2899808248 383
245 iso_pu_bacteria 8056967851 8056975948 383
246 3300005614 Ga0068856_100223586 Ga0068856_1002235862 384
247 3300009545 Ga0105237_10031716 Ga0105237_100317163 384
248 3300010375 Ga0105239_10065045 Ga0105239_100650452 384
249 3300014968 Ga0157379_10044776 Ga0157379_100447763 384
250 3300033179 Ga0307507_10071012 Ga0307507_100710122 384
251 3300035083 Ga0373926_0007685 Ga0373926_0007685_409_1617 384
252 3300035111 Ga0373923_0001927 Ga0373923_0001927_3313_4521 384
253 3300035170 Ga0373943_0083799 Ga0373943_0083799_272_1480 384
254 3300035692 Ga0373935_0035375 Ga0373935_0035375_1716_2924 384
255 3300035724 Ga0373933_0065664 Ga0373933_0065664_939_2147 384
256 3300046459 Ga0495629_0217498 Ga0495629_0217498_62_1270 384
257 3300046473 Ga0495582_0013563 Ga0495582_0013563_431_1639 384
258 3300046476 Ga0495662_0011816 Ga0495662_0011816_1982_3190 384
259 3300046477 Ga0495664_0085355 Ga0495664_0085355_271_1479 384
260 3300046529 Ga0495652_0042232 Ga0495652_0042232_1974_3182 384
261 3300046533 Ga0495640_0075715 Ga0495640_0075715_478_1686 384
262 3300046543 Ga0495645_0078718 Ga0495645_0078718_361_1569 384
263 3300046681 Ga0495647_0029564 Ga0495647_0029564_422_1630 384
264 3300046690 Ga0495624_0068244 Ga0495624_0068244_608_1816 384
265 3300047315 Ga0495581_0037788 Ga0495581_0037788_1299_2507 384
266 3300047319 Ga0495674_0025856 Ga0495674_0025856_2963_4171 384
267 3300047321 Ga0495676_0137628 Ga0495676_0137628_521_1729 384
268 3300047471 Ga0495684_0094112 Ga0495684_0094112_969_2177 384
269 3300047673 Ga0495593_0034853 Ga0495593_0034853_83_1291 384
270 3300048904 Ga0496101_0063179 Ga0496101_0063179_472_1707 384
271 3300048905 Ga0496102_0058896 Ga0496102_0058896_290_1525 384
272 3300048908 Ga0496105_0015051 Ga0496105_0015051_2702_3937 384
273 3300048915 Ga0496112_0185424 Ga0496112_0185424_327_1562 384
274 3300048916 Ga0496113_0094579 Ga0496113_0094579_740_1975 384
275 iso_pu_bacteria 3005718088 3005724182 384
276 3300025253 Ga0209677_100233 Ga0209677_1002332 385
277 3300048920 Ga0496117_0121964 Ga0496117_0121964_310_1533 385
278 3300048921 Ga0496118_0011124 Ga0496118_0011124_854_2077 385
279 3300048929 Ga0496126_0004045 Ga0496126_0004045_12176_13399 385
280 iso_pu_bacteria 2844315083 2844321151 385
281 iso_pu_bacteria 2903727486 2903728575 385
282 iso_pu_bacteria 2906602504 2906607766 385
283 3300025272 Ga0209455_1012677 Ga0209455_10126772 387
284 3300048929 Ga0496126_0258359 Ga0496126_0258359_195_1418 387
285 3300049570 Ga0501033_0002458 Ga0501033_0002458_1357_2592 387
286 3300049573 Ga0501037_0034789 Ga0501037_0034789_264_1502 387
287 3300049579 Ga0501043_0100638 Ga0501043_0100638_581_1819 387
288 iso_pu_bacteria 2513237141 2513887795 387
289 iso_pu_bacteria 2879099564 2879106332 387
290 iso_pu_bacteria 2922368715 2922370500 387
291 iso_pu_bacteria 2932784394 2932791436 387
292 iso_pu_bacteria 2932809354 2932815015 387
293 iso_pu_bacteria 2932818245 2932824128 387
294 iso_pu_bacteria 2932828146 2932835338 387
295 iso_pu_bacteria 2935616580 2935621081 387
296 iso_pu_bacteria 2935638405 2935643612 387
297 iso_pu_bacteria 2935665750 2935671078 387
298 iso_pu_bacteria 2935675223 2935681316 387
299 iso_pu_bacteria 2935684952 2935689338 387
300 iso_pu_bacteria 2935694250 2935699916 387
301 iso_pu_bacteria 2935703347 2935712153 387
302 iso_pu_bacteria 2935713505 2935720284 387
303 iso_pu_bacteria 2935722832 2935728099 387
304 iso_pu_bacteria 2935732158 2935737304 387
305 iso_pu_bacteria 2935741537 2935746635 387
306 iso_pu_bacteria 2935750917 2935757602 387
307 iso_pu_bacteria 2935760218 2935763978 387
308 iso_pu_bacteria 2935801545 2935807953 387
309 iso_pu_bacteria 2935810662 2935818711 387
310 iso_pu_bacteria 2935827899 2935833129 387
311 iso_pu_bacteria 2935837841 2935844215 387
312 iso_pu_bacteria 2935855204 2935859726 387
313 iso_pu_bacteria 2935864058 2935872124 387
314 iso_pu_bacteria 2935873716 2935878952 387
315 iso_pu_bacteria 2935992306 2936000299 387
316 iso_pu_bacteria 2936002035 2936008457 387
317 iso_pu_bacteria 2936037263 2936045521 387
318 iso_pu_bacteria 2940556831 2940563576 387
319 iso_pu_bacteria 2941531003 2941537327 387
320 iso_pu_bacteria 2941538514 2941542547 387
321 iso_pu_bacteria 8016511872 8016519433 387
322 iso_pu_bacteria 8017057580 8017066088 387
323 iso_pu_bacteria 8019586578 8019596595 387
324 iso_pu_bacteria 8019597564 8019605111 387
325 iso_pu_bacteria 8019608314 8019613426 387
326 3300005434 Ga0070709_10015240 Ga0070709_100152402 388
327 3300005439 Ga0070711_100100135 Ga0070711_1001001351 388
328 3300006175 Ga0070712_100023454 Ga0070712_1000234542 388
329 3300006871 Ga0075434_100007552 Ga0075434_1000075523 388
330 3300025906 Ga0207699_10050329 Ga0207699_100503292 388
331 3300025915 Ga0207693_10002911 Ga0207693_100029114 388
332 3300044684 Ga0466966_0118653 Ga0466966_0118653_344_1561 388
333 3300045836 Ga0466958_0076020 Ga0466958_0076020_661_1878 388
334 iso_pu_bacteria 2858800743 2858804564 388
335 iso_pu_bacteria 2964643177 2964648980 388
336 3300035695 Ga0373927_0020802 Ga0373927_0020802_2412_3650 389
337 iso_pu_bacteria 2524023205 2524438370 389
338 iso_pu_bacteria 2744054633 2745078479 389
339 3300048904 Ga0496101_0052853 Ga0496101_0052853_907_2223 390
340 iso_pu_bacteria 2738543024 2739306713 390
341 3300013297 Ga0157378_10058109 Ga0157378_100581093 392
342 3300025254 Ga0209148_1009243 Ga0209148_10092432 394
343 3300025261 Ga0209233_1005429 Ga0209233_10054292 394
344 3300025272 Ga0209455_1004954 Ga0209455_10049543 394
345 3300003323 rootH1_10116622 rootH1_101166221 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

