F416265

General Info

Members Datasets Scaffolds Average Seq Length
345 266 690 101

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10354872|Ga0070710_103548722
Length 108
Sequence VTEIRVVLPVHLRNLARTGKEVTVTVPGDGGGGVTQRAVLDALEQAYPVLLGTIRDRQTGKRRAFVRFYACEQDFSNEPPDAPLPAAVAAALAAGTEPFLVVGAMAGG

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
209 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
210 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
211 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
212 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
213 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
253 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 2.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 5.8
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10354872 3300005437 Bacteria 972
2 JGI24751J29686_10002670 3300002459 Bacteria 3590
3 rootL2_10002808 3300003322 Bacteria 3833
4 Ga0070658_10070831 3300005327 Bacteria 2855
5 Ga0070676_10474124 3300005328 Bacteria 884
6 Ga0070690_100289141 3300005330 Bacteria 1172
7 Ga0070670_100060777 3300005331 Bacteria 3244
8 Ga0070677_10639527 3300005333 Bacteria 593
9 Ga0068869_100001843 3300005334 Bacteria 12736
10 Ga0068869_101923384 3300005334 Bacteria 530
11 Ga0070666_10975389 3300005335 Bacteria 628
12 Ga0070680_100005607 3300005336 Bacteria 9506
13 Ga0070682_100003336 3300005337 Bacteria 8899
14 Ga0070682_101396018 3300005337 Bacteria 599
15 Ga0068868_100020520 3300005338 Bacteria 4967
16 Ga0070660_101173883 3300005339 Bacteria 650
17 Ga0070689_100034187 3300005340 Bacteria 3878
18 Ga0070689_100105798 3300005340 Bacteria 2231
19 Ga0070691_10002131 3300005341 Bacteria 8750
20 Ga0070687_100390056 3300005343 Bacteria 910
21 Ga0070661_100042326 3300005344 Bacteria 3324
22 Ga0070661_100224729 3300005344 Bacteria 1441
23 Ga0070692_10039327 3300005345 Bacteria 2414
24 Ga0070675_100128750 3300005354 Bacteria 2155
25 Ga0070675_100198407 3300005354 Bacteria 1741
26 Ga0070671_100021698 3300005355 Bacteria 5245
27 Ga0070674_100917310 3300005356 Bacteria 764
28 Ga0070673_100136755 3300005364 Bacteria 2063
29 Ga0070673_100445036 3300005364 Bacteria 1165
30 Ga0070688_100287766 3300005365 Bacteria 1183
31 Ga0070659_100119026 3300005366 Bacteria 2137
32 Ga0070659_100208610 3300005366 Bacteria 1610
33 Ga0070709_10006165 3300005434 Bacteria 6525
34 Ga0070714_100144925 3300005435 Bacteria 2135
35 Ga0070713_100002127 3300005436 Bacteria 12821
36 Ga0070710_10159151 3300005437 Bacteria 1399
37 Ga0070710_10242999 3300005437 Bacteria 1154
38 Ga0070701_10036467 3300005438 Bacteria 2478
39 Ga0070711_100151936 3300005439 Bacteria 1747
40 Ga0070705_100524154 3300005440 Bacteria 904
41 Ga0070700_100026248 3300005441 Bacteria 3438
42 Ga0070700_101220728 3300005441 Bacteria 629
43 Ga0070708_100229070 3300005445 Bacteria 1743
44 Ga0070663_100005899 3300005455 Bacteria 7328
45 Ga0070678_100020034 3300005456 Bacteria 4380
46 Ga0070662_101589376 3300005457 Bacteria 564
47 Ga0070681_10207384 3300005458 Bacteria 1876
48 Ga0070685_10010554 3300005466 Bacteria 4803
49 Ga0070706_100413594 3300005467 Bacteria 1255
50 Ga0070699_100188298 3300005518 Bacteria 1833
51 Ga0070679_100040169 3300005530 Bacteria 4654
52 Ga0070679_100436351 3300005530 Bacteria 1255
