F416345

General Info

Members Datasets Scaffolds Average Seq Length
345 202 332 164

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11061721|Ga0105240_110617211
Length 180
Sequence LIRCESNRLLGHLHMSAQIGGPGAAVRAHEELFAYWASLREGARLPGRRSLDPAGIKRLLPTVSLIDVVQEPRSGGGPEFRMRLAGTGLYGVYGREITGKRLGDIYNTAAADYWRGELGKVVAERRPAVGVHNLAWRGASHLSILWLRLPLASDGEDVDMILGLDAVVGMSQMPTGIRAA

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221640 Caulobacter sp. Root342 Isolate Unclassified
5 2643221642 Caulobacter sp. Root343 Isolate Unclassified
6 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
7 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
8 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
9 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
10 2849560528 Caulobacter zeae 410 Isolate Unclassified
11 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
12 2851153111 Caulobacter radicis 736 Isolate Unclassified
13 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
183 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
184 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
185 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
188 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
189 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
190 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
194 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
201 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
202 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.33
Nodule 0
Rhizoplane 2.03
Rhizosphere 77.68
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10045327 3300003215 Bacteria 1313
2 rootH1_10074625 3300003316 Bacteria 3360
3 Ga0055524_1085030 3300003775 Bacteria 564
4 Ga0055536_1011129 3300003781 Bacteria 3492
5 Ga0055531_10006977 3300003794 Bacteria 6277
6 Ga0065165_1000030 3300005262 Bacteria 218104
7 Ga0065165_1023525 3300005262 Bacteria 2087
8 Ga0070658_10120523 3300005327 Bacteria 2180
9 Ga0070670_100000035 3300005331 Bacteria 157570
10 Ga0070666_10183788 3300005335 Bacteria 1467
11 Ga0070680_100037387 3300005336 Bacteria 3922
12 Ga0070680_100061541 3300005336 Bacteria 3073
13 Ga0070660_100380180 3300005339 Bacteria 1166
14 Ga0070691_10029670 3300005341 Bacteria 2559
15 Ga0070668_100003559 3300005347 Bacteria 11485
16 Ga0070668_100012069 3300005347 Bacteria 6436
17 Ga0070668_100742642 3300005347 Bacteria 868
18 Ga0070671_100113661 3300005355 Bacteria 2275
19 Ga0070667_100001239 3300005367 Bacteria 23159
20 Ga0070667_100021097 3300005367 Bacteria 5412
21 Ga0070667_100377640 3300005367 Bacteria 1287
22 Ga0070667_100973153 3300005367 Bacteria 791
23 Ga0070713_101428337 3300005436 Unclassified 671
24 Ga0070662_100786984 3300005457 Unclassified 808
25 Ga0070681_10298384 3300005458 Bacteria 1521
26 Ga0070681_10390480 3300005458 Bacteria 1302
27 Ga0070679_100449313 3300005530 Bacteria 1234
28 Ga0070679_100803874 3300005530 Bacteria 884
29 Ga0068853_100854236 3300005539 Bacteria 873
30 Ga0068853_100925190 3300005539 Bacteria 838
31 Ga0070686_100817100 3300005544 Bacteria 752
32 Ga0070665_100000371 3300005548 Bacteria 66831
33 Ga0070665_100001415 3300005548 Bacteria 28191
34 Ga0068855_100120732 3300005563 Bacteria 3000
35 Ga0068855_100176262 3300005563 Bacteria 2419
36 Ga0068855_100903512 3300005563 Bacteria 933
37 Ga0068855_101222555 3300005563 Bacteria 780
38 Ga0068857_100713584 3300005577 Bacteria 953
39 Ga0068856_100063789 3300005614 Bacteria 3639
40 Ga0068856_100072253 3300005614 Bacteria 3416
41 Ga0068856_100152321 3300005614 Bacteria 2322
42 Ga0068856_100521555 3300005614 Bacteria 1209
43 Ga0068852_102341705 3300005616 Bacteria 555
44 Ga0068859_100555782 3300005617 Bacteria 1242
45 Ga0068864_100000102 3300005618 Bacteria 82743
46 Ga0068864_100308959 3300005618 Bacteria 1482
47 Ga0068864_100382764 3300005618 Bacteria 1334
48 Ga0068851_10520920 3300005834 Bacteria 715
49 Ga0068863_100001929 3300005841 Bacteria 20592
50 Ga0068863_101977741 3300005841 Bacteria 593
51 Ga0068858_100003453 3300005842 Bacteria 15687
52 Ga0068858_100303729 3300005842 Bacteria 1523
53 Ga0068860_100000157 3300005843 Bacteria 110717
54 Ga0068862_100000782 3300005844 Bacteria 31544
55 Ga0068862_100028858 3300005844 Bacteria 4674
56 Ga0068862_100144563 3300005844 Bacteria 2113
57 Ga0070717_10076190 3300006028 Bacteria 2807
58 Ga0075366_10105060 3300006195 Bacteria 1697
59 Ga0097621_100642845 3300006237 Bacteria 973
60 Ga0068871_100351598 3300006358 Bacteria 1304
61 Ga0068865_100570060 3300006881 Bacteria 953
62 Ga0097620_100555795 3300006931 Bacteria 1242
63 Ga0105240_10004784 3300009093 Bacteria 20425
64 Ga0105240_10005900 3300009093 Bacteria 18141
65 Ga0105240_10060513 3300009093 Bacteria 4721
66 Ga0105240_10074679 3300009093 Bacteria 4183
67 Ga0105240_10076902 3300009093 Bacteria 4113
68 Ga0105240_10829961 3300009093 Bacteria 999
69 Ga0105240_11061721 3300009093 Bacteria 863
70 Ga0105240_11463296 3300009093 Bacteria 717
71 Ga0105248_10001408 3300009177 Bacteria 26859
