F416190

General Info

Members Datasets Scaffolds Average Seq Length
344 232 688 366

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946072368|2946077737
Length 388
Sequence STPEPGTPGEAGTTSGAADRSGPDGRGGQEGWRGPRHRKQRAGRRKGLLIAAWSAAGVLVLGGTGAGYLYFELNGNIKSVDIDQALGTARPTKVDNGSENILVLGSDTRSGTNKKLGGGADDGSARSDTAMVVHVYEGHKRASVVSIPRDTLVDRPACTDTKGVTHDAASDVMFNSAYSTGGAACAVKTVEAISGIRMDHYLEVDFAGFEKLIDELGGVEITTTKAIDDPDSHLKLDAGTHTLTGDQALGLVRTRHGVGDGSDLGRIQLQQAFVKALVDQVKHVGLLTGGTRLYDLADTATKAVTTDSDLGSLNSLMSFASGLQGIGAADMTMVTMPVQYDPSNLNRVLVSEAKAEQVWTALRNDRPVPKAATEGNASGEAAGVVASS

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
25 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
28 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
29 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
30 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
34 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
35 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
41 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
42 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
43 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
44 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
45 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
46 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
47 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
48 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
49 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
50 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
51 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
52 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
53 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
54 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
115 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
148 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
149 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
154 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
155 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
156 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
157 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
158 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
159 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
160 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
161 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
162 2643221548 Streptomyces sp. Root55 Isolate Unclassified
163 2643221578 Streptomyces sp. Root63 Isolate Unclassified
164 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
165 2643221647 Streptomyces sp. Root369 Isolate Unclassified
166 2643221670 Streptomyces sp. Root431 Isolate Unclassified
167 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
168 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
169 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
170 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
171 2643221714 Streptomyces sp. Root264 Isolate Unclassified
172 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
173 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
174 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
175 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
176 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
177 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
178 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
179 2808606448 Streptomyces sp. 193411 Isolate Unclassified
180 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
181 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
182 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
