F416310

General Info

Members Datasets Scaffolds Average Seq Length
345 204 690 309

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10000040|Ga0081539_1000004085
Length 349
Sequence MPGLVPGIHVFKPQSKRDVDGRDKPGHDKVNYIFAGHFPKMPLRLIFMGTPEFAVPTLRVLHDAGHDIAVVYTRAAKPAGRGMKLQTTPVEQQARGLGIPVISPTTLKTPEALRDFRAHNADAAVVVAYGMILPRAILDTPERGCFNLHASLLPRWRGAAPINRAIMAGDSESGVMAMKMDAGLDTGDVAMAERVAITDAMTAADLHDALAPLGAGLMARAMGALERRELRLTPQSKVGVTYAAKIEKAEARIDWAKPARAVLRHIHGLSPFPGAWCEMPIEGGPRVKILRCEVAEGSGAPGDLLDDRLTIACKEGAIRILELQRAGRQPMKAGEFLRGTPLKPPARVS

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
180 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
183 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
184 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
188 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
189 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
190 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
193 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
199 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
200 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
201 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
202 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
203 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
204 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 0.29
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 0.29
Rhizoplane 1.45
Rhizosphere 89.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10000040 3300005985 Bacteria 292753
2 JGI25153J46596_10000737 3300003215 Bacteria 20058
3 Ga0070658_10015089 3300005327 Bacteria 6184
4 Ga0070658_10032518 3300005327 Bacteria 4193
5 Ga0070661_100000785 3300005344 Bacteria 22858
6 Ga0070659_100125538 3300005366 Bacteria 2082
7 Ga0070667_100215402 3300005367 Bacteria 1708
8 Ga0070713_100144634 3300005436 Bacteria 2109
9 Ga0070710_10001420 3300005437 Bacteria 11294
10 Ga0070711_100055532 3300005439 Bacteria 2736
11 Ga0070663_100054285 3300005455 Bacteria 2863
12 Ga0070662_100042403 3300005457 Bacteria 3250
13 Ga0070681_10015440 3300005458 Bacteria 7603
14 Ga0070681_10023666 3300005458 Bacteria 6181
15 Ga0070681_10142089 3300005458 Bacteria 2330
16 Ga0070681_10207474 3300005458 Bacteria 1876
17 Ga0068867_100288328 3300005459 Bacteria 1349
18 Ga0070706_100236146 3300005467 Bacteria 1707
19 Ga0070698_100083286 3300005471 Bacteria 3188
20 Ga0070679_100028933 3300005530 Bacteria 5465
21 Ga0070679_100045286 3300005530 Bacteria 4384
22 Ga0068853_100021529 3300005539 Bacteria 5377
23 Ga0068853_100451629 3300005539 Bacteria 1209
24 Ga0070693_100087119 3300005547 Bacteria 1875
25 Ga0068855_100006768 3300005563 Bacteria 13903
26 Ga0068855_100124606 3300005563 Bacteria 2947
27 Ga0070664_100000500 3300005564 Bacteria 29704
28 Ga0068857_100013608 3300005577 Bacteria 7088
29 Ga0068854_100030977 3300005578 Bacteria 3714
30 Ga0068856_100038882 3300005614 Bacteria 4671
31 Ga0068852_100021082 3300005616 Bacteria 5193
32 Ga0068852_100023485 3300005616 Bacteria 4964
33 Ga0068851_10001765 3300005834 Bacteria 9451
34 Ga0068851_10048560 3300005834 Bacteria 2151
35 Ga0068860_100002621 3300005843 Bacteria 18698
36 Ga0068860_100357688 3300005843 Bacteria 1438
37 Ga0081455_10030627 3300005937 Bacteria 4884
38 Ga0081539_10066537 3300005985 Bacteria 1952
39 Ga0070717_10006939 3300006028 Bacteria 8369