72 Ga0105248_10704970 3300009177 Bacteria 1139
73 Ga0105248_11104080 3300009177 Bacteria 897
74 Ga0105237_10129847 3300009545 Bacteria 2514
75 Ga0105237_10759688 3300009545 Bacteria 976
76 Ga0105238_10177056 3300009551 Bacteria 2109
77 Ga0105238_10447490 3300009551 Bacteria 1288
78 Ga0105238_10569640 3300009551 Bacteria 1138
79 Ga0105238_10682862 3300009551 Bacteria 1038
80 Ga0105238_11474271 3300009551 Bacteria 709
81 Ga0105249_10000472 3300009553 Bacteria 37443
82 Ga0105249_10093621 3300009553 Bacteria 2815
83 Ga0105239_11267470 3300010375 Bacteria 850
84 Ga0105239_11359175 3300010375 Bacteria 820
85 Ga0157370_10115203 3300013104 Bacteria 2511
86 Ga0157370_10233196 3300013104 Bacteria 1703
87 Ga0157369_11160752 3300013105 Bacteria 789
88 Ga0157374_10264098 3300013296 Bacteria 1696
89 Ga0157374_11682896 3300013296 Bacteria 659
90 Ga0163162_10287440 3300013306 Bacteria 1776
91 Ga0157372_10237379 3300013307 Bacteria 2115
92 Ga0163163_10004960 3300014325 Bacteria 11454
93 Ga0163163_10219927 3300014325 Bacteria 1948
94 Ga0157379_10005496 3300014968 Bacteria 10882
95 Ga0163161_10418178 3300017792 Bacteria 1078
96 Ga0213876_10000100 3300021384 Bacteria 96803
97 Ga0209026_1001794 3300025250 Bacteria 8878
98 Ga0209026_1004780 3300025250 Bacteria 3879
99 Ga0209148_1017332 3300025254 Bacteria 1224
100 Ga0209564_1023379 3300025295 Bacteria 2150
101 Ga0209758_1000424 3300025297 Bacteria 71558
102 Ga0209050_1000169 3300025298 Bacteria 151269
103 Ga0209256_1005336 3300025299 Bacteria 7468
104 Ga0209256_1015577 3300025299 Bacteria 2647
105 Ga0209257_1000954 3300025304 Bacteria 39793
106 Ga0207680_10066367 3300025903 Bacteria 2219
107 Ga0207680_10278436 3300025903 Bacteria 1162
108 Ga0207705_10245536 3300025909 Bacteria 1364
109 Ga0207707_10233530 3300025912 Bacteria 1600
110 Ga0207707_10659451 3300025912 Bacteria 881
111 Ga0207695_10001947 3300025913 Bacteria 32053
112 Ga0207695_10003117 3300025913 Bacteria 23717
113 Ga0207695_10054557 3300025913 Bacteria 4172
114 Ga0207695_10115566 3300025913 Bacteria 2658
115 Ga0207695_10164508 3300025913 Bacteria 2147
116 Ga0207695_11290924 3300025913 Bacteria 610
117 Ga0207671_10057672 3300025914 Bacteria 2878
118 Ga0207660_10093918 3300025917 Bacteria 2229
119 Ga0207657_10562154 3300025919 Bacteria 891
120 Ga0207652_10069335 3300025921 Bacteria 3061
121 Ga0207652_10666627 3300025921 Bacteria 930
122 Ga0207694_10040977 3300025924 Bacteria 3568
123 Ga0207694_10097171 3300025924 Bacteria 2330
124 Ga0207694_10288060 3300025924 Bacteria 1350
125 Ga0207694_10553660 3300025924 Bacteria 965
126 Ga0207650_10000286 3300025925 Bacteria 51390
127 Ga0207687_10151233 3300025927 Bacteria 1771
128 Ga0207644_10004040 3300025931 Bacteria 9519
129 Ga0207644_10290623 3300025931 Bacteria 1314
130 Ga0207686_10235036 3300025934 Bacteria 1331
131 Ga0207711_10001120 3300025941 Bacteria 25635
132 Ga0207711_10001984 3300025941 Bacteria 18535
133 Ga0207711_10137941 3300025941 Bacteria 2192
134 Ga0207667_10119296 3300025949 Bacteria 2718
135 Ga0207667_10186311 3300025949 Bacteria 2130
136 Ga0207667_10208531 3300025949 Bacteria 2003
137 Ga0207667_10711939 3300025949 Bacteria 1006
138 Ga0207667_10984731 3300025949 Bacteria 831
139 Ga0207712_10000287 3300025961 Bacteria 48043
140 Ga0207712_10046242 3300025961 Bacteria 3017
141 Ga0207712_10124127 3300025961 Bacteria 1958
142 Ga0207668_10000196 3300025972 Bacteria 41526
143 Ga0207668_10000892 3300025972 Bacteria 18008
144 Ga0207668_10903028 3300025972 Bacteria 786
145 Ga0207640_11506136 3300025981 Bacteria 604
146 Ga0207658_10000144 3300025986 Bacteria 74430
147 Ga0207658_10055746 3300025986 Bacteria 2930
148 Ga0207658_10077639 3300025986 Bacteria 2534
149 Ga0207658_10941541 3300025986 Bacteria 787
150 Ga0207703_10001522 3300026035 Bacteria 21061
151 Ga0207703_10020558 3300026035 Bacteria 5163
152 Ga0207703_11120625 3300026035 Unclassified 756
153 Ga0207639_11198265 3300026041 Bacteria 713
154 Ga0207702_10076628 3300026078 Bacteria 2891
155 Ga0207702_10588640 3300026078 Bacteria 1091
156 Ga0207702_11280545 3300026078 Bacteria 727
157 Ga0207641_10000389 3300026088 Bacteria 51956
158 Ga0207641_10004504 3300026088 Bacteria 12048
159 Ga0207676_10000066 3300026095 Bacteria 105425
160 Ga0207676_10420396 3300026095 Bacteria 1253
161 Ga0209981_1001889 3300027378 Bacteria 2671
162 Ga0210000_1006735 3300027462 Bacteria 1675
163 Ga0209999_1000252 3300027543 Bacteria 7761
164 Ga0209983_1060968 3300027665 Bacteria 834
165 Ga0268266_10000426 3300028379 Bacteria 63596
166 Ga0268266_10010725 3300028379 Bacteria 7984
167 Ga0268266_10023810 3300028379 Bacteria 5212
168 Ga0268266_10085675 3300028379 Bacteria 2753
169 Ga0268265_10139109 3300028380 Bacteria 2030
170 Ga0268265_10254943 3300028380 Bacteria 1556
171 Ga0268264_10000211 3300028381 Bacteria 117108
172 Ga0268264_10034362 3300028381 Bacteria 4170
173 Ga0268264_12182892 3300028381 Bacteria 562
174 Ga0265326_10047341 3300028558 Bacteria 1219
175 Ga0265319_1030917 3300028563 Bacteria 1868
176 Ga0265318_10018399 3300028577 Bacteria 2852