183 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
184 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
185 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
186 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
187 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
188 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
189 2862574272 Streptomyces sp. AcE210 Isolate Nodule
190 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
191 2867428634 Streptomyces sp. RP5T Isolate Unclassified
192 2867475112 Streptomyces sp. TM32 Isolate Unclassified
193 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
194 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
195 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
196 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
197 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
198 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
199 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
200 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
201 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
202 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
203 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
204 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
205 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
206 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
207 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
208 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
209 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
210 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
211 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
212 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
213 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
214 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
215 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
216 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
217 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
218 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
219 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
220 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
221 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
222 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
223 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
224 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
225 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
226 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
227 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
228 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
229 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
230 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
231 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
232 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.87
Metatranscriptomes 0.29
Isolates 23.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 2.03
Rhizoplane 0.29
Rhizosphere 77.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005583 3300001989 Bacteria 4770
2 JGI24737J22298_10005506 3300001990 Bacteria 4369
3 rootH1_10030130 3300003316 Bacteria 2006
4 rootH1_10030131 3300003316 Bacteria 2166
5 rootH2_10153437 3300003320 Bacteria 1822
6 rootL2_10023807 3300003322 Bacteria 2298
7 rootH1_10135036 3300003323 Bacteria 1876
8 JGI25160J50197_1012892 3300003354 Bacteria 2876
9 Ga0006562J51391_1054525 3300003578 Bacteria 2460
10 Ga0068853_100348003 3300005539 Bacteria 1378
11 Ga0081455_10009187 3300005937 Bacteria 10189
12 Ga0075367_10000321 3300006178 Bacteria 16931
13 Ga0099826_10028878 3300006948 Bacteria 4049