335

433

0.96

PF03707

MHYT

Bacterial signalling protein N terminal repeat

157

215

0.95

PF03707

MHYT

Bacterial signalling protein N terminal repeat

95

152

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6w-assembly1.cif.gz_A lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. 0.8369 282 390
4g4k-assembly1.cif.gz_A structure of the staphylococcus aureus agra lyttr domain 0.8353 285 384
3d6w-assembly1.cif.gz_A lyttr dna-binding domain of putative methyl-accepting/dna response regulator from bacillus cereus. 0.8233 282 390
4g4k-assembly1.cif.gz_A structure of the staphylococcus aureus agra lyttr domain 0.8122 285 384
4xxe-assembly1.cif.gz_D structure of agra lyttr domain in complex with promoters 0.8023 283 384
ID Description Score Start End Superfamily
3d6wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.909 283 352 2.40.50.40
3d6wB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.897 283 352 2.40.50.40
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8915 283 351 2.40.50.40
af_P0AFT5_129_238_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.8692 281 390 2.40.50.1020
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8688 283 351 2.40.50.40
ID Description Score Start End GO Terms
AF-A0A4Q6EZN5-F1-model_v4 deleted 0.939 12 125
AF-A0A2N3S007-F1-model_v4 deleted 0.9247 282 387
AF-A0A3B9NT71-F1-model_v4 DNA-binding response regulator 0.9147 281 351 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A523X618-F1-model_v4 Response regulator 0.9145 282 361 GO:0000156
GO:0003677
AF-A0A1G5FD99-F1-model_v4 Stage 0 sporulation protein A homolog 0.9132 280 387 GO:0000156
GO:0003677

Feature Viewer

pLDDT pTM Quality
74.36 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map