53 Ga0070684_101996237 3300005535 Bacteria 547
54 Ga0070697_100064981 3300005536 Bacteria 2980
55 Ga0068853_100110316 3300005539 Bacteria 2443
56 Ga0070672_100346282 3300005543 Bacteria 1266
57 Ga0070686_100788755 3300005544 Unclassified 765
58 Ga0070693_100001983 3300005547 Bacteria 9363
59 Ga0070665_100078568 3300005548 Bacteria 3306
60 Ga0068855_100283826 3300005563 Bacteria 1837
61 Ga0068854_100253656 3300005578 Bacteria 1406
62 Ga0068856_100228915 3300005614 Bacteria 1874
63 Ga0068856_102159063 3300005614 Bacteria 566
64 Ga0070702_100001772 3300005615 Bacteria 8979
65 Ga0068859_100072875 3300005617 Bacteria 3472
66 Ga0068859_100200023 3300005617 Bacteria 2083
67 Ga0068866_10276674 3300005718 Bacteria 1038
68 Ga0068861_100172240 3300005719 Bacteria 1795
69 Ga0068870_10019195 3300005840 Bacteria 3312
70 Ga0068870_10309233 3300005840 Bacteria 1000
71 Ga0068863_100010322 3300005841 Bacteria 9075
72 Ga0068858_100052241 3300005842 Bacteria 3780
73 Ga0068860_100141512 3300005843 Bacteria 2312
74 Ga0068862_100195958 3300005844 Bacteria 1820
75 Ga0070717_10651475 3300006028 Bacteria 956
76 Ga0075432_10026023 3300006058 Bacteria 2008
77 Ga0070716_100485518 3300006173 Bacteria 908
78 Ga0070712_100241611 3300006175 Bacteria 1439
79 Ga0070712_100268187 3300006175 Bacteria 1370
80 Ga0075366_10885206 3300006195 Unclassified 556
81 Ga0097621_100014941 3300006237 Bacteria 5826
82 Ga0097621_100239375 3300006237 Bacteria 1586
83 Ga0068871_101187984 3300006358 Bacteria 715
84 Ga0075428_100118397 3300006844 Bacteria 2884
85 Ga0075431_101272368 3300006847 Bacteria 697
86 Ga0075431_101835346 3300006847 Bacteria 562
87 Ga0075433_10021822 3300006852 Bacteria 5372
88 Ga0075434_100001870 3300006871 Bacteria 18213
89 Ga0075434_100629378 3300006871 Bacteria 1092
90 Ga0075434_102353269 3300006871 Bacteria 535
91 Ga0075429_100078205 3300006880 Bacteria 2882
92 Ga0068865_100633774 3300006881 Bacteria 907
93 Ga0075436_100392587 3300006914 Bacteria 1005
94 Ga0075436_101459416 3300006914 Unclassified 519
95 Ga0097620_100072876 3300006931 Bacteria 3472
96 Ga0097620_100200012 3300006931 Bacteria 2083
97 Ga0075435_100001237 3300007076 Bacteria 16361
98 Ga0075435_101466683 3300007076 Bacteria 598
99 Ga0105251_10050662 3300009011 Bacteria 1982
100 Ga0105244_10295675 3300009036 Bacteria 750
101 Ga0105240_10725301 3300009093 Bacteria 1083
102 Ga0111539_10144676 3300009094 Bacteria 2783
103 Ga0111539_10314641 3300009094 Bacteria 1822
104 Ga0111539_10355777 3300009094 Bacteria 1704
105 Ga0111539_12070179 3300009094 Bacteria 660
106 Ga0111539_12227769 3300009094 Bacteria 636
107 Ga0105245_10100034 3300009098 Bacteria 2682
108 Ga0105245_11269996 3300009098 Bacteria 785
109 Ga0105247_10018711 3300009101 Bacteria 4158
110 Ga0114129_10092839 3300009147 Bacteria 4181
111 Ga0105243_10527599 3300009148 Bacteria 1124
112 Ga0105241_10062381 3300009174 Bacteria 2873
113 Ga0105241_10452829 3300009174 Bacteria 1136
114 Ga0105242_11743657 3300009176 Bacteria 660
115 Ga0105248_10050146 3300009177 Bacteria 4681
116 Ga0105237_10368759 3300009545 Bacteria 1441
117 Ga0105238_10140356 3300009551 Bacteria 2393
118 Ga0105238_10141939 3300009551 Bacteria 2378
119 Ga0105032_105790 3300009979 Bacteria 1038
120 Ga0105239_10221769 3300010375 Bacteria 2120
121 Ga0105246_10056635 3300011119 Bacteria 2710