40 Ga0070716_100138096 3300006173 Bacteria 1550
41 Ga0075366_10218493 3300006195 Bacteria 1161
42 Ga0075428_100341883 3300006844 Bacteria 1607
43 Ga0075436_100089593 3300006914 Bacteria 2138
44 Ga0105240_10000094 3300009093 Bacteria 181637
45 Ga0105240_10007060 3300009093 Bacteria 16374
46 Ga0105240_10046148 3300009093 Bacteria 5522
47 Ga0105240_10126018 3300009093 Bacteria 3077
48 Ga0105240_10303753 3300009093 Bacteria 1825
49 Ga0105240_10506339 3300009093 Bacteria 1342
50 Ga0105245_10356446 3300009098 Bacteria 1451
51 Ga0105241_10006700 3300009174 Bacteria 8475
52 Ga0105237_10063405 3300009545 Bacteria 3693
53 Ga0105237_10093901 3300009545 Bacteria 2989
54 Ga0105237_10212080 3300009545 Bacteria 1936
55 Ga0105238_10001723 3300009551 Bacteria 22037
56 Ga0105238_10002649 3300009551 Bacteria 17824
57 Ga0105249_10642845 3300009553 Bacteria 1118
58 Ga0099796_10067235 3300010159 Bacteria 1285
59 Ga0105239_10015859 3300010375 Bacteria 8340
60 Ga0157370_10006613 3300013104 Bacteria 12739
61 Ga0157369_10002031 3300013105 Bacteria 24394
62 Ga0157369_10343317 3300013105 Bacteria 1551
63 Ga0157372_10353119 3300013307 Bacteria 1713
64 Ga0157375_10329704 3300013308 Bacteria 1691
65 Ga0213872_10000497 3300021361 Bacteria 31473
66 Ga0213872_10001809 3300021361 Bacteria 13303
67 Ga0213872_10002461 3300021361 Bacteria 10860
68 Ga0213872_10003330 3300021361 Bacteria 8955
69 Ga0213872_10003420 3300021361 Bacteria 8825
70 Ga0213872_10018117 3300021361 Bacteria 3248
71 Ga0213872_10130416 3300021361 Bacteria 1107
72 Ga0209758_1000798 3300025297 Bacteria 44669
73 Ga0207656_10006834 3300025321 Bacteria 4127
74 Ga0207692_10000852 3300025898 Bacteria 10957
75 Ga0207699_10010233 3300025906 Bacteria 4698
76 Ga0207705_10231926 3300025909 Bacteria 1404
77 Ga0207684_10223638 3300025910 Bacteria 1624
78 Ga0207654_10000874 3300025911 Bacteria 16703
79 Ga0207695_10000419 3300025913 Bacteria 94504
80 Ga0207695_10001756 3300025913 Bacteria 34405
81 Ga0207695_10230962 3300025913 Bacteria 1754
82 Ga0207671_10023292 3300025914 Bacteria 4671
83 Ga0207671_10037373 3300025914 Bacteria 3601
84 Ga0207693_10031012 3300025915 Bacteria 4223
85 Ga0207663_10000260 3300025916 Bacteria 23036
86 Ga0207657_10003965 3300025919 Bacteria 15718
87 Ga0207652_10049546 3300025921 Bacteria 3596
88 Ga0207694_10000306 3300025924 Bacteria 46009
89 Ga0207650_10046866 3300025925 Bacteria 3184
90 Ga0207700_10069212 3300025928 Bacteria 2708
91 Ga0207664_10007936 3300025929 Bacteria 7377
92 Ga0207664_10011995 3300025929 Bacteria 6186
93 Ga0207690_10112384 3300025932 Bacteria 1964
94 Ga0207706_10035916 3300025933 Bacteria 4403
95 Ga0207679_10030750 3300025945 Bacteria 3752
96 Ga0207667_10054956 3300025949 Bacteria 4187
97 Ga0207640_10049117 3300025981 Bacteria 2730
98 Ga0207639_10025554 3300026041 Bacteria 4282
99 Ga0207639_10039634 3300026041 Bacteria 3511
100 Ga0207639_10295190 3300026041 Bacteria 1430
101 Ga0207678_10166290 3300026067 Bacteria 1883
102 Ga0207702_10000122 3300026078 Bacteria 91685
103 Ga0207702_10013474 3300026078 Bacteria 6794
104 Ga0207676_10635529 3300026095 Bacteria 1029
105 Ga0207674_10000014 3300026116 Bacteria 183605
106 Ga0207674_10014657 3300026116 Bacteria 8644
107 Ga0268266_10134631 3300028379 Bacteria 2212
108 Ga0268265_10229781 3300028380 Bacteria 1630
109 Ga0268264_10000187 3300028381 Bacteria 129270
110 Ga0268264_10050023 3300028381 Bacteria 3479