14 Ga0105239_10472470 3300010375 Bacteria 1424
15 Ga0105246_10019425 3300011119 Bacteria 4342
16 Ga0157369_10183441 3300013105 Bacteria 2201
17 Ga0182008_10000936 3300014497 Bacteria 20326
18 Ga0182006_1015910 3300015261 Bacteria 3216
19 Ga0182007_10002331 3300015262 Bacteria 9530
20 Ga0183367_1002 3300015688 Bacteria 1101531
21 Ga0209758_1001875 3300025297 Bacteria 23033
22 Ga0207426_1003290 3300025302 Bacteria 8998
23 Ga0207426_1018164 3300025302 Bacteria 2482
24 Ga0207647_10001930 3300025904 Bacteria 15848
25 Ga0207639_10274612 3300026041 Bacteria 1480
26 Ga0209282_1050186 3300027666 Bacteria 2401
27 Ga0307517_10003529 3300028786 Bacteria 24302
28 Ga0307515_10014631 3300028794 Bacteria 14524
29 Ga0268256_1020697 3300030500 Bacteria 1768
30 Ga0307511_10028636 3300030521 Bacteria 5050
31 Ga0307511_10042316 3300030521 Bacteria 3828
32 Ga0307511_10074482 3300030521 Bacteria 2446
33 Ga0307512_10002661 3300030522 Bacteria 22042
34 Ga0307512_10122584 3300030522 Bacteria 1663
35 Ga0307513_10019853 3300031456 Bacteria 7986
36 Ga0307508_10043883 3300031616 Bacteria 4003
37 Ga0307508_10104993 3300031616 Bacteria 2422
38 Ga0307508_10106496 3300031616 Bacteria 2402
39 Ga0307514_10053006 3300031649 Bacteria 3132
40 Ga0307514_10109878 3300031649 Bacteria 1956
41 Ga0307514_10169498 3300031649 Bacteria 1429
42 Ga0307518_10034689 3300031838 Bacteria 3663
43 Ga0307507_10044409 3300033179 Bacteria 4393
44 Ga0307510_10030925 3300033180 Bacteria 6060
45 Ga0307510_10072490 3300033180 Bacteria 3421
46 Ga0395900_0035086 3300037418 Bacteria 5167
47 Ga0395898_0003850 3300037466 Bacteria 16607
48 Ga0395898_0008215 3300037466 Bacteria 11037
49 Ga0395898_0044623 3300037466 Bacteria 4361
50 Ga0395905_0077895 3300037471 Bacteria 3106
51 Ga0395901_0347495 3300038443 Bacteria 1531
52 Ga0439436_0000487 3300041404 Bacteria 10315
53 Ga0439436_0002264 3300041404 Bacteria 5763
54 Ga0451833_0299565 3300041491 Bacteria 1887
55 Ga0451853_0150950 3300041512 Bacteria 10492
56 Ga0439433_0007107 3300041999 Bacteria 2416
57 Ga0439442_001427 3300042002 Bacteria 4710
58 Ga0439455_0003006 3300042012 Bacteria 3166
59 Ga0439457_000883 3300042014 Bacteria 9046
60 Ga0439462_0001217 3300042015 Bacteria 5634
61 Ga0450894_000941 3300042131 Bacteria 4592
62 Ga0450898_000551 3300042134 Bacteria 4413
63 Ga0450903_000144 3300042138 Bacteria 15642
64 Ga0450906_000509 3300042145 Bacteria 8207
65 Ga0439458_0001018 3300042157 Bacteria 7154
66 Ga0450908_001151 3300042184 Bacteria 5127
67 Ga0466972_0005212 3300044658 Bacteria 6506
68 Ga0466972_0007341 3300044658 Bacteria 5536
69 Ga0466972_0030299 3300044658 Bacteria 2663
70 Ga0466972_0044571 3300044658 Bacteria 2151
71 Ga0466965_0014220 3300044683 Bacteria 3765
72 Ga0466966_0005431 3300044684 Bacteria 8378
73 Ga0466966_0049053 3300044684 Bacteria 2689
74 Ga0466961_0000308 3300044693 Bacteria 32406
75 Ga0466961_0041766 3300044693 Bacteria 2940
76 Ga0466963_0001216 3300044694 Bacteria 13564
77 Ga0466964_0045038 3300044706 Bacteria 1794
78 Ga0466971_0002002 3300044719 Bacteria 8632
79 Ga0466971_0092354 3300044719 Bacteria 1386
80 Ga0466970_0006047 3300044765 Bacteria 6035
81 Ga0466970_0036100 3300044765 Bacteria 2617
82 Ga0466957_0000605 3300044842 Bacteria 18193
83 Ga0466960_0047878 3300044901 Bacteria 2052
84 Ga0466959_0000486 3300045049 Bacteria 23165
85 Ga0466958_0000413 3300045836 Bacteria 17607
86 Ga0466967_0003786 3300045976 Bacteria 9991
87 Ga0495603_0004525 3300046455 Bacteria 8299
88 Ga0495603_0024520 3300046455 Bacteria 3648
89 Ga0495603_0035684 3300046455 Bacteria 2986
90 Ga0495603_0038721 3300046455 Bacteria 2858
91 Ga0495603_0166480 3300046455 Bacteria 1277