122 Ga0157321_1003186 3300012487 Bacteria 964
123 Ga0157373_10243231 3300013100 Bacteria 1272
124 Ga0157371_10080140 3300013102 Bacteria 2312
125 Ga0157370_10023425 3300013104 Bacteria 6128
126 Ga0157370_10413667 3300013104 Bacteria 1241
127 Ga0157370_10896434 3300013104 Bacteria 805
128 Ga0157374_10028810 3300013296 Bacteria 5020
129 Ga0157378_11120657 3300013297 Bacteria 824
130 Ga0157378_11719918 3300013297 Bacteria 674
131 Ga0163162_10849026 3300013306 Bacteria 1028
132 Ga0157372_10085962 3300013307 Bacteria 3568
133 Ga0157372_10247862 3300013307 Bacteria 2067
134 Ga0157372_10412263 3300013307 Bacteria 1574
135 Ga0157375_10186851 3300013308 Bacteria 2226
136 Ga0157375_11976815 3300013308 Bacteria 693
137 Ga0163163_11514310 3300014325 Bacteria 732
138 Ga0157377_10011423 3300014745 Bacteria 4433
139 Ga0157379_10028170 3300014968 Bacteria 5000
140 Ga0157376_10090316 3300014969 Bacteria 2651
141 Ga0157376_10223176 3300014969 Bacteria 1746
142 Ga0197907_10992985 3300020069 Bacteria 1988
143 Ga0206356_11791668 3300020070 Bacteria 812
144 Ga0206354_11210034 3300020081 Bacteria 2948
145 Ga0206353_11964563 3300020082 Bacteria 978
146 Ga0213876_10417829 3300021384 Bacteria 713
147 Ga0213875_10567967 3300021388 Bacteria 547
148 Ga0224712_10007494 3300022467 Bacteria 3182
149 Ga0207656_10025625 3300025321 Bacteria 2396
150 Ga0207713_1063453 3300025735 Bacteria 1395
151 Ga0207682_10471230 3300025893 Bacteria 595
152 Ga0207692_10301599 3300025898 Bacteria 975
153 Ga0207642_10102748 3300025899 Bacteria 1439
154 Ga0207710_10087857 3300025900 Bacteria 1451
155 Ga0207688_10225277 3300025901 Bacteria 1131
156 Ga0207699_10101514 3300025906 Bacteria 1826
157 Ga0207645_10063343 3300025907 Bacteria 2363
158 Ga0207643_10000114 3300025908 Bacteria 55362
159 Ga0207643_10656868 3300025908 Bacteria 677
160 Ga0207705_10003470 3300025909 Bacteria 11989
161 Ga0207705_11239348 3300025909 Unclassified 571
162 Ga0207684_11206041 3300025910 Bacteria 626
163 Ga0207654_10002864 3300025911 Bacteria 8750
164 Ga0207707_10240465 3300025912 Bacteria 1574
165 Ga0207695_10183749 3300025913 Bacteria 2011
166 Ga0207671_10026253 3300025914 Bacteria 4367
167 Ga0207693_10150930 3300025915 Bacteria 1828
168 Ga0207663_10066347 3300025916 Bacteria 2310
169 Ga0207663_10166058 3300025916 Bacteria 1563
170 Ga0207660_10015589 3300025917 Bacteria 5018
171 Ga0207662_10044271 3300025918 Bacteria 2628
172 Ga0207657_10035562 3300025919 Bacteria 4465
173 Ga0207649_10001877 3300025920 Bacteria 11995
174 Ga0207652_10026867 3300025921 Bacteria 4796
175 Ga0207681_10793061 3300025923 Bacteria 791
176 Ga0207694_10212925 3300025924 Bacteria 1575
177 Ga0207694_10363681 3300025924 Bacteria 1199
178 Ga0207650_10001262 3300025925 Bacteria 18374
179 Ga0207659_10094700 3300025926 Bacteria 2238
180 Ga0207687_10063332 3300025927 Bacteria 2618
181 Ga0207687_10282064 3300025927 Bacteria 1332
182 Ga0207664_10130584 3300025929 Bacteria 2114
183 Ga0207664_10676715 3300025929 Bacteria 928
184 Ga0207644_10004501 3300025931 Bacteria 9054
185 Ga0207690_10349839 3300025932 Bacteria 1168
186 Ga0207706_10097364 3300025933 Bacteria 2588
187 Ga0207709_11248733 3300025935 Bacteria 613
188 Ga0207670_10016051 3300025936 Bacteria 4491
189 Ga0207704_10696387 3300025938 Bacteria 841
190 Ga0207691_10170387 3300025940 Bacteria 1907