111 Ga0265763_1000332 3300030763 Bacteria 2695
112 Ga0265330_10048762 3300031235 Bacteria 1862
113 Ga0265332_10008748 3300031238 Bacteria 4533
114 Ga0265340_10001645 3300031247 Bacteria 12826
115 Ga0265340_10049995 3300031247 Bacteria 2029
116 Ga0265339_10005543 3300031249 Bacteria 8388
117 Ga0265316_10244397 3300031344 Bacteria 1319
118 Ga0307408_100055008 3300031548 Bacteria 2879
119 Ga0307408_100101835 3300031548 Bacteria 2189
120 Ga0265313_10060713 3300031595 Bacteria 1772
121 Ga0307508_10169502 3300031616 Bacteria 1787
122 Ga0316575_10002143 3300031665 Bacteria 6584
123 Ga0265314_10007932 3300031711 Bacteria 9159
124 Ga0265314_10035502 3300031711 Bacteria 3633
125 Ga0265342_10065019 3300031712 Bacteria 2139
126 Ga0307413_10020256 3300031824 Bacteria 3533
127 Ga0307413_10027375 3300031824 Bacteria 3158
128 Ga0307413_10124484 3300031824 Bacteria 1752
129 Ga0307410_10021408 3300031852 Bacteria 3976
130 Ga0307410_10049652 3300031852 Bacteria 2817
131 Ga0307410_10158001 3300031852 Bacteria 1695
132 Ga0307410_10365773 3300031852 Bacteria 1156
133 Ga0307410_10412226 3300031852 Bacteria 1094
134 Ga0307406_10092380 3300031901 Bacteria 2040
135 Ga0307406_10174660 3300031901 Bacteria 1558
136 Ga0307407_10034376 3300031903 Bacteria 2774
137 Ga0307407_10151740 3300031903 Bacteria 1506
138 Ga0307412_10013118 3300031911 Bacteria 4848
139 Ga0307412_10027682 3300031911 Bacteria 3537
140 Ga0307409_100004595 3300031995 Bacteria 7786
141 Ga0307409_100007392 3300031995 Bacteria 6567
142 Ga0307416_100633223 3300032002 Bacteria 1152
143 Ga0307411_10049515 3300032005 Bacteria 2730
144 Ga0307411_10055489 3300032005 Bacteria 2606
145 Ga0307415_100082315 3300032126 Bacteria 2302
146 Ga0307415_100382449 3300032126 Bacteria 1196
147 Ga0373926_0085347 3300035083 Bacteria 1171
148 Ga0373940_0005528 3300035088 Bacteria 2744
149 Ga0373936_0153494 3300035113 Bacteria 999
150 Ga0373953_0008102 3300035117 Bacteria 3555
151 Ga0373924_0012709 3300035410 Bacteria 3150
152 Ga0373931_0090528 3300035691 Bacteria 1704
153 Ga0373927_0005789 3300035695 Bacteria 8482
154 Ga0373937_0605948 3300036401 Bacteria 1039
155 Ga0373925_0170276 3300037068 Bacteria 1719
156 Ga0395899_0039115 3300037312 Bacteria 3552
157 Ga0395900_0002882 3300037418 Bacteria 18746
158 Ga0395900_0018509 3300037418 Bacteria 7104
159 Ga0395900_0076182 3300037418 Bacteria 3448
160 Ga0395898_0025829 3300037466 Bacteria 5914
161 Ga0395898_0057557 3300037466 Bacteria 3788
162 Ga0395898_0109887 3300037466 Bacteria 2643
163 Ga0395905_0008916 3300037471 Bacteria 9850
164 Ga0395905_0022817 3300037471 Bacteria 5916
165 Ga0436364_1004119 3300037853 Bacteria 2412
166 Ga0395901_0010315 3300038443 Bacteria 9464
167 Ga0395901_0044421 3300038443 Bacteria 4609
168 Ga0436361_0011908 3300039447 Bacteria 4789
169 Ga0436361_0470732 3300039447 Bacteria 988
170 Ga0436361_0600916 3300039447 Bacteria 2515
171 Ga0436361_0679000 3300039447 Bacteria 4182
172 Ga0436361_0683360 3300039447 Bacteria 1130
173 Ga0436361_0717462 3300039447 Bacteria 1009
174 Ga0436361_0788579 3300039447 Bacteria 46510
175 Ga0436361_0829388 3300039447 Bacteria 8428
176 Ga0436361_0855890 3300039447 Bacteria 6834
177 Ga0436361_0997755 3300039447 Bacteria 7244
178 Ga0436361_1047562 3300039447 Bacteria 1593
179 Ga0436361_1114573 3300039447 Bacteria 5732
180 Ga0436361_1143888 3300039447 Bacteria 1945
181 Ga0436361_1148463 3300039447 Bacteria 2835