92 Ga0495629_0017969 3300046459 Bacteria 5069
93 Ga0495629_0021516 3300046459 Bacteria 4602
94 Ga0495629_0027015 3300046459 Bacteria 4076
95 Ga0495629_0039014 3300046459 Bacteria 3344
96 Ga0495629_0116891 3300046459 Bacteria 1858
97 Ga0495638_0175420 3300046460 Bacteria 1227
98 Ga0495651_0007778 3300046462 Bacteria 8199
99 Ga0495651_0157700 3300046462 Bacteria 1629
100 Ga0495580_0193732 3300046472 Bacteria 1401
101 Ga0495582_0011716 3300046473 Bacteria 4833
102 Ga0495582_0019161 3300046473 Bacteria 3744
103 Ga0495605_0001651 3300046474 Bacteria 14340
104 Ga0495639_0034014 3300046475 Bacteria 2278
105 Ga0495662_0012109 3300046476 Bacteria 4214
106 Ga0495662_0021110 3300046476 Bacteria 3149
107 Ga0495594_0009077 3300046499 Bacteria 5132
108 Ga0495594_0077682 3300046499 Bacteria 1852
109 Ga0495594_0091135 3300046499 Bacteria 1708
110 Ga0495594_0151288 3300046499 Bacteria 1317
111 Ga0495607_0046130 3300046501 Bacteria 2561
112 Ga0495583_0019689 3300046506 Bacteria 3515
113 Ga0495583_0062369 3300046506 Bacteria 1660
114 Ga0495608_0015100 3300046511 Bacteria 5358
115 Ga0495616_0014079 3300046513 Bacteria 4490
116 Ga0495620_0007475 3300046515 Bacteria 5925
117 Ga0495628_0027308 3300046516 Bacteria 4646
118 Ga0495631_0004578 3300046518 Bacteria 7339
119 Ga0495632_0098639 3300046519 Bacteria 1378
120 Ga0495642_0027051 3300046528 Bacteria 2281
121 Ga0495652_0069736 3300046529 Bacteria 2941
122 Ga0495640_0032941 3300046533 Bacteria 3686
123 Ga0495640_0038448 3300046533 Bacteria 3366
124 Ga0495587_0004186 3300046536 Bacteria 9551
125 Ga0495622_0021632 3300046557 Bacteria 2994
126 Ga0495622_0023271 3300046557 Bacteria 2887
127 Ga0495634_0002467 3300046642 Bacteria 15369
128 Ga0495634_0002771 3300046642 Bacteria 14392
129 Ga0495634_0099756 3300046642 Bacteria 1877
130 Ga0495625_0002557 3300046660 Bacteria 19548
131 Ga0495625_0206999 3300046660 Bacteria 1291
132 Ga0495635_0001012 3300046663 Bacteria 18564
133 Ga0495635_0004862 3300046663 Bacteria 9349
134 Ga0495635_0032268 3300046663 Bacteria 3634
135 Ga0495588_0001725 3300046674 Bacteria 9308
136 Ga0495588_0008618 3300046674 Bacteria 4685
137 Ga0495657_0000997 3300046675 Bacteria 24940
138 Ga0495657_0022146 3300046675 Bacteria 4555
139 Ga0495646_0005312 3300046680 Bacteria 8132
140 Ga0495613_0000571 3300046689 Bacteria 30034
141 Ga0495613_0109018 3300046689 Bacteria 1996
142 Ga0495613_0111831 3300046689 Bacteria 1967
143 Ga0495613_0232693 3300046689 Bacteria 1290
144 Ga0495670_0092481 3300046691 Bacteria 1549
145 Ga0495671_0017411 3300046692 Bacteria 3826
146 Ga0495671_0046863 3300046692 Bacteria 2161
147 Ga0495649_0084817 3300046694 Bacteria 1691
148 Ga0495589_0016963 3300046794 Bacteria 3738
149 Ga0495589_0020871 3300046794 Bacteria 3348
150 Ga0495600_0019253 3300046809 Bacteria 4357
151 Ga0495600_0061255 3300046809 Bacteria 2458
152 Ga0495581_0015484 3300047315 Bacteria 4427
153 Ga0495581_0049588 3300047315 Bacteria 2424
154 Ga0495604_0000623 3300047317 Bacteria 30451
155 Ga0495604_0069754 3300047317 Bacteria 2663
156 Ga0495604_0282988 3300047317 Bacteria 1120
157 Ga0495636_0051961 3300047318 Bacteria 1718
158 Ga0495636_0053077 3300047318 Bacteria 1701
159 Ga0495674_0211685 3300047319 Bacteria 1605
160 Ga0495676_0013591 3300047321 Bacteria 7309
161 Ga0495676_0041632 3300047321 Bacteria 3778
162 Ga0495676_0082828 3300047321 Bacteria 2426
163 Ga0495676_0084399 3300047321 Bacteria 2396
164 Ga0495676_0100176 3300047321 Bacteria 2145
165 Ga0495676_0113242 3300047321 Bacteria 1986
166 Ga0495676_0209944 3300047321 Bacteria 1347
167 Ga0495687_022709 3300047443 Bacteria 3007
168 Ga0495687_032470 3300047443 Bacteria 2381
169 Ga0495675_0053720 3300047444 Bacteria 2557