191 Ga0207711_10760985 3300025941 Bacteria 903
192 Ga0207689_10012386 3300025942 Bacteria 7295
193 Ga0207661_10006863 3300025944 Bacteria 8072
194 Ga0207679_10003869 3300025945 Bacteria 9282
195 Ga0207667_10363220 3300025949 Bacteria 1476
196 Ga0207651_10094141 3300025960 Bacteria 2202
197 Ga0207651_11258271 3300025960 Bacteria 665
198 Ga0207668_11390084 3300025972 Bacteria 633
199 Ga0207640_10534632 3300025981 Bacteria 982
200 Ga0207658_10839157 3300025986 Bacteria 835
201 Ga0207677_10041012 3300026023 Bacteria 3057
202 Ga0207703_10004338 3300026035 Bacteria 11655
203 Ga0207639_10101340 3300026041 Bacteria 2328
204 Ga0207678_10000465 3300026067 Bacteria 36723
205 Ga0207708_10050037 3300026075 Bacteria 3182
206 Ga0207708_11961122 3300026075 Bacteria 513
207 Ga0207702_10002305 3300026078 Bacteria 18271
208 Ga0207702_10009123 3300026078 Bacteria 8351
209 Ga0207641_10001987 3300026088 Bacteria 19523
210 Ga0207641_10348351 3300026088 Bacteria 1411
211 Ga0207648_10180653 3300026089 Bacteria 1867
212 Ga0207676_10031882 3300026095 Bacteria 3965
213 Ga0207674_10033615 3300026116 Bacteria 5367
214 Ga0207675_100329712 3300026118 Bacteria 1492
215 Ga0207683_10001200 3300026121 Bacteria 23463
216 Ga0207698_10005017 3300026142 Bacteria 8121
217 Ga0207428_10031313 3300027907 Bacteria 4391
218 Ga0207428_10549980 3300027907 Bacteria 835
219 Ga0268266_10061215 3300028379 Bacteria 3246
220 Ga0268265_11147531 3300028380 Bacteria 773
221 Ga0268264_10136391 3300028381 Bacteria 2182
222 Ga0265334_10148501 3300028573 Bacteria 828
223 Ga0265338_10025363 3300028800 Bacteria 6019
224 Ga0265338_10035111 3300028800 Bacteria 4828
225 Ga0265338_10058647 3300028800 Bacteria 3396
226 Ga0265338_10170579 3300028800 Bacteria 1669
227 Ga0265338_10576990 3300028800 Bacteria 785
228 Ga0265320_10272852 3300031240 Bacteria 749
229 Ga0265325_10003154 3300031241 Bacteria 10852
230 Ga0265325_10034692 3300031241 Bacteria 2683
231 Ga0265340_10101501 3300031247 Bacteria 1336
232 Ga0265340_10433840 3300031247 Bacteria 579
233 Ga0265339_10130084 3300031249 Bacteria 1288
234 Ga0265316_10207562 3300031344 Bacteria 1450
235 Ga0265316_10254886 3300031344 Bacteria 1287
236 Ga0265316_10379811 3300031344 Bacteria 1019
237 Ga0307408_100077442 3300031548 Bacteria 2476
238 Ga0265313_10064778 3300031595 Bacteria 1699
239 Ga0265314_10101554 3300031711 Bacteria 1848
240 Ga0265342_10042728 3300031712 Bacteria 2737
241 Ga0307405_10200819 3300031731 Bacteria 1448
242 Ga0307413_10686744 3300031824 Bacteria 849
243 Ga0307413_10899267 3300031824 Bacteria 752
244 Ga0307410_10402518 3300031852 Bacteria 1106
245 Ga0307410_11710632 3300031852 Bacteria 557
246 Ga0307406_10662205 3300031901 Bacteria 868
247 Ga0307412_10367652 3300031911 Bacteria 1160
248 Ga0307412_10793741 3300031911 Bacteria 821
249 Ga0307409_101818743 3300031995 Bacteria 638
250 Ga0307409_101979021 3300031995 Bacteria 612
251 Ga0307416_100072023 3300032002 Bacteria 2874
252 Ga0307416_101806917 3300032002 Bacteria 715
253 Ga0307414_10112496 3300032004 Bacteria 2076
254 Ga0307415_100018397 3300032126 Bacteria 4219
255 Ga0373923_0497976 3300035111 Bacteria 594
256 Ga0373927_0218498 3300035695 Bacteria 1252
257 Ga0373933_0008229 3300035724 Bacteria 5691
258 Ga0373937_0460253 3300036401 Bacteria 1208