182 Ga0451577_0254913 3300042876 Bacteria 1588
183 Ga0453683_0276403 3300044673 Bacteria 1072
184 Ga0466965_0101346 3300044683 Bacteria 1473
185 Ga0466957_0007609 3300044842 Bacteria 6124
186 Ga0466959_0027885 3300045049 Bacteria 4189
187 Ga0451576_0006676 3300045051 Bacteria 14079
188 Ga0451576_0152240 3300045051 Bacteria 2412
189 Ga0451576_0235917 3300045051 Bacteria 1910
190 Ga0466958_0087578 3300045836 Bacteria 1923
191 Ga0495603_0026654 3300046455 Bacteria 3491
192 Ga0495590_0034159 3300046457 Bacteria 1776
193 Ga0495638_0157463 3300046460 Bacteria 1313
194 Ga0495606_0003543 3300046507 Bacteria 16488
195 Ga0495628_0018693 3300046516 Bacteria 5735
196 Ga0495630_0217474 3300046517 Bacteria 1458
197 Ga0495640_0050227 3300046533 Bacteria 2874
198 Ga0495587_0037762 3300046536 Bacteria 2898
199 Ga0495645_0004402 3300046543 Bacteria 9625
200 Ga0495667_0094161 3300046559 Bacteria 1939
201 Ga0495634_0024865 3300046642 Bacteria 4198
202 Ga0495623_0011342 3300046679 Bacteria 5766
203 Ga0495669_0021507 3300046684 Bacteria 2800
204 Ga0495672_0002370 3300047320 Bacteria 17401
205 Ga0495676_0273002 3300047321 Bacteria 1147
206 Ga0495680_0047424 3300047322 Bacteria 3379
207 Ga0495675_0010684 3300047444 Bacteria 5743
208 Ga0495686_0000302 3300047472 Bacteria 84826
209 Ga0495686_0061799 3300047472 Bacteria 2325
210 Ga0496112_0000055 3300048915 Bacteria 78086
211 Ga0496112_0004717 3300048915 Bacteria 11615
212 Ga0496115_0004434 3300048918 Bacteria 10175
213 Ga0496115_0106923 3300048918 Bacteria 2297
214 Ga0496121_0008147 3300048924 Bacteria 12447
215 Ga0496122_0002944 3300048925 Bacteria 23216
216 Ga0496123_0001139 3300048926 Bacteria 39727
217 Ga0501032_0000040 3300049569 Bacteria 115662
218 Ga0501032_0022681 3300049569 Bacteria 4350
219 Ga0501032_0036986 3300049569 Bacteria 3330
220 Ga0501032_0053955 3300049569 Bacteria 2706
221 Ga0501032_0237256 3300049569 Bacteria 1185
222 Ga0501033_0000128 3300049570 Bacteria 73419
223 Ga0501033_0000291 3300049570 Bacteria 48207
224 Ga0501033_0017644 3300049570 Bacteria 5390
225 Ga0501033_0043848 3300049570 Bacteria 3330
226 Ga0501034_0098309 3300049571 Bacteria 2922
227 Ga0501034_0125748 3300049571 Bacteria 2549
228 Ga0501036_0001021 3300049572 Bacteria 21132
229 Ga0501036_0030580 3300049572 Bacteria 4547
230 Ga0501036_0159451 3300049572 Bacteria 1902
231 Ga0501036_0329286 3300049572 Bacteria 1276
232 Ga0501037_0000041 3300049573 Bacteria 118457
233 Ga0501037_0000723 3300049573 Bacteria 25000
234 Ga0501037_0024182 3300049573 Bacteria 4492
235 Ga0501037_0129235 3300049573 Bacteria 1812
236 Ga0501038_0000057 3300049574 Bacteria 92766
237 Ga0501038_0005197 3300049574 Bacteria 12108
238 Ga0501038_0006993 3300049574 Bacteria 10420
239 Ga0501038_0045355 3300049574 Bacteria 3816
240 Ga0501038_0061909 3300049574 Bacteria 3200
241 Ga0501039_0067621 3300049575 Bacteria 2774
242 Ga0501039_0069372 3300049575 Bacteria 2737
243 Ga0501039_0117417 3300049575 Bacteria 2083
244 Ga0501039_0192083 3300049575 Bacteria 1605
245 Ga0501040_0000313 3300049576 Bacteria 28477
246 Ga0501040_0001885 3300049576 Bacteria 13456
247 Ga0501040_0027260 3300049576 Bacteria 3845
248 Ga0501040_0039041 3300049576 Bacteria 3228
249 Ga0501041_0206662 3300049577 Bacteria 1231
250 Ga0501042_0003658 3300049578 Bacteria 9696
251 Ga0501042_0007575 3300049578 Bacteria 7121
252 Ga0501042_0017311 3300049578 Bacteria 4968