177 Ga0307517_10128872 3300028786 Bacteria 1831
178 Ga0307517_10253144 3300028786 Bacteria 1031
179 Ga0307515_10078448 3300028794 Bacteria 4342
180 Ga0265338_10030277 3300028800 Bacteria 5337
181 Ga0265338_10031439 3300028800 Bacteria 5206
182 Ga0265338_10047323 3300028800 Bacteria 3929
183 Ga0265338_10077951 3300028800 Bacteria 2797
184 Ga0265338_10272921 3300028800 Bacteria 1239
185 Ga0265338_10287427 3300028800 Bacteria 1199
186 Ga0265324_10063101 3300029957 Bacteria 1265
187 Ga0265340_10251005 3300031247 Bacteria 788
188 Ga0265327_10000564 3300031251 Bacteria 63187
189 Ga0265327_10002569 3300031251 Bacteria 18794
190 Ga0265316_10269632 3300031344 Bacteria 1246
191 Ga0307513_10000348 3300031456 Bacteria 67217
192 Ga0307513_10009597 3300031456 Bacteria 12225
193 Ga0265314_10076507 3300031711 Bacteria 2223
194 Ga0265314_10124789 3300031711 Bacteria 1614
195 Ga0265342_10256902 3300031712 Bacteria 931
196 Ga0307405_10289308 3300031731 Bacteria 1238
197 Ga0307405_10997140 3300031731 Bacteria 714
198 Ga0307413_10565402 3300031824 Bacteria 925
199 Ga0307410_10101803 3300031852 Bacteria 2060
200 Ga0307409_100102319 3300031995 Bacteria 2380
201 Ga0307414_10264863 3300032004 Bacteria 1436
202 Ga0307414_10710898 3300032004 Bacteria 910
203 Ga0307411_10506861 3300032005 Bacteria 1021
204 Ga0373944_0024830 3300035089 Bacteria 1760
205 Ga0373936_0006147 3300035113 Bacteria 4524
206 Ga0373943_0145332 3300035170 Bacteria 1281
207 Ga0373946_0118065 3300035171 Bacteria 1208
208 Ga0373927_0007174 3300035695 Bacteria 7562
209 Ga0373933_0932504 3300035724 Bacteria 572
210 Ga0373947_0579430 3300035725 Bacteria 764
211 Ga0373925_0000901 3300037068 Bacteria 27149
212 Ga0373925_0045151 3300037068 Bacteria 3273
213 Ga0395899_0000356 3300037312 Bacteria 56002
214 Ga0395899_0083031 3300037312 Bacteria 2330
215 Ga0395899_0162665 3300037312 Bacteria 1576
216 Ga0395899_0494791 3300037312 Bacteria 794
217 Ga0395900_0000016 3300037418 Bacteria 382407
218 Ga0395900_0090995 3300037418 Bacteria 3135
219 Ga0395900_0192259 3300037418 Bacteria 2069
220 Ga0395898_0007018 3300037466 Bacteria 11967
221 Ga0395898_0054431 3300037466 Bacteria 3905
222 Ga0395898_0732562 3300037466 Bacteria 930
223 Ga0395898_1585963 3300037466 Bacteria 579
224 Ga0395905_0008339 3300037471 Bacteria 10221
225 Ga0395905_0082173 3300037471 Bacteria 3019
226 Ga0395905_0106748 3300037471 Bacteria 2629
227 Ga0395905_0346030 3300037471 Bacteria 1378
228 Ga0395905_0621031 3300037471 Bacteria 983
229 Ga0395905_0664218 3300037471 Bacteria 944
230 Ga0395905_1074016 3300037471 Bacteria 708
231 Ga0395901_0000022 3300038443 Bacteria 296356
232 Ga0395901_0104919 3300038443 Bacteria 2966
233 Ga0395901_0191742 3300038443 Bacteria 2143
234 Ga0395901_1339385 3300038443 Bacteria 676
235 Ga0395901_1858050 3300038443 Bacteria 551
236 Ga0436365_1220486 3300039437 Bacteria 40834
237 Ga0436365_1649491 3300039437 Bacteria 1947
238 Ga0436363_0391842 3300039450 Bacteria 1829
239 Ga0436363_1209416 3300039450 Bacteria 922
240 Ga0466972_0194225 3300044658 Bacteria 951
241 Ga0466966_0409211 3300044684 Unclassified 815
242 Ga0466961_0040901 3300044693 Bacteria 2972
243 Ga0466964_0106597 3300044706 Bacteria 1244
244 Ga0466970_0079186 3300044765 Bacteria 1774
245 Ga0495590_0008945 3300046457 Bacteria 3805
246 Ga0495638_0011370 3300046460 Bacteria 6134
247 Ga0495651_0525995 3300046462 Bacteria 754
248 Ga0495639_0360074 3300046475 Unclassified 731
249 Ga0495583_0073806 3300046506 Bacteria 1495
250 Ga0495583_0110331 3300046506 Bacteria 1166
251 Ga0495606_0360048 3300046507 Unclassified 769
252 Ga0495610_0052950 3300046512 Bacteria 1968
253 Ga0495610_0052982 3300046512 Bacteria 1967
254 Ga0495648_0000176 3300046524 Bacteria 73832
255 Ga0495652_0516707 3300046529 Bacteria 826
256 Ga0495587_0202709 3300046536 Bacteria 1122
257 Ga0495597_0032660 3300046542 Bacteria 2361
258 Ga0495668_0012264 3300046616 Bacteria 5087
259 Ga0495668_0022103 3300046616 Bacteria 3639
260 Ga0495668_0062637 3300046616 Bacteria 2049
261 Ga0495668_0079649 3300046616 Bacteria 1798
262 Ga0495668_0104659 3300046616 Bacteria 1548
263 Ga0495668_0169244 3300046616 Bacteria 1197
264 Ga0495625_0233357 3300046660 Bacteria 1201
265 Ga0495625_0281340 3300046660 Bacteria 1070
266 Ga0495625_0389737 3300046660 Bacteria 872
267 Ga0495588_0224494 3300046674 Bacteria 991
268 Ga0495669_0000008 3300046684 Bacteria 177295
269 Ga0495669_0000145 3300046684 Bacteria 45088
270 Ga0495669_0038439 3300046684 Bacteria 2119
271 Ga0495613_0000188 3300046689 Bacteria 60791
272 Ga0495636_0218252 3300047318 Bacteria 875
273 Ga0495677_0028119 3300047445 Bacteria 2041
274 Ga0495677_0062693 3300047445 Bacteria 1380
275 Ga0495673_0001487 3300047469 Bacteria 18540
276 Ga0495686_0004249 3300047472 Bacteria 11876
277 Ga0496100_0309388 3300048903 Bacteria 1184
278 Ga0496103_0271850 3300048906 Bacteria 1090
279 Ga0496107_0282427 3300048910 Bacteria 1235
280 Ga0496115_0002632 3300048918 Bacteria 12892
281 Ga0496115_0071784 3300048918 Bacteria 2808