259 Ga0373925_0008470 3300037068 Bacteria 7495
260 Ga0373925_0732283 3300037068 Bacteria 815
261 Ga0395899_0782823 3300037312 Bacteria 591
262 Ga0395898_1739232 3300037466 Bacteria 546
263 Ga0436364_0085232 3300037853 Bacteria 586
264 Ga0436364_0203116 3300037853 Bacteria 556
265 Ga0436365_0362213 3300039437 Unclassified 1618
266 Ga0436360_1130024 3300039438 Bacteria 762
267 Ga0436360_1250989 3300039438 Bacteria 1196
268 Ga0436361_1120603 3300039447 Bacteria 595
269 Ga0436362_0287276 3300039453 Bacteria 780
270 Ga0439448_0017265 3300042005 Bacteria 2203
271 Ga0439450_019895 3300042008 Bacteria 1427
272 Ga0439463_015387 3300042016 Bacteria 1893
273 Ga0450914_011867 3300042118 Bacteria 864
274 Ga0439459_0018223 3300042438 Bacteria 1317
275 Ga0439464_0089537 3300042439 Bacteria 926
276 Ga0439440_0152769 3300042993 Bacteria 662
277 Ga0466963_0033120 3300044694 Bacteria 3352
278 Ga0466964_0064496 3300044706 Bacteria 1532
279 Ga0453684_0016307 3300044712 Bacteria 11633
280 Ga0466958_0212115 3300045836 Bacteria 1234
281 Ga0466958_0783172 3300045836 Bacteria 622
282 Ga0466967_0037691 3300045976 Bacteria 4140
283 Ga0466967_1111909 3300045976 Bacteria 787
284 Ga0495639_0065676 3300046475 Bacteria 1669
285 Ga0495594_0118904 3300046499 Bacteria 1493
286 Ga0495640_0128199 3300046533 Bacteria 1644
287 Ga0495635_0004319 3300046663 Bacteria 9840
288 Ga0495657_0052573 3300046675 Bacteria 2730
289 Ga0495613_0991947 3300046689 Bacteria 540
290 Ga0495624_0044394 3300046690 Bacteria 2833
291 Ga0495674_0978809 3300047319 Bacteria 649
292 Ga0495680_0009820 3300047322 Bacteria 8582
293 Ga0495684_0792932 3300047471 Bacteria 620
294 Ga0495614_0062911 3300048089 Bacteria 1595
295 Ga0496102_0036334 3300048905 Bacteria 4437
296 Ga0496103_0139097 3300048906 Bacteria 1552
297 Ga0496104_0016063 3300048907 Bacteria 6794
298 Ga0496105_0008588 3300048908 Bacteria 7937
299 Ga0496106_0006521 3300048909 Bacteria 8637
300 Ga0496108_0007131 3300048911 Bacteria 9056
301 Ga0496108_0081068 3300048911 Bacteria 2750
302 Ga0496109_0265955 3300048912 Bacteria 1615
303 Ga0496110_0006045 3300048913 Bacteria 9540
304 Ga0496110_0259965 3300048913 Bacteria 1580
305 Ga0496110_1438594 3300048913 Bacteria 599
306 Ga0496111_0010434 3300048914 Bacteria 6233
307 Ga0496111_0629998 3300048914 Bacteria 784
308 Ga0496112_0108625 3300048915 Bacteria 2744
309 Ga0496112_1106836 3300048915 Bacteria 710
310 Ga0496112_1809494 3300048915 Bacteria 523
311 Ga0496113_0313656 3300048916 Bacteria 1256
312 Ga0496114_0644177 3300048917 Bacteria 932
313 Ga0496114_1279615 3300048917 Unclassified 620
314 Ga0496115_0073287 3300048918 Bacteria 2779
315 Ga0501309_088581 3300049129 Bacteria 526
316 Ga0501307_069170 3300049162 Bacteria 560
317 Ga0501325_004286 3300049541 Bacteria 1085
318 Ga0501032_0220048 3300049569 Bacteria 1236
319 Ga0501047_1028850 3300049581 Bacteria 637
320 Ga0501048_1116823 3300049582 Bacteria 567
321 Ga0501067_0027474 3300049583 Bacteria 3153
322 Ga0501072_0715242 3300049588 Bacteria 787
323 Ga0501075_0214054 3300049591 Bacteria 1470
324 Ga0501216_186187 3300049660 Bacteria 508
325 Ga0501217_262138 3300049661 Bacteria 560
326 Ga0501044_1325539 3300049823 Bacteria 586
327 nmdc:mga0k408_348038_c1 3300050493 Unclassified 883
328 nmdc:mga05p37_376010_c1 3300050507 Bacteria 1666