253 Ga0501042_0077130 3300049578 Bacteria 2386
254 Ga0501042_0267397 3300049578 Bacteria 1234
255 Ga0501043_0000184 3300049579 Bacteria 56470
256 Ga0501043_0001380 3300049579 Bacteria 21276
257 Ga0501043_0029072 3300049579 Bacteria 4340
258 Ga0501046_0000072 3300049580 Bacteria 106407
259 Ga0501046_0010044 3300049580 Bacteria 8153
260 Ga0501046_0249269 3300049580 Bacteria 1307
261 Ga0501047_0000044 3300049581 Bacteria 174789
262 Ga0501047_0012569 3300049581 Bacteria 8018
263 Ga0501047_0059119 3300049581 Bacteria 3701
264 Ga0501048_0000117 3300049582 Bacteria 45344
265 Ga0501048_0049551 3300049582 Bacteria 2993
266 Ga0501067_0000938 3300049583 Bacteria 15626
267 Ga0501067_0050193 3300049583 Bacteria 2312
268 Ga0501068_0003582 3300049584 Bacteria 8389
269 Ga0501070_0071307 3300049586 Bacteria 2876
270 Ga0501071_0066596 3300049587 Bacteria 2618
271 Ga0501072_0000156 3300049588 Bacteria 50717
272 Ga0501072_0038704 3300049588 Bacteria 3743
273 Ga0501072_0311866 3300049588 Bacteria 1250
274 Ga0501073_0002824 3300049589 Bacteria 13006
275 Ga0501073_0129448 3300049589 Bacteria 1749
276 Ga0501073_0159656 3300049589 Bacteria 1562
277 Ga0501073_0162668 3300049589 Bacteria 1546
278 Ga0501074_0000035 3300049590 Bacteria 64770
279 Ga0501074_0010216 3300049590 Bacteria 6815
280 Ga0501075_0102267 3300049591 Bacteria 2176
281 Ga0501076_0016124 3300049592 Bacteria 5657
282 Ga0501077_0031114 3300049593 Bacteria 3395
283 Ga0501077_0096853 3300049593 Bacteria 1870
284 Ga0501079_0028127 3300049741 Bacteria 4313
285 Ga0501080_0003454 3300049742 Bacteria 13950
286 Ga0501080_0008601 3300049742 Bacteria 9261
287 Ga0501080_0141677 3300049742 Bacteria 2222
288 Ga0501081_0002776 3300049743 Bacteria 11107
289 Ga0501081_0119786 3300049743 Bacteria 1874
290 Ga0501083_0000641 3300049744 Bacteria 22636
291 Ga0501083_0014594 3300049744 Bacteria 5492
292 Ga0501083_0014803 3300049744 Bacteria 5455
293 Ga0501083_0199355 3300049744 Bacteria 1306
294 Ga0501035_0000128 3300049822 Bacteria 92297
295 Ga0501035_0000688 3300049822 Bacteria 36917
296 Ga0501035_0014519 3300049822 Bacteria 7269
297 Ga0501035_0056887 3300049822 Bacteria 3488
298 Ga0501035_0104522 3300049822 Bacteria 2483
299 Ga0501035_0218101 3300049822 Bacteria 1630
300 Ga0501044_0000108 3300049823 Bacteria 100968
301 Ga0501044_0003954 3300049823 Bacteria 16596
302 Ga0501044_0005432 3300049823 Bacteria 14156
303 Ga0501044_0188099 3300049823 Bacteria 2028
304 Ga0501045_0032377 3300049824 Bacteria 3788
305 Ga0501045_0045341 3300049824 Bacteria 3201
306 Ga0501045_0335510 3300049824 Bacteria 1125
307 Ga0495601_0030849 3300053077 Bacteria 3330
308 Ga0495619_0058870 3300053085 Bacteria 2551
309 Ga0500578_0119762 3300053086 Bacteria 1655
310 Ga0500651_0010878 3300053093 Bacteria 5470
311 Ga0500566_0068946 3300053094 Bacteria 1987
312 Ga0500556_0000363 3300053104 Bacteria 33629
313 Ga0500572_055860 3300053111 Bacteria 1188
314 Ga0500595_030551 3300053119 Bacteria 1813
315 Ga0500595_051583 3300053119 Bacteria 1273
316 Ga0500607_000354 3300053121 Bacteria 43487
317 Ga0500614_019802 3300053123 Bacteria 1546
318 Ga0500642_0010355 3300053130 Bacteria 3284
319 Ga0500559_0006081 3300053136 Bacteria 5469
320 Ga0500559_0007397 3300053136 Bacteria 4870
321 Ga0500559_0080361 3300053136 Bacteria 1481
322 Ga0500568_0072736 3300053139 Bacteria 1314
323 Ga0500573_0000061 3300053140 Bacteria 67535