282 Ga0496115_0156932 3300048918 Bacteria 1880
283 Ga0496115_0568837 3300048918 Bacteria 904
284 Ga0496125_0068965 3300048928 Bacteria 2777
285 Ga0496126_0016053 3300048929 Bacteria 7509
286 Ga0501032_0579154 3300049569 Bacteria 715
287 Ga0501033_0059548 3300049570 Bacteria 2820
288 Ga0501037_0094492 3300049573 Bacteria 2162
289 Ga0501038_0968278 3300049574 Bacteria 626
290 Ga0501043_0556775 3300049579 Bacteria 851
291 Ga0501047_0004936 3300049581 Bacteria 12526
292 Ga0501047_0185910 3300049581 Bacteria 1943
293 Ga0501047_0277057 3300049581 Bacteria 1523
294 Ga0501047_0349529 3300049581 Bacteria 1315
295 Ga0501047_0623760 3300049581 Bacteria 899
296 Ga0501035_0295648 3300049822 Bacteria 1366
297 Ga0501044_0001035 3300049823 Bacteria 33494
298 Ga0501044_0238139 3300049823 Bacteria 1765
299 Ga0501044_0727307 3300049823 Bacteria 876
300 Ga0501044_0857093 3300049823 Bacteria 785
301 nmdc:mga0k408_33350_c1 3300050493 Bacteria 2945
302 Ga0500578_0000636 3300053086 Bacteria 42530
303 Ga0500643_001627 3300053087 Bacteria 12551
304 Ga0500643_012742 3300053087 Bacteria 2999
305 Ga0500644_0000010 3300053088 Bacteria 127225
306 Ga0500644_0019787 3300053088 Bacteria 1992
307 Ga0500646_0047150 3300053090 Bacteria 1232
308 Ga0500647_0015654 3300053091 Bacteria 3471
309 Ga0500566_0346783 3300053094 Unclassified 682
310 Ga0500641_0017278 3300053096 Bacteria 2696
311 Ga0500641_0020894 3300053096 Bacteria 2488
312 Ga0500555_000435 3300053103 Bacteria 17297
313 Ga0500556_0020636 3300053104 Bacteria 2111
314 Ga0500562_003447 3300053108 Bacteria 3961
315 Ga0500562_091795 3300053108 Bacteria 824
316 Ga0500572_001209 3300053111 Bacteria 7353
317 Ga0500594_0000167 3300053118 Bacteria 17218
318 Ga0500595_007296 3300053119 Bacteria 4590
319 Ga0500597_053255 3300053120 Bacteria 1728
320 Ga0500608_000248 3300053122 Bacteria 21224
321 Ga0500642_0182315 3300053130 Bacteria 981
322 Ga0500559_0000001 3300053136 Bacteria 325464
323 Ga0500559_0004438 3300053136 Bacteria 6665
324 Ga0500559_0176262 3300053136 Bacteria 1006
325 Ga0500564_006955 3300053138 Bacteria 4765
326 Ga0500616_0314104 3300053153 Unclassified 647
327 Ga0500622_0005922 3300053156 Bacteria 7205
328 Ga0500622_0046764 3300053156 Bacteria 2236
329 Ga0500622_0118206 3300053156 Bacteria 1288
330 Ga0500627_0215119 3300053158 Bacteria 859
331 Ga0500636_0064352 3300053177 Bacteria 2136
332 Ga0500576_168863 3300053725 Bacteria 790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0156932 Ga0496115_0156932_914_1351 143
2 3300038443 Ga0395901_1858050 Ga0395901_1858050_76_513 144
3 3300005335 Ga0070666_10183788 Ga0070666_101837881 149
4 3300009551 Ga0105238_11474271 Ga0105238_114742711 149
5 3300025924 Ga0207694_10288060 Ga0207694_102880602 149
6 3300025924 Ga0207694_10553660 Ga0207694_105536602 149
7 3300053725 Ga0500576_168863 Ga0500576_168863_168_623 149
8 3300049822 Ga0501035_0295648 Ga0501035_0295648_18_476 150
9 3300025931 Ga0207644_10004040 Ga0207644_100040407 156
10 3300025941 Ga0207711_10001984 Ga0207711_1000198411 156
11 3300025961 Ga0207712_10124127 Ga0207712_101241274 156
12 3300025986 Ga0207658_10055746 Ga0207658_100557463 156
13 3300026035 Ga0207703_10020558 Ga0207703_100205584 156
14 3300026088 Ga0207641_10004504 Ga0207641_100045043 156
15 3300028381 Ga0268264_10034362 Ga0268264_100343624 156
16 3300039450 Ga0436363_1209416 Ga0436363_1209416_49_534 156
17 3300044684 Ga0466966_0409211 Ga0466966_0409211_253_771 156
18 iso_pu_bacteria 2585428106 2587918556 156
19 iso_pu_bacteria 2643221614 2644086552 156
20 iso_pu_bacteria 2643221640 2644224879 156
21 iso_pu_bacteria 2643221642 2644234187 156
22 iso_pu_bacteria 2643221661 2644341506 156
23 iso_pu_bacteria 2643221666 2644367793 156
24 3300005614 Ga0068856_100521555 Ga0068856_1005215552 157
25 3300026078 Ga0207702_10588640 Ga0207702_105886403 157
26 3300028558 Ga0265326_10047341 Ga0265326_100473412 157
27 3300028577 Ga0265318_10018399 Ga0265318_100183993 157
28 3300028800 Ga0265338_10030277 Ga0265338_100302774 157
29 3300028800 Ga0265338_10077951 Ga0265338_100779515 157
30 3300028800 Ga0265338_10272921 Ga0265338_102729211 157
31 3300031711 Ga0265314_10076507 Ga0265314_100765072 157
32 3300049581 Ga0501047_0004936 Ga0501047_0004936_2878_3396 157
33 3300053091 Ga0500647_0015654 Ga0500647_0015654_1954_2433 157
34 3300053111 Ga0500572_001209 Ga0500572_001209_4893_5372 157
35 3300053120 Ga0500597_053255 Ga0500597_053255_820_1299 157
36 3300053136 Ga0500559_0000001 Ga0500559_0000001_170823_171302 157
37 3300053177 Ga0500636_0064352 Ga0500636_0064352_47_526 157
38 iso_pu_bacteria 2582581279 2585146285 157
39 iso_pu_bacteria 2791355048 2792463050 157
40 iso_pu_bacteria 2843744320 2843746897 157
41 iso_pu_bacteria 2849560528 2849563183 157
42 iso_pu_bacteria 2849573788 2849576600 157
43 iso_pu_bacteria 2851153111 2851154176 157
44 iso_pu_bacteria 2898329390 2898333204 157
45 3300005347 Ga0070668_100742642 Ga0070668_1007426422 158
46 3300005436 Ga0070713_101428337 Ga0070713_1014283371 158