329 nmdc:mga09592_126843_c1 3300050508 Bacteria 2194
330 nmdc:mga0qj67_256308_c1 3300050509 Bacteria 1419
331 nmdc:mga06r32_473136_c1 3300050510 Bacteria 1231
332 nmdc:mga06r32_987339_c1 3300050510 Bacteria 795
333 nmdc:mga08y16_1297931_c1 3300050511 Bacteria 695
334 nmdc:mga08y16_134648_c1 3300050511 Bacteria 2568
335 nmdc:mga08y16_155759_c1 3300050511 Bacteria 2374
336 nmdc:mga08y16_518973_c1 3300050511 Bacteria 1208
337 nmdc:mga0n895_2016238_c1 3300050512 Bacteria 535
338 nmdc:mga0n895_471476_c1 3300050512 Bacteria 1266
339 nmdc:mga0n895_9719_c1 3300050512 Bacteria 8436
340 nmdc:mga0rr50_449998_c2 3300050513 Bacteria 740
341 nmdc:mga0rr50_809_c1 3300050513 Bacteria 16823
342 nmdc:mga08x19_677184_c1 3300050514 Bacteria 732
343 nmdc:mga0a205_3723_c1 3300050515 Bacteria 13652
344 Ga0495619_0058624 3300053085 Bacteria 2556
345 Ga0530510_0680011 3300061734 Bacteria 784
346 Ga0070710_10354872
347 JGI24751J29686_10002670
348 rootL2_10002808
349 Ga0070658_10070831
350 Ga0070676_10474124
351 Ga0070690_100289141
352 Ga0070670_100060777
353 Ga0070677_10639527
354 Ga0068869_100001843
355 Ga0068869_101923384
356 Ga0070666_10975389
357 Ga0070680_100005607
358 Ga0070682_100003336
359 Ga0070682_101396018
360 Ga0068868_100020520
361 Ga0070660_101173883
362 Ga0070689_100034187
363 Ga0070689_100105798
364 Ga0070691_10002131
365 Ga0070687_100390056
366 Ga0070661_100042326
367 Ga0070661_100224729
368 Ga0070692_10039327
369 Ga0070675_100128750
370 Ga0070675_100198407
371 Ga0070671_100021698
372 Ga0070674_100917310
373 Ga0070673_100136755
374 Ga0070673_100445036
375 Ga0070688_100287766
376 Ga0070659_100119026
377 Ga0070659_100208610
378 Ga0070709_10006165
379 Ga0070714_100144925
380 Ga0070713_100002127
381 Ga0070710_10159151
382 Ga0070710_10242999
383 Ga0070701_10036467
384 Ga0070711_100151936
385 Ga0070705_100524154
386 Ga0070700_100026248
387 Ga0070700_101220728
388 Ga0070708_100229070
389 Ga0070663_100005899
390 Ga0070678_100020034
391 Ga0070662_101589376
392 Ga0070681_10207384
393 Ga0070685_10010554
394 Ga0070706_100413594
395 Ga0070699_100188298
396 Ga0070679_100040169
397 Ga0070679_100436351
398 Ga0070684_101996237
399 Ga0070697_100064981
400 Ga0068853_100110316
401 Ga0070672_100346282
402 Ga0070686_100788755
403 Ga0070693_100001983
404 Ga0070665_100078568
405 Ga0068855_100283826
406 Ga0068854_100253656
407 Ga0068856_100228915
408 Ga0068856_102159063
409 Ga0070702_100001772
410 Ga0068859_100072875
411 Ga0068859_100200023
412 Ga0068866_10276674
413 Ga0068861_100172240
414 Ga0068870_10019195
415 Ga0068870_10309233
416 Ga0068863_100010322
417 Ga0068858_100052241
418 Ga0068860_100141512
419 Ga0068862_100195958
420 Ga0070717_10651475
421 Ga0075432_10026023
422 Ga0070716_100485518
423 Ga0070712_100241611
424 Ga0070712_100268187
425 Ga0075366_10885206
426 Ga0097621_100014941
427 Ga0097621_100239375
428 Ga0068871_101187984
429 Ga0075428_100118397
430 Ga0075431_101272368
431 Ga0075431_101835346
432 Ga0075433_10021822
433 Ga0075434_100001870
434 Ga0075434_100629378
435 Ga0075434_102353269
436 Ga0075429_100078205
437 Ga0068865_100633774
438 Ga0075436_100392587
439 Ga0075436_101459416
440 Ga0097620_100072876
441 Ga0097620_100200012
442 Ga0075435_100001237
443 Ga0075435_101466683
444 Ga0105251_10050662
445 Ga0105244_10295675
446 Ga0105240_10725301
447 Ga0111539_10144676