324 Ga0500588_0002728 3300053146 Bacteria 3634
325 Ga0500639_030872 3300053163 Bacteria 2831
326 Ga0500639_103900 3300053163 Bacteria 1392
327 Ga0500637_0142962 3300053178 Bacteria 1384
328 Ga0500645_007973 3300053730 Bacteria 3649
329 Ga0500596_002865 3300053735 Bacteria 3359
330 Ga0500601_009285 3300053737 Bacteria 1097
331 Ga0501084_0002007 3300054114 Bacteria 16265
332 Ga0501084_0079859 3300054114 Bacteria 2742
333 Ga0501084_0354953 3300054114 Bacteria 1238
334 Ga0501082_0002249 3300060353 Bacteria 16902
335 Ga0501082_0058040 3300060353 Bacteria 3334
336 Ga0501082_0089375 3300060353 Bacteria 2659
337 Ga0466962_0045389 3300061719 Bacteria 2101
338 Ga0530510_0017354 3300061734 Bacteria 5101
339 2509149890 2508501128 Bacteria 8613869
340 2600202485 2599185354 Bacteria 4398675
341 2753764278 2751185897 Bacteria 5322941
342 2809064279 2808606401 Bacteria 4586670
343 2809080247 2808606404 Bacteria 4652788
344 2809084611 2808606405 Bacteria 4586632
345 2880522153 2880518877 Bacteria 5012590
346 Ga0081539_10000040
347 JGI25153J46596_10000737
348 Ga0070658_10015089
349 Ga0070658_10032518
350 Ga0070661_100000785
351 Ga0070659_100125538
352 Ga0070667_100215402
353 Ga0070713_100144634
354 Ga0070710_10001420
355 Ga0070711_100055532
356 Ga0070663_100054285
357 Ga0070662_100042403
358 Ga0070681_10015440
359 Ga0070681_10023666
360 Ga0070681_10142089
361 Ga0070681_10207474
362 Ga0068867_100288328
363 Ga0070706_100236146
364 Ga0070698_100083286
365 Ga0070679_100028933
366 Ga0070679_100045286
367 Ga0068853_100021529
368 Ga0068853_100451629
369 Ga0070693_100087119
370 Ga0068855_100006768
371 Ga0068855_100124606
372 Ga0070664_100000500
373 Ga0068857_100013608
374 Ga0068854_100030977
375 Ga0068856_100038882
376 Ga0068852_100021082
377 Ga0068852_100023485
378 Ga0068851_10001765
379 Ga0068851_10048560
380 Ga0068860_100002621
381 Ga0068860_100357688
382 Ga0081455_10030627
383 Ga0081539_10066537
384 Ga0070717_10006939
385 Ga0070716_100138096
386 Ga0075366_10218493
387 Ga0075428_100341883
388 Ga0075436_100089593
389 Ga0105240_10000094
390 Ga0105240_10007060
391 Ga0105240_10046148
392 Ga0105240_10126018
393 Ga0105240_10303753
394 Ga0105240_10506339
395 Ga0105245_10356446
396 Ga0105241_10006700
397 Ga0105237_10063405
398 Ga0105237_10093901
399 Ga0105237_10212080
400 Ga0105238_10001723
401 Ga0105238_10002649
402 Ga0105249_10642845
403 Ga0099796_10067235
404 Ga0105239_10015859
405 Ga0157370_10006613
406 Ga0157369_10002031
407 Ga0157369_10343317
408 Ga0157372_10353119
409 Ga0157375_10329704
410 Ga0213872_10000497
411 Ga0213872_10001809
412 Ga0213872_10002461
413 Ga0213872_10003330
414 Ga0213872_10003420
415 Ga0213872_10018117
416 Ga0213872_10130416
417 Ga0209758_1000798
418 Ga0207656_10006834
419 Ga0207692_10000852
420 Ga0207699_10010233
421 Ga0207705_10231926
422 Ga0207684_10223638
423 Ga0207654_10000874
424 Ga0207695_10000419
425 Ga0207695_10001756
426 Ga0207695_10230962
427 Ga0207671_10023292
428 Ga0207671_10037373
429 Ga0207693_10031012
430 Ga0207663_10000260
431 Ga0207657_10003965
432 Ga0207652_10049546
433 Ga0207694_10000306
434 Ga0207650_10046866
435 Ga0207700_10069212
436 Ga0207664_10007936
437 Ga0207664_10011995
438 Ga0207690_10112384
439 Ga0207706_10035916
440 Ga0207679_10030750
441 Ga0207667_10054956
442 Ga0207640_10049117
443 Ga0207639_10025554
444 Ga0207639_10039634
445 Ga0207639_10295190
446 Ga0207678_10166290