47 3300005616 Ga0068852_102341705 Ga0068852_1023417051 158
48 3300005834 Ga0068851_10520920 Ga0068851_105209201 158
49 3300006237 Ga0097621_100642845 Ga0097621_1006428452 158
50 3300006358 Ga0068871_100351598 Ga0068871_1003515982 158
51 3300013296 Ga0157374_10264098 Ga0157374_102640983 158
52 3300013296 Ga0157374_11682896 Ga0157374_116828961 158
53 3300025934 Ga0207686_10235036 Ga0207686_102350362 158
54 3300025972 Ga0207668_10903028 Ga0207668_109030281 158
55 3300029957 Ga0265324_10063101 Ga0265324_100631013 158
56 3300031251 Ga0265327_10002569 Ga0265327_100025694 158
57 3300031344 Ga0265316_10269632 Ga0265316_102696322 158
58 3300031711 Ga0265314_10124789 Ga0265314_101247891 158
59 3300035724 Ga0373933_0932504 Ga0373933_0932504_19_501 158
60 3300037312 Ga0395899_0083031 Ga0395899_0083031_884_1366 158
61 3300037312 Ga0395899_0494791 Ga0395899_0494791_229_711 158
62 3300037418 Ga0395900_0192259 Ga0395900_0192259_1103_1585 158
63 3300037466 Ga0395898_0054431 Ga0395898_0054431_1280_1762 158
64 3300037471 Ga0395905_0664218 Ga0395905_0664218_342_824 158
65 3300038443 Ga0395901_0104919 Ga0395901_0104919_1555_2037 158
66 3300038443 Ga0395901_0191742 Ga0395901_0191742_646_1128 158
67 3300046462 Ga0495651_0525995 Ga0495651_0525995_76_558 158
68 3300046529 Ga0495652_0516707 Ga0495652_0516707_216_698 158
69 3300046536 Ga0495587_0202709 Ga0495587_0202709_581_1063 158
70 3300046689 Ga0495613_0000188 Ga0495613_0000188_5241_5723 158
71 3300048918 Ga0496115_0071784 Ga0496115_0071784_1869_2351 158
72 3300048918 Ga0496115_0568837 Ga0496115_0568837_70_552 158
73 3300049579 Ga0501043_0556775 Ga0501043_0556775_164_646 158
74 3300049581 Ga0501047_0349529 Ga0501047_0349529_653_1135 158
75 3300049823 Ga0501044_0238139 Ga0501044_0238139_1044_1526 158
76 3300005331 Ga0070670_100000035 Ga0070670_10000003564 159
77 3300005347 Ga0070668_100003559 Ga0070668_1000035595 159
78 3300005367 Ga0070667_100001239 Ga0070667_1000012394 159
79 3300005367 Ga0070667_100377640 Ga0070667_1003776402 159
80 3300005548 Ga0070665_100001415 Ga0070665_1000014155 159
81 3300005618 Ga0068864_100000102 Ga0068864_10000010210 159
82 3300005841 Ga0068863_100001929 Ga0068863_10000192919 159
83 3300005842 Ga0068858_100003453 Ga0068858_1000034532 159
84 3300005843 Ga0068860_100000157 Ga0068860_10000015750 159
85 3300005844 Ga0068862_100000782 Ga0068862_10000078226 159
86 3300009553 Ga0105249_10000472 Ga0105249_1000047232 159
87 3300014325 Ga0163163_10004960 Ga0163163_1000496010 159
88 3300014968 Ga0157379_10005496 Ga0157379_100054967 159
89 3300017792 Ga0163161_10418178 Ga0163161_104181782 159
90 3300025925 Ga0207650_10000286 Ga0207650_1000028646 159
91 3300025961 Ga0207712_10000287 Ga0207712_1000028732 159
92 3300025972 Ga0207668_10000892 Ga0207668_1000089214 159
93 3300025986 Ga0207658_10000144 Ga0207658_1000014445 159
94 3300026035 Ga0207703_10001522 Ga0207703_100015227 159
95 3300026088 Ga0207641_10000389 Ga0207641_1000038932 159
96 3300026095 Ga0207676_10000066 Ga0207676_1000006637 159
97 3300028379 Ga0268266_10010725 Ga0268266_100107253 159
98 3300028381 Ga0268264_10000211 Ga0268264_10000211103 159
99 3300028563 Ga0265319_1030917 Ga0265319_10309172 159
100 3300031456 Ga0307513_10000348 Ga0307513_1000034836 159
101 3300048906 Ga0496103_0271850 Ga0496103_0271850_236_760 159
102 3300053090 Ga0500646_0047150 Ga0500646_0047150_199_681 159
103 3300053103 Ga0500555_000435 Ga0500555_000435_8997_9479 159
104 3300053119 Ga0500595_007296 Ga0500595_007296_538_1023 159
105 3300053136 Ga0500559_0176262 Ga0500559_0176262_122_607 159
106 3300003316 rootH1_10074625 rootH1_100746253 160
107 3300003781 Ga0055536_1011129 Ga0055536_10111295 160
108 3300005327 Ga0070658_10120523 Ga0070658_101205232 160
109 3300005336 Ga0070680_100037387 Ga0070680_1000373872 160
110 3300005336 Ga0070680_100061541 Ga0070680_1000615412 160
111 3300005339 Ga0070660_100380180 Ga0070660_1003801802 160
112 3300005341 Ga0070691_10029670 Ga0070691_100296702 160
113 3300005347 Ga0070668_100012069 Ga0070668_1000120695 160
114 3300005367 Ga0070667_100021097 Ga0070667_1000210974 160
115 3300005367 Ga0070667_100973153 Ga0070667_1009731532 160
116 3300005457 Ga0070662_100786984 Ga0070662_1007869842 160
117 3300005458 Ga0070681_10298384 Ga0070681_102983841 160
118 3300005458 Ga0070681_10390480 Ga0070681_103904802 160
119 3300005530 Ga0070679_100449313 Ga0070679_1004493132 160
120 3300005530 Ga0070679_100803874 Ga0070679_1008038741 160
121 3300005539 Ga0068853_100854236 Ga0068853_1008542361 160
122 3300005539 Ga0068853_100925190 Ga0068853_1009251901 160
123 3300005544 Ga0070686_100817100 Ga0070686_1008171002 160
124 3300005548 Ga0070665_100000371 Ga0070665_10000037122 160
125 3300005563 Ga0068855_100120732 Ga0068855_1001207324 160
126 3300005563 Ga0068855_100176262 Ga0068855_1001762623 160
127 3300005563 Ga0068855_100903512 Ga0068855_1009035121 160
128 3300005563 Ga0068855_101222555 Ga0068855_1012225551 160
129 3300005577 Ga0068857_100713584 Ga0068857_1007135842 160
130 3300005614 Ga0068856_100063789 Ga0068856_1000637893 160