448 Ga0111539_10314641
449 Ga0111539_10355777
450 Ga0111539_12070179
451 Ga0111539_12227769
452 Ga0105245_10100034
453 Ga0105245_11269996
454 Ga0105247_10018711
455 Ga0114129_10092839
456 Ga0105243_10527599
457 Ga0105241_10062381
458 Ga0105241_10452829
459 Ga0105242_11743657
460 Ga0105248_10050146
461 Ga0105237_10368759
462 Ga0105238_10140356
463 Ga0105238_10141939
464 Ga0105032_105790
465 Ga0105239_10221769
466 Ga0105246_10056635
467 Ga0157321_1003186
468 Ga0157373_10243231
469 Ga0157371_10080140
470 Ga0157370_10023425
471 Ga0157370_10413667
472 Ga0157370_10896434
473 Ga0157374_10028810
474 Ga0157378_11120657
475 Ga0157378_11719918
476 Ga0163162_10849026
477 Ga0157372_10085962
478 Ga0157372_10247862
479 Ga0157372_10412263
480 Ga0157375_10186851
481 Ga0157375_11976815
482 Ga0163163_11514310
483 Ga0157377_10011423
484 Ga0157379_10028170
485 Ga0157376_10090316
486 Ga0157376_10223176
487 Ga0197907_10992985
488 Ga0206356_11791668
489 Ga0206354_11210034
490 Ga0206353_11964563
491 Ga0213876_10417829
492 Ga0213875_10567967
493 Ga0224712_10007494
494 Ga0207656_10025625
495 Ga0207713_1063453
496 Ga0207682_10471230
497 Ga0207692_10301599
498 Ga0207642_10102748
499 Ga0207710_10087857
500 Ga0207688_10225277
501 Ga0207699_10101514
502 Ga0207645_10063343
503 Ga0207643_10000114
504 Ga0207643_10656868
505 Ga0207705_10003470
506 Ga0207705_11239348
507 Ga0207684_11206041
508 Ga0207654_10002864
509 Ga0207707_10240465
510 Ga0207695_10183749
511 Ga0207671_10026253
512 Ga0207693_10150930
513 Ga0207663_10066347
514 Ga0207663_10166058
515 Ga0207660_10015589
516 Ga0207662_10044271
517 Ga0207657_10035562
518 Ga0207649_10001877
519 Ga0207652_10026867
520 Ga0207681_10793061
521 Ga0207694_10212925
522 Ga0207694_10363681
523 Ga0207650_10001262
524 Ga0207659_10094700
525 Ga0207687_10063332
526 Ga0207687_10282064
527 Ga0207664_10130584
528 Ga0207664_10676715
529 Ga0207644_10004501
530 Ga0207690_10349839
531 Ga0207706_10097364
532 Ga0207709_11248733
533 Ga0207670_10016051
534 Ga0207704_10696387
535 Ga0207691_10170387
536 Ga0207711_10760985
537 Ga0207689_10012386
538 Ga0207661_10006863
539 Ga0207679_10003869
540 Ga0207667_10363220
541 Ga0207651_10094141
542 Ga0207651_11258271
543 Ga0207668_11390084
544 Ga0207640_10534632
545 Ga0207658_10839157
546 Ga0207677_10041012
547 Ga0207703_10004338
548 Ga0207639_10101340
549 Ga0207678_10000465
550 Ga0207708_10050037
551 Ga0207708_11961122
552 Ga0207702_10002305
553 Ga0207702_10009123
554 Ga0207641_10001987
555 Ga0207641_10348351
556 Ga0207648_10180653
557 Ga0207676_10031882
558 Ga0207674_10033615
559 Ga0207675_100329712
560 Ga0207683_10001200
561 Ga0207698_10005017
562 Ga0207428_10031313
563 Ga0207428_10549980
564 Ga0268266_10061215
565 Ga0268265_11147531
566 Ga0268264_10136391
567 Ga0265334_10148501
568 Ga0265338_10025363
569 Ga0265338_10035111
570 Ga0265338_10058647
571 Ga0265338_10170579
572 Ga0265338_10576990
573 Ga0265320_10272852
574 Ga0265325_10003154
575 Ga0265325_10034692
576 Ga0265340_10101501
577 Ga0265340_10433840
578 Ga0265339_10130084
579 Ga0265316_10207562
580 Ga0265316_10254886
581 Ga0265316_10379811
582 Ga0307408_100077442
583 Ga0265313_10064778
584 Ga0265314_10101554
585 Ga0265342_10042728
586 Ga0307405_10200819
587 Ga0307413_10686744
588 Ga0307413_10899267
589 Ga0307410_10402518
590 Ga0307410_11710632