447 Ga0207702_10000122
448 Ga0207702_10013474
449 Ga0207676_10635529
450 Ga0207674_10000014
451 Ga0207674_10014657
452 Ga0268266_10134631
453 Ga0268265_10229781
454 Ga0268264_10000187
455 Ga0268264_10050023
456 Ga0265763_1000332
457 Ga0265330_10048762
458 Ga0265332_10008748
459 Ga0265340_10001645
460 Ga0265340_10049995
461 Ga0265339_10005543
462 Ga0265316_10244397
463 Ga0307408_100055008
464 Ga0307408_100101835
465 Ga0265313_10060713
466 Ga0307508_10169502
467 Ga0316575_10002143
468 Ga0265314_10007932
469 Ga0265314_10035502
470 Ga0265342_10065019
471 Ga0307413_10020256
472 Ga0307413_10027375
473 Ga0307413_10124484
474 Ga0307410_10021408
475 Ga0307410_10049652
476 Ga0307410_10158001
477 Ga0307410_10365773
478 Ga0307410_10412226
479 Ga0307406_10092380
480 Ga0307406_10174660
481 Ga0307407_10034376
482 Ga0307407_10151740
483 Ga0307412_10013118
484 Ga0307412_10027682
485 Ga0307409_100004595
486 Ga0307409_100007392
487 Ga0307416_100633223
488 Ga0307411_10049515
489 Ga0307411_10055489
490 Ga0307415_100082315
491 Ga0307415_100382449
492 Ga0373926_0085347
493 Ga0373940_0005528
494 Ga0373936_0153494
495 Ga0373953_0008102
496 Ga0373924_0012709
497 Ga0373931_0090528
498 Ga0373927_0005789
499 Ga0373937_0605948
500 Ga0373925_0170276
501 Ga0395899_0039115
502 Ga0395900_0002882
503 Ga0395900_0018509
504 Ga0395900_0076182
505 Ga0395898_0025829
506 Ga0395898_0057557
507 Ga0395898_0109887
508 Ga0395905_0008916
509 Ga0395905_0022817
510 Ga0436364_1004119
511 Ga0395901_0010315
512 Ga0395901_0044421
513 Ga0436361_0011908
514 Ga0436361_0470732
515 Ga0436361_0600916
516 Ga0436361_0679000
517 Ga0436361_0683360
518 Ga0436361_0717462
519 Ga0436361_0788579
520 Ga0436361_0829388
521 Ga0436361_0855890
522 Ga0436361_0997755
523 Ga0436361_1047562
524 Ga0436361_1114573
525 Ga0436361_1143888
526 Ga0436361_1148463
527 Ga0451577_0254913
528 Ga0453683_0276403
529 Ga0466965_0101346
530 Ga0466957_0007609
531 Ga0466959_0027885
532 Ga0451576_0006676
533 Ga0451576_0152240
534 Ga0451576_0235917
535 Ga0466958_0087578
536 Ga0495603_0026654
537 Ga0495590_0034159
538 Ga0495638_0157463
539 Ga0495606_0003543
540 Ga0495628_0018693
541 Ga0495630_0217474
542 Ga0495640_0050227
543 Ga0495587_0037762
544 Ga0495645_0004402
545 Ga0495667_0094161
546 Ga0495634_0024865
547 Ga0495623_0011342
548 Ga0495669_0021507
549 Ga0495672_0002370
550 Ga0495676_0273002
551 Ga0495680_0047424
552 Ga0495675_0010684
553 Ga0495686_0000302
554 Ga0495686_0061799
555 Ga0496112_0000055
556 Ga0496112_0004717
557 Ga0496115_0004434
558 Ga0496115_0106923
559 Ga0496121_0008147
560 Ga0496122_0002944
561 Ga0496123_0001139
562 Ga0501032_0000040
563 Ga0501032_0022681
564 Ga0501032_0036986
565 Ga0501032_0053955
566 Ga0501032_0237256
567 Ga0501033_0000128
568 Ga0501033_0000291
569 Ga0501033_0017644
570 Ga0501033_0043848
571 Ga0501034_0098309
572 Ga0501034_0125748
573 Ga0501036_0001021
574 Ga0501036_0030580
575 Ga0501036_0159451
576 Ga0501036_0329286
577 Ga0501037_0000041
578 Ga0501037_0000723
579 Ga0501037_0024182
580 Ga0501037_0129235
581 Ga0501038_0000057
582 Ga0501038_0005197
583 Ga0501038_0006993
584 Ga0501038_0045355
585 Ga0501038_0061909
586 Ga0501039_0067621
587 Ga0501039_0069372
588 Ga0501039_0117417
589 Ga0501039_0192083
590 Ga0501040_0000313
591 Ga0501040_0001885
592 Ga0501040_0027260
593 Ga0501040_0039041
594 Ga0501041_0206662
595 Ga0501042_0003658
596 Ga0501042_0007575