131 3300005614 Ga0068856_100152321 Ga0068856_1001523212 160
132 3300005617 Ga0068859_100555782 Ga0068859_1005557822 160
133 3300005618 Ga0068864_100308959 Ga0068864_1003089593 160
134 3300005841 Ga0068863_101977741 Ga0068863_1019777411 160
135 3300005842 Ga0068858_100303729 Ga0068858_1003037292 160
136 3300005844 Ga0068862_100028858 Ga0068862_1000288582 160
137 3300005844 Ga0068862_100144563 Ga0068862_1001445633 160
138 3300006028 Ga0070717_10076190 Ga0070717_100761901 160
139 3300006195 Ga0075366_10105060 Ga0075366_101050602 160
140 3300006881 Ga0068865_100570060 Ga0068865_1005700602 160
141 3300006931 Ga0097620_100555795 Ga0097620_1005557952 160
142 3300009093 Ga0105240_10004784 Ga0105240_100047846 160
143 3300009093 Ga0105240_10005900 Ga0105240_100059005 160
144 3300009093 Ga0105240_10060513 Ga0105240_100605136 160
145 3300009093 Ga0105240_10074679 Ga0105240_100746792 160
146 3300009093 Ga0105240_10076902 Ga0105240_100769024 160
147 3300009093 Ga0105240_10829961 Ga0105240_108299612 160
148 3300009093 Ga0105240_11061721 Ga0105240_110617211 160
149 3300009093 Ga0105240_11463296 Ga0105240_114632962 160
150 3300009177 Ga0105248_10001408 Ga0105248_1000140811 160
151 3300009177 Ga0105248_11104080 Ga0105248_111040802 160
152 3300009545 Ga0105237_10129847 Ga0105237_101298473 160
153 3300009545 Ga0105237_10759688 Ga0105237_107596881 160
154 3300009551 Ga0105238_10177056 Ga0105238_101770561 160
155 3300009551 Ga0105238_10447490 Ga0105238_104474902 160
156 3300009551 Ga0105238_10569640 Ga0105238_105696402 160
157 3300009551 Ga0105238_10682862 Ga0105238_106828621 160
158 3300009553 Ga0105249_10093621 Ga0105249_100936215 160
159 3300010375 Ga0105239_11267470 Ga0105239_112674701 160
160 3300010375 Ga0105239_11359175 Ga0105239_113591752 160
161 3300013104 Ga0157370_10115203 Ga0157370_101152033 160
162 3300013104 Ga0157370_10233196 Ga0157370_102331962 160
163 3300013105 Ga0157369_11160752 Ga0157369_111607521 160
164 3300013306 Ga0163162_10287440 Ga0163162_102874401 160
165 3300013307 Ga0157372_10237379 Ga0157372_102373793 160
166 3300021384 Ga0213876_10000100 Ga0213876_1000010041 160
167 3300025250 Ga0209026_1004780 Ga0209026_10047803 160
168 3300025254 Ga0209148_1017332 Ga0209148_10173322 160
169 3300025295 Ga0209564_1023379 Ga0209564_10233793 160
170 3300025299 Ga0209256_1015577 Ga0209256_10155775 160
171 3300025903 Ga0207680_10066367 Ga0207680_100663672 160
172 3300025903 Ga0207680_10278436 Ga0207680_102784361 160
173 3300025909 Ga0207705_10245536 Ga0207705_102455362 160
174 3300025912 Ga0207707_10233530 Ga0207707_102335302 160
175 3300025912 Ga0207707_10659451 Ga0207707_106594512 160
176 3300025913 Ga0207695_10001947 Ga0207695_1000194728 160
177 3300025913 Ga0207695_10003117 Ga0207695_1000311712 160
178 3300025913 Ga0207695_10054557 Ga0207695_100545573 160
179 3300025913 Ga0207695_10115566 Ga0207695_101155664 160
180 3300025913 Ga0207695_10164508 Ga0207695_101645082 160
181 3300025913 Ga0207695_11290924 Ga0207695_112909242 160
182 3300025914 Ga0207671_10057672 Ga0207671_100576724 160
183 3300025917 Ga0207660_10093918 Ga0207660_100939183 160
184 3300025919 Ga0207657_10562154 Ga0207657_105621542 160
185 3300025921 Ga0207652_10069335 Ga0207652_100693354 160
186 3300025921 Ga0207652_10666627 Ga0207652_106666272 160
187 3300025924 Ga0207694_10040977 Ga0207694_100409775 160
188 3300025924 Ga0207694_10097171 Ga0207694_100971712 160
189 3300025927 Ga0207687_10151233 Ga0207687_101512332 160
190 3300025941 Ga0207711_10001120 Ga0207711_1000112025 160
191 3300025949 Ga0207667_10119296 Ga0207667_101192963 160
192 3300025949 Ga0207667_10186311 Ga0207667_101863112 160
193 3300025949 Ga0207667_10208531 Ga0207667_102085312 160
194 3300025949 Ga0207667_10711939 Ga0207667_107119391 160
195 3300025949 Ga0207667_10984731 Ga0207667_109847311 160
196 3300025961 Ga0207712_10046242 Ga0207712_100462425 160
197 3300025972 Ga0207668_10000196 Ga0207668_1000019641 160
198 3300025981 Ga0207640_11506136 Ga0207640_115061361 160
199 3300025986 Ga0207658_10077639 Ga0207658_100776393 160
200 3300025986 Ga0207658_10941541 Ga0207658_109415412 160
201 3300026035 Ga0207703_11120625 Ga0207703_111206252 160
202 3300026041 Ga0207639_11198265 Ga0207639_111982651 160
203 3300026078 Ga0207702_10076628 Ga0207702_100766282 160
204 3300026078 Ga0207702_11280545 Ga0207702_112805451 160
205 3300026095 Ga0207676_10420396 Ga0207676_104203961 160
206 3300027378 Ga0209981_1001889 Ga0209981_10018892 160
207 3300027462 Ga0210000_1006735 Ga0210000_10067352 160
208 3300027543 Ga0209999_1000252 Ga0209999_10002527 160
209 3300027665 Ga0209983_1060968 Ga0209983_10609681 160
210 3300028379 Ga0268266_10000426 Ga0268266_1000042686 160
211 3300028379 Ga0268266_10023810 Ga0268266_100238105 160
212 3300028380 Ga0268265_10139109 Ga0268265_101391093 160
213 3300028380 Ga0268265_10254943 Ga0268265_102549432 160
214 3300028381 Ga0268264_12182892 Ga0268264_121828921 160
215 3300028786 Ga0307517_10128872 Ga0307517_101288722 160