591 Ga0307406_10662205
592 Ga0307412_10367652
593 Ga0307412_10793741
594 Ga0307409_101818743
595 Ga0307409_101979021
596 Ga0307416_100072023
597 Ga0307416_101806917
598 Ga0307414_10112496
599 Ga0307415_100018397
600 Ga0373923_0497976
601 Ga0373927_0218498
602 Ga0373933_0008229
603 Ga0373937_0460253
604 Ga0373925_0008470
605 Ga0373925_0732283
606 Ga0395899_0782823
607 Ga0395898_1739232
608 Ga0436364_0085232
609 Ga0436364_0203116
610 Ga0436365_0362213
611 Ga0436360_1130024
612 Ga0436360_1250989
613 Ga0436361_1120603
614 Ga0436362_0287276
615 Ga0439448_0017265
616 Ga0439450_019895
617 Ga0439463_015387
618 Ga0450914_011867
619 Ga0439459_0018223
620 Ga0439464_0089537
621 Ga0439440_0152769
622 Ga0466963_0033120
623 Ga0466964_0064496
624 Ga0453684_0016307
625 Ga0466958_0212115
626 Ga0466958_0783172
627 Ga0466967_0037691
628 Ga0466967_1111909
629 Ga0495639_0065676
630 Ga0495594_0118904
631 Ga0495640_0128199
632 Ga0495635_0004319
633 Ga0495657_0052573
634 Ga0495613_0991947
635 Ga0495624_0044394
636 Ga0495674_0978809
637 Ga0495680_0009820
638 Ga0495684_0792932
639 Ga0495614_0062911
640 Ga0496102_0036334
641 Ga0496103_0139097
642 Ga0496104_0016063
643 Ga0496105_0008588
644 Ga0496106_0006521
645 Ga0496108_0007131
646 Ga0496108_0081068
647 Ga0496109_0265955
648 Ga0496110_0006045
649 Ga0496110_0259965
650 Ga0496110_1438594
651 Ga0496111_0010434
652 Ga0496111_0629998
653 Ga0496112_0108625
654 Ga0496112_1106836
655 Ga0496112_1809494
656 Ga0496113_0313656
657 Ga0496114_0644177
658 Ga0496114_1279615
659 Ga0496115_0073287
660 Ga0501309_088581
661 Ga0501307_069170
662 Ga0501325_004286
663 Ga0501032_0220048
664 Ga0501047_1028850
665 Ga0501048_1116823
666 Ga0501067_0027474
667 Ga0501072_0715242
668 Ga0501075_0214054
669 Ga0501216_186187
670 Ga0501217_262138
671 Ga0501044_1325539
672 nmdc:mga0k408_348038_c1
673 nmdc:mga05p37_376010_c1
674 nmdc:mga09592_126843_c1
675 nmdc:mga0qj67_256308_c1
676 nmdc:mga06r32_473136_c1
677 nmdc:mga06r32_987339_c1
678 nmdc:mga08y16_1297931_c1
679 nmdc:mga08y16_134648_c1
680 nmdc:mga08y16_155759_c1
681 nmdc:mga08y16_518973_c1
682 nmdc:mga0n895_2016238_c1
683 nmdc:mga0n895_471476_c1
684 nmdc:mga0n895_9719_c1
685 nmdc:mga0rr50_449998_c2
686 nmdc:mga0rr50_809_c1
687 nmdc:mga08x19_677184_c1
688 nmdc:mga0a205_3723_c1
689 Ga0495619_0058624
690 Ga0530510_0680011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8755 5 96
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8217 5 96
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8132 6 103
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.7983 8 96
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.7973 6 103
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8755 5 96 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8216 5 96 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7983 8 96 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7652 5 103 3.10.20.30
1vjkA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7619 5 96 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9884 4 98
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9789 4 90
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.978 7 89
AF-A0A3N5W3B6-F1-model_v4 MoaD/ThiS family protein 0.9665 7 72
AF-A0A2M8Q7R1-F1-model_v4 MoaD/ThiS family protein 0.9631 7 64

Map