597 Ga0501042_0017311
598 Ga0501042_0077130
599 Ga0501042_0267397
600 Ga0501043_0000184
601 Ga0501043_0001380
602 Ga0501043_0029072
603 Ga0501046_0000072
604 Ga0501046_0010044
605 Ga0501046_0249269
606 Ga0501047_0000044
607 Ga0501047_0012569
608 Ga0501047_0059119
609 Ga0501048_0000117
610 Ga0501048_0049551
611 Ga0501067_0000938
612 Ga0501067_0050193
613 Ga0501068_0003582
614 Ga0501070_0071307
615 Ga0501071_0066596
616 Ga0501072_0000156
617 Ga0501072_0038704
618 Ga0501072_0311866
619 Ga0501073_0002824
620 Ga0501073_0129448
621 Ga0501073_0159656
622 Ga0501073_0162668
623 Ga0501074_0000035
624 Ga0501074_0010216
625 Ga0501075_0102267
626 Ga0501076_0016124
627 Ga0501077_0031114
628 Ga0501077_0096853
629 Ga0501079_0028127
630 Ga0501080_0003454
631 Ga0501080_0008601
632 Ga0501080_0141677
633 Ga0501081_0002776
634 Ga0501081_0119786
635 Ga0501083_0000641
636 Ga0501083_0014594
637 Ga0501083_0014803
638 Ga0501083_0199355
639 Ga0501035_0000128
640 Ga0501035_0000688
641 Ga0501035_0014519
642 Ga0501035_0056887
643 Ga0501035_0104522
644 Ga0501035_0218101
645 Ga0501044_0000108
646 Ga0501044_0003954
647 Ga0501044_0005432
648 Ga0501044_0188099
649 Ga0501045_0032377
650 Ga0501045_0045341
651 Ga0501045_0335510
652 Ga0495601_0030849
653 Ga0495619_0058870
654 Ga0500578_0119762
655 Ga0500651_0010878
656 Ga0500566_0068946
657 Ga0500556_0000363
658 Ga0500572_055860
659 Ga0500595_030551
660 Ga0500595_051583
661 Ga0500607_000354
662 Ga0500614_019802
663 Ga0500642_0010355
664 Ga0500559_0006081
665 Ga0500559_0007397
666 Ga0500559_0080361
667 Ga0500568_0072736
668 Ga0500573_0000061
669 Ga0500588_0002728
670 Ga0500639_030872
671 Ga0500639_103900
672 Ga0500637_0142962
673 Ga0500645_007973
674 Ga0500596_002865
675 Ga0500601_009285
676 Ga0501084_0002007
677 Ga0501084_0079859
678 Ga0501084_0354953
679 Ga0501082_0002249
680 Ga0501082_0058040
681 Ga0501082_0089375
682 Ga0466962_0045389
683 Ga0530510_0017354
684 2509149890
685 2600202485
686 2753764278
687 2809064279
688 2809080247
689 2809084611
690 2880522153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

43

222

0.95

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

245

341

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9524 3 307
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9513 1 307
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9503 3 307
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9483 1 307
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9434 3 307
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9777 3 208 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9677 3 208 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9605 3 208 3.40.50.170
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9469 4 301 3.40.50.12230
5uaiB02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.9445 209 305 3.10.25.10
ID Description Score Start End GO Terms
AF-F2I3X7-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9814 1 307 GO:0004479
GO:0005829
AF-A0A1H9TCB6-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.979 1 306 GO:0004479
GO:0005829
AF-A0A379B190-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.979 77 248 GO:0004479
GO:0005829
AF-F2I3X7-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9783 1 307 GO:0004479
GO:0005829
AF-A0A2E9V837-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9765 4 307 GO:0004479
GO:0005829

Map