216 3300028800 Ga0265338_10031439 Ga0265338_100314393 160
217 3300031251 Ga0265327_10000564 Ga0265327_1000056432 160
218 3300035089 Ga0373944_0024830 Ga0373944_0024830_891_1376 160
219 3300035113 Ga0373936_0006147 Ga0373936_0006147_848_1345 160
220 3300035170 Ga0373943_0145332 Ga0373943_0145332_703_1188 160
221 3300035171 Ga0373946_0118065 Ga0373946_0118065_541_1026 160
222 3300035695 Ga0373927_0007174 Ga0373927_0007174_5504_5989 160
223 3300035725 Ga0373947_0579430 Ga0373947_0579430_13_498 160
224 3300037068 Ga0373925_0000901 Ga0373925_0000901_26051_26536 160
225 3300037068 Ga0373925_0045151 Ga0373925_0045151_644_1129 160
226 3300037312 Ga0395899_0162665 Ga0395899_0162665_952_1494 160
227 3300037418 Ga0395900_0090995 Ga0395900_0090995_2604_3089 160
228 3300037466 Ga0395898_0732562 Ga0395898_0732562_379_864 160
229 3300037471 Ga0395905_0082173 Ga0395905_0082173_1043_1528 160
230 3300037471 Ga0395905_0106748 Ga0395905_0106748_339_824 160
231 3300038443 Ga0395901_1339385 Ga0395901_1339385_161_646 160
232 3300039437 Ga0436365_1220486 Ga0436365_1220486_718_1206 160
233 3300039437 Ga0436365_1649491 Ga0436365_1649491_575_1060 160
234 3300044658 Ga0466972_0194225 Ga0466972_0194225_107_634 160
235 3300044693 Ga0466961_0040901 Ga0466961_0040901_401_928 160
236 3300044706 Ga0466964_0106597 Ga0466964_0106597_426_953 160
237 3300044765 Ga0466970_0079186 Ga0466970_0079186_1018_1545 160
238 3300046475 Ga0495639_0360074 Ga0495639_0360074_210_695 160
239 3300046542 Ga0495597_0032660 Ga0495597_0032660_273_761 160
240 3300046616 Ga0495668_0062637 Ga0495668_0062637_326_814 160
241 3300046616 Ga0495668_0079649 Ga0495668_0079649_391_876 160
242 3300046660 Ga0495625_0281340 Ga0495625_0281340_102_590 160
243 3300046674 Ga0495588_0224494 Ga0495588_0224494_117_605 160
244 3300046684 Ga0495669_0000008 Ga0495669_0000008_88989_89477 160
245 3300046684 Ga0495669_0000145 Ga0495669_0000145_10220_10708 160
246 3300047445 Ga0495677_0028119 Ga0495677_0028119_870_1358 160
247 3300047445 Ga0495677_0062693 Ga0495677_0062693_576_1061 160
248 3300048903 Ga0496100_0309388 Ga0496100_0309388_102_644 160
249 3300048910 Ga0496107_0282427 Ga0496107_0282427_502_990 160
250 3300048918 Ga0496115_0002632 Ga0496115_0002632_1963_2463 160
251 3300048928 Ga0496125_0068965 Ga0496125_0068965_826_1314 160
252 3300048929 Ga0496126_0016053 Ga0496126_0016053_5054_5542 160
253 3300049574 Ga0501038_0968278 Ga0501038_0968278_105_593 160
254 3300049581 Ga0501047_0277057 Ga0501047_0277057_74_559 160
255 3300049581 Ga0501047_0623760 Ga0501047_0623760_96_581 160
256 3300049823 Ga0501044_0727307 Ga0501044_0727307_244_732 160
257 3300049823 Ga0501044_0857093 Ga0501044_0857093_71_574 160
258 3300050493 nmdc:mga0k408_33350_c1 nmdc:mga0k408_33350_c1_986_1474 160
259 3300053087 Ga0500643_001627 Ga0500643_001627_2767_3258 160
260 3300053087 Ga0500643_012742 Ga0500643_012742_2471_2956 160
261 3300053094 Ga0500566_0346783 Ga0500566_0346783_65_550 160
262 3300053096 Ga0500641_0017278 Ga0500641_0017278_1606_2109 160
263 3300053096 Ga0500641_0020894 Ga0500641_0020894_430_957 160
264 3300053104 Ga0500556_0020636 Ga0500556_0020636_181_708 160
265 3300053108 Ga0500562_003447 Ga0500562_003447_1714_2199 160
266 3300053122 Ga0500608_000248 Ga0500608_000248_4825_5313 160
267 3300053130 Ga0500642_0182315 Ga0500642_0182315_313_840 160
268 3300053136 Ga0500559_0004438 Ga0500559_0004438_5009_5497 160
269 3300053156 Ga0500622_0046764 Ga0500622_0046764_1508_1996 160
270 3300053156 Ga0500622_0118206 Ga0500622_0118206_721_1209 160
271 3300003775 Ga0055524_1085030 Ga0055524_10850301 161
272 3300005262 Ga0065165_1023525 Ga0065165_10235253 161
273 3300005355 Ga0070671_100113661 Ga0070671_1001136612 161
274 3300005614 Ga0068856_100072253 Ga0068856_1000722534 161
275 3300005618 Ga0068864_100382764 Ga0068864_1003827642 161
276 3300009177 Ga0105248_10704970 Ga0105248_107049702 161
277 3300014325 Ga0163163_10219927 Ga0163163_102199273 161
278 3300025299 Ga0209256_1005336 Ga0209256_10053366 161
279 3300025931 Ga0207644_10290623 Ga0207644_102906232 161
280 3300025941 Ga0207711_10137941 Ga0207711_101379413 161
281 3300028379 Ga0268266_10085675 Ga0268266_100856754 161
282 3300028786 Ga0307517_10253144 Ga0307517_102531442 161
283 3300028794 Ga0307515_10078448 Ga0307515_100784484 161
284 3300028800 Ga0265338_10047323 Ga0265338_100473235 161
285 3300028800 Ga0265338_10287427 Ga0265338_102874271 161
286 3300031247 Ga0265340_10251005 Ga0265340_102510051 161
287 3300031456 Ga0307513_10009597 Ga0307513_100095977 161
288 3300031712 Ga0265342_10256902 Ga0265342_102569022 161
289 3300031731 Ga0307405_10289308 Ga0307405_102893082 161
290 3300031731 Ga0307405_10997140 Ga0307405_109971402 161
291 3300031824 Ga0307413_10565402 Ga0307413_105654022 161
292 3300031852 Ga0307410_10101803 Ga0307410_101018033 161
293 3300031995 Ga0307409_100102319 Ga0307409_1001023193 161
294 3300032004 Ga0307414_10264863 Ga0307414_102648632 161
295 3300032004 Ga0307414_10710898 Ga0307414_107108982 161
296 3300032005 Ga0307411_10506861 Ga0307411_105068612 161