170 Ga0495685_006836 3300047447 Bacteria 3753
171 Ga0495685_007532 3300047447 Bacteria 3596
172 Ga0495685_009070 3300047447 Bacteria 3315
173 Ga0495685_009113 3300047447 Bacteria 3309
174 Ga0495681_0000926 3300047470 Bacteria 22637
175 Ga0495681_0085138 3300047470 Bacteria 1404
176 Ga0495684_0181796 3300047471 Bacteria 1558
177 Ga0495593_0006464 3300047673 Bacteria 6866
178 Ga0495602_0036652 3300048088 Bacteria 4562
179 Ga0495614_0002764 3300048089 Bacteria 7797
180 Ga0495626_0025356 3300048091 Bacteria 2901
181 Ga0496109_0044727 3300048912 Bacteria 4017
182 Ga0501031_0003389 3300049568 Bacteria 10229
183 Ga0501031_0187858 3300049568 Bacteria 1349
184 Ga0501032_0012955 3300049569 Bacteria 5940
185 Ga0501033_0005722 3300049570 Bacteria 9802
186 Ga0501033_0010056 3300049570 Bacteria 7263
187 Ga0501033_0015813 3300049570 Bacteria 5718
188 Ga0501033_0027732 3300049570 Bacteria 4257
189 Ga0501033_0194225 3300049570 Bacteria 1452
190 Ga0501034_0003253 3300049571 Bacteria 18575
191 Ga0501034_0031253 3300049571 Bacteria 5409
192 Ga0501034_0052466 3300049571 Bacteria 4108
193 Ga0501034_0100962 3300049571 Bacteria 2879
194 Ga0501034_0174163 3300049571 Bacteria 2118
195 Ga0501034_0262770 3300049571 Bacteria 1669
196 Ga0501034_0269809 3300049571 Bacteria 1643
197 Ga0501036_0055929 3300049572 Bacteria 3342
198 Ga0501036_0067784 3300049572 Bacteria 3019
199 Ga0501036_0083301 3300049572 Bacteria 2703
200 Ga0501036_0138116 3300049572 Bacteria 2057
201 Ga0501036_0146258 3300049572 Bacteria 1993
202 Ga0501036_0181199 3300049572 Bacteria 1773
203 Ga0501037_0001515 3300049573 Bacteria 16967
204 Ga0501037_0115229 3300049573 Bacteria 1934
205 Ga0501037_0136179 3300049573 Bacteria 1759
206 Ga0501038_0006047 3300049574 Bacteria 11201
207 Ga0501038_0023161 3300049574 Bacteria 5556
208 Ga0501039_0029109 3300049575 Bacteria 4253
209 Ga0501039_0188542 3300049575 Bacteria 1622
210 Ga0501039_0259827 3300049575 Bacteria 1365
211 Ga0501040_0032561 3300049576 Bacteria 3527
212 Ga0501042_0078593 3300049578 Bacteria 2363
213 Ga0501042_0103546 3300049578 Bacteria 2048
214 Ga0501043_0001919 3300049579 Bacteria 17802
215 Ga0501043_0099706 3300049579 Bacteria 2283
216 Ga0501043_0152600 3300049579 Bacteria 1807
217 Ga0501043_0176868 3300049579 Bacteria 1663
218 Ga0501046_0038225 3300049580 Bacteria 3854
219 Ga0501046_0091787 3300049580 Bacteria 2335
220 Ga0501046_0191680 3300049580 Bacteria 1524
221 Ga0501047_0002638 3300049581 Bacteria 17064
222 Ga0501047_0011176 3300049581 Bacteria 8495
223 Ga0501047_0098562 3300049581 Bacteria 2801
224 Ga0501047_0162680 3300049581 Bacteria 2103
225 Ga0501047_0245354 3300049581 Bacteria 1640
226 Ga0501047_0304632 3300049581 Bacteria 1435
227 Ga0501048_0196797 3300049582 Bacteria 1429
228 Ga0501067_0006408 3300049583 Bacteria 6519
229 Ga0501068_0001150 3300049584 Bacteria 14024
230 Ga0501069_0138254 3300049585 Bacteria 1397
231 Ga0501070_0000119 3300049586 Bacteria 70355
232 Ga0501071_0001359 3300049587 Bacteria 14008
233 Ga0501072_0020393 3300049588 Bacteria 5135
234 Ga0501073_0017216 3300049589 Bacteria 5235
235 Ga0501074_0001283 3300049590 Bacteria 16635
236 Ga0501074_0005339 3300049590 Bacteria 9237
237 Ga0501077_0122403 3300049593 Bacteria 1649
238 Ga0501079_0001004 3300049741 Bacteria 19523
239 Ga0501080_0020347 3300049742 Bacteria 6141
240 Ga0501083_0002036 3300049744 Bacteria 13915
241 Ga0501035_0007390 3300049822 Bacteria 10270
242 Ga0501035_0011307 3300049822 Bacteria 8272
243 Ga0501035_0027159 3300049822 Bacteria 5233
244 Ga0501035_0032714 3300049822 Bacteria 4730
245 Ga0501035_0136819 3300049822 Bacteria 2132
246 Ga0501044_0009949 3300049823 Bacteria 10331