297 3300037312 Ga0395899_0000356 Ga0395899_0000356_29703_30203 161
298 3300037418 Ga0395900_0000016 Ga0395900_0000016_228598_229098 161
299 3300037466 Ga0395898_0007018 Ga0395898_0007018_620_1120 161
300 3300037466 Ga0395898_1585963 Ga0395898_1585963_25_516 161
301 3300037471 Ga0395905_0008339 Ga0395905_0008339_882_1382 161
302 3300037471 Ga0395905_0346030 Ga0395905_0346030_308_796 161
303 3300037471 Ga0395905_0621031 Ga0395905_0621031_293_781 161
304 3300037471 Ga0395905_1074016 Ga0395905_1074016_159_647 161
305 3300038443 Ga0395901_0000022 Ga0395901_0000022_266679_267179 161
306 3300046457 Ga0495590_0008945 Ga0495590_0008945_3238_3729 161
307 3300046460 Ga0495638_0011370 Ga0495638_0011370_36_527 161
308 3300046506 Ga0495583_0073806 Ga0495583_0073806_353_859 161
309 3300046506 Ga0495583_0110331 Ga0495583_0110331_491_979 161
310 3300046507 Ga0495606_0360048 Ga0495606_0360048_171_659 161
311 3300046512 Ga0495610_0052950 Ga0495610_0052950_1367_1855 161
312 3300046512 Ga0495610_0052982 Ga0495610_0052982_216_707 161
313 3300046524 Ga0495648_0000176 Ga0495648_0000176_45529_46020 161
314 3300046616 Ga0495668_0012264 Ga0495668_0012264_1779_2270 161
315 3300046616 Ga0495668_0022103 Ga0495668_0022103_2520_3008 161
316 3300046616 Ga0495668_0104659 Ga0495668_0104659_925_1410 161
317 3300046616 Ga0495668_0169244 Ga0495668_0169244_344_994 161
318 3300046660 Ga0495625_0233357 Ga0495625_0233357_35_526 161
319 3300046660 Ga0495625_0389737 Ga0495625_0389737_113_619 161
320 3300046684 Ga0495669_0038439 Ga0495669_0038439_636_1124 161
321 3300047318 Ga0495636_0218252 Ga0495636_0218252_119_607 161
322 3300047469 Ga0495673_0001487 Ga0495673_0001487_3206_3697 161
323 3300047472 Ga0495686_0004249 Ga0495686_0004249_8254_8745 161
324 3300049569 Ga0501032_0579154 Ga0501032_0579154_129_617 161
325 3300049570 Ga0501033_0059548 Ga0501033_0059548_600_1088 161
326 3300049573 Ga0501037_0094492 Ga0501037_0094492_212_700 161
327 3300049581 Ga0501047_0185910 Ga0501047_0185910_1443_1931 161
328 3300049823 Ga0501044_0001035 Ga0501044_0001035_2999_3487 161
329 3300053086 Ga0500578_0000636 Ga0500578_0000636_15556_16047 161
330 3300053088 Ga0500644_0000010 Ga0500644_0000010_3250_3741 161
331 3300053088 Ga0500644_0019787 Ga0500644_0019787_24_515 161
332 3300053108 Ga0500562_091795 Ga0500562_091795_248_739 161
333 3300053118 Ga0500594_0000167 Ga0500594_0000167_12261_12752 161
334 3300053138 Ga0500564_006955 Ga0500564_006955_1109_1600 161
335 3300053153 Ga0500616_0314104 Ga0500616_0314104_120_608 161
336 3300053156 Ga0500622_0005922 Ga0500622_0005922_3547_4038 161
337 3300053158 Ga0500627_0215119 Ga0500627_0215119_82_570 161
338 3300025250 Ga0209026_1001794 Ga0209026_10017946 162
339 3300039450 Ga0436363_0391842 Ga0436363_0391842_1114_1617 162
340 3300003215 JGI25153J46596_10045327 JGI25153J46596_100453273 163
341 3300003794 Ga0055531_10006977 Ga0055531_100069773 163
342 3300005262 Ga0065165_1000030 Ga0065165_10000303 163
343 3300025297 Ga0209758_1000424 Ga0209758_100042465 163
344 3300025298 Ga0209050_1000169 Ga0209050_1000169140 163
345 3300025304 Ga0209257_1000954 Ga0209257_100095430 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07310

PAS_5

PAS domain

24

166

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mxq-assembly1.cif.gz_D crystal structure of sensory box sensor histidine kinase from vibrio cholerae 0.7672 48 149
3luq-assembly1.cif.gz_D the crystal structure of a pas domain from a sensory box histidine kinase regulator from geobacter sulfurreducens to 2.5a 0.7579 48 149
2v9a-assembly2.cif.gz_B structure of citrate-free periplasmic domain of sensor histidine kinase cita 0.7481 107 147
3mxq-assembly1.cif.gz_B crystal structure of sensory box sensor histidine kinase from vibrio cholerae 0.7441 40 149
6pl0-assembly1.cif.gz_A crystal structure of the dark-adapted full-length bacteriophytochrome xccbphp from xanthomonas campestris in the pr state bound to bv chromophore 0.7369 40 147
ID Description Score Start End Superfamily
af_O82754_88_232_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7712 48 147 3.30.450.20
af_K7K556_92_221_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7676 48 147 3.30.450.20
af_A0A1D6GGX9_750_875_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7447 45 149 3.30.450.20
af_A4D1U4_80_347_3.40.50.11500 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DENN domain, C-terminal lobe 0.7357 107 148 3.40.50.11500
af_P9WLZ7_1_147_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7331 38 150 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A3D9HG97-F1-model_v4 PAS domain-containing protein 0.9514 13 151
AF-A0A369T8K5-F1-model_v4 PAS domain-containing protein 0.9411 14 152
AF-A0A2N3E0I6-F1-model_v4 Histidine kinase 0.9379 14 150
AF-A0A061QLA5-F1-model_v4 PAS domain protein 0.9372 14 151
AF-A0A2E4Y0F9-F1-model_v4 PAS domain-containing protein 0.9364 16 150

Feature Viewer

pLDDT pTM Quality
88.25 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map