247 Ga0501044_0027468 3300049823 Bacteria 6014
248 Ga0501044_0039748 3300049823 Bacteria 4905
249 Ga0501044_0155708 3300049823 Bacteria 2265
250 Ga0501044_0165054 3300049823 Bacteria 2189
251 Ga0501044_0187400 3300049823 Bacteria 2033
252 Ga0501044_0213605 3300049823 Bacteria 1882
253 nmdc:mga06z11_2838_c1 3300050494 Bacteria 6647
254 nmdc:mga04h51_26220_c1 3300050495 Bacteria 1800
255 Ga0500610_0016110 3300053079 Bacteria 3556
256 Ga0500640_038855 3300053095 Bacteria 2091
257 Ga0500573_0057556 3300053140 Bacteria 2230
258 Ga0501084_0025772 3300054114 Bacteria 4903
259 Ga0501082_0151489 3300060353 Bacteria 2014
260 Ga0466962_0000418 3300061719 Bacteria 18353
261 Ga0466962_0029506 3300061719 Bacteria 2626
262 Ga0530510_0053229 3300061734 Bacteria 2925
263 2946077737 2946072368 Bacteria 8999607
264 2547408421 2547132111 Bacteria 8013147
265 2554256252 2554235005 Bacteria 6457341
266 2585296587 2582581312 Bacteria 7308206
267 2585309028 2582581313 Bacteria 10042643
268 2585319218 2582581314 Bacteria 11452267
269 2616697272 2616644814 Bacteria 11555299
270 2616899937 2616644941 Bacteria 8510691
271 2643763995 2643221548 Bacteria 8053412
272 2643902287 2643221578 Bacteria 9213798
273 2643943883 2643221587 Bacteria 7586415
274 2644265833 2643221647 Bacteria 10741251
275 2644386870 2643221670 Bacteria 6497041
276 2644403857 2643221673 Bacteria 9196637
277 2644434620 2643221677 Bacteria 7584031
278 2644440027 2643221678 Bacteria 9540101
279 2644461572 2643221682 Bacteria 6743283
280 2644632649 2643221714 Bacteria 9015452
281 2784590385 2784132148 Bacteria 8627943
282 2785341230 2784746763 Bacteria 9783172
283 2785371474 2784746768 Bacteria 10036182
284 2786672633 2786546132 Bacteria 10419719
285 2804847877 2802429296 Bacteria 7227771
286 2808844005 2808606359 Bacteria 9866990
287 2808913596 2808606375 Bacteria 9466072
288 2809234059 2808606448 Bacteria 8656184
289 2811844437 2808606982 Bacteria 7791042
290 2812355971 2811994879 Bacteria 9313447
291 2812478780 2811994917 Bacteria 7761064
292 2852640996 2852635781 Bacteria 8251373
293 2862186385 2862178590 Bacteria 8583590
294 2862284775 2862281513 Bacteria 9621493
295 2862291085 2862290372 Bacteria 7471434
296 2862388111 2862382967 Bacteria 10317375
297 2862512704 2862507626 Bacteria 9425308
298 2862575697 2862574272 Bacteria 10567477
299 2862577536 2862574272 Bacteria 10567477
300 2862580539 2862574272 Bacteria 10567477
301 2863408584 2863404153 Bacteria 9672205
302 2867430543 2867428634 Bacteria 9590268
303 2867481135 2867475112 Bacteria 6909112
304 2873154081 2873151551 Bacteria 8625867
305 2873158373 2873151551 Bacteria 8625867
306 2875396669 2875391855 Bacteria 7600475
307 2877679129 2877676314 Bacteria 9512378
308 2912717641 2912715099 Bacteria 9460473
309 2912730194 2912723979 Bacteria 8557534
310 2912762722 2912757875 Bacteria 7940295
311 2918506479 2918501144 Bacteria 8668083
312 2919471710 2919468124 Bacteria 9133025
313 2935395049 2935390628 Bacteria 7043367
314 2946047886 2946045630 Bacteria 8527308
315 2946069816 2946064051 Bacteria 8957905
316 2947226984 2947224130 Bacteria 9938529
317 2954005445 2954002825 Bacteria 9173742
318 2954384033 2954380949 Bacteria 10050426
319 2954678925 2954673503 Bacteria 9685905
320 2954685226 2954682443 Bacteria 9862841
321 2954694832 2954691527 Bacteria 10720516
322 2954710034 2954701450 Bacteria 10834262
323 2954714344 2954711539 Bacteria 10867210
324 2954724293 2954721474 Bacteria 10456478
325 2954737546 2954731030 Bacteria 10243860
326 2954743190 2954740390 Bacteria 10229294
327 2954756380 2954749733 Bacteria 10366972
328 2954762148 2954759201 Bacteria 9358192
329 2990062916 2990059506 Bacteria 9321252
330 2990092817 2990088156 Bacteria 6657676
331 2997452838 2997451912 Bacteria 8492419
332 3006322567 3006321560 Bacteria 8247479
333 3006393565 3006393351 Bacteria 6615579
334 3006429918 3006425503 Bacteria 6491253
335 3006491292 3006486233 Bacteria 8157040
336 3006500094 3006493962 Bacteria 8825450
337 8008562759 8008558824 Bacteria 10610750
338 8008577194 8008574985 Bacteria 7815457
339 8023627164 8023623736 Bacteria 8593882
340 8025413938 8025413630 Bacteria 7014048
341 8025531343 8025530807 Bacteria 8495698
342 8048411952 8048406513 Bacteria 8936924
343 8054163332 8054160619 Bacteria 7783213
344 8056832173 8056829672 Bacteria 9045328
345 JGI24739J22299_10005583
346 JGI24737J22298_10005506
347 rootH1_10030130
348 rootH1_10030131
349 rootH2_10153437
350 rootL2_10023807
351 rootH1_10135036
352 JGI25160J50197_1012892
353 Ga0006562J51391_1054525
354 Ga0068853_100348003
355 Ga0081455_10009187
356 Ga0075367_10000321
357 Ga0099826_10028878
358 Ga0105239_10472470
359 Ga0105246_10019425
360 Ga0157369_10183441
361 Ga0182008_10000936
362 Ga0182006_1015910
363 Ga0182007_10002331
364 Ga0183367_1002
365 Ga0209758_1001875
366 Ga0207426_1003290
367 Ga0207426_1018164
368 Ga0207647_10001930
369 Ga0207639_10274612
370 Ga0209282_1050186
371 Ga0307517_10003529
372 Ga0307515_10014631
373 Ga0268256_1020697
374 Ga0307511_10028636
375 Ga0307511_10042316
376 Ga0307511_10074482
377 Ga0307512_10002661
378 Ga0307512_10122584
379 Ga0307513_10019853
380 Ga0307508_10043883
381 Ga0307508_10104993
382 Ga0307508_10106496
383 Ga0307514_10053006
384 Ga0307514_10109878
385 Ga0307514_10169498
386 Ga0307518_10034689
387 Ga0307507_10044409
388 Ga0307510_10030925
389 Ga0307510_10072490
390 Ga0395900_0035086
391 Ga0395898_0003850
392 Ga0395898_0008215
393 Ga0395898_0044623
394 Ga0395905_0077895
395 Ga0395901_0347495
396 Ga0439436_0000487
397 Ga0439436_0002264
398 Ga0451833_0299565
399 Ga0451853_0150950
400 Ga0439433_0007107
401 Ga0439442_001427
402 Ga0439455_0003006
403 Ga0439457_000883
404 Ga0439462_0001217
405 Ga0450894_000941
406 Ga0450898_000551
407 Ga0450903_000144
408 Ga0450906_000509
409 Ga0439458_0001018
410 Ga0450908_001151
411 Ga0466972_0005212
412 Ga0466972_0007341
413 Ga0466972_0030299
414 Ga0466972_0044571
415 Ga0466965_0014220
416 Ga0466966_0005431
417 Ga0466966_0049053
418 Ga0466961_0000308
419 Ga0466961_0041766
420 Ga0466963_0001216
421 Ga0466964_0045038
422 Ga0466971_0002002
423 Ga0466971_0092354
424 Ga0466970_0006047
425 Ga0466970_0036100
426 Ga0466957_0000605
427 Ga0466960_0047878
428 Ga0466959_0000486
429 Ga0466958_0000413
430 Ga0466967_0003786
431 Ga0495603_0004525
432 Ga0495603_0024520
433 Ga0495603_0035684
434 Ga0495603_0038721
435 Ga0495603_0166480
436 Ga0495629_0017969
437 Ga0495629_0021516
438 Ga0495629_0027015
439 Ga0495629_0039014
440 Ga0495629_0116891
441 Ga0495638_0175420
442 Ga0495651_0007778
443 Ga0495651_0157700
444 Ga0495580_0193732
445 Ga0495582_0011716
446 Ga0495582_0019161
447 Ga0495605_0001651
448 Ga0495639_0034014
449 Ga0495662_0012109
450 Ga0495662_0021110
451 Ga0495594_0009077
452 Ga0495594_0077682
453 Ga0495594_0091135
454 Ga0495594_0151288
455 Ga0495607_0046130
456 Ga0495583_0019689
457 Ga0495583_0062369
458 Ga0495608_0015100
459 Ga0495616_0014079
460 Ga0495620_0007475
461 Ga0495628_0027308
462 Ga0495631_0004578
463 Ga0495632_0098639
464 Ga0495642_0027051
465 Ga0495652_0069736
466 Ga0495640_0032941
467 Ga0495640_0038448
468 Ga0495587_0004186
469 Ga0495622_0021632
470 Ga0495622_0023271
471 Ga0495634_0002467
472 Ga0495634_0002771
473 Ga0495634_0099756
474 Ga0495625_0002557
475 Ga0495625_0206999
476 Ga0495635_0001012
477 Ga0495635_0004862
478 Ga0495635_0032268
479 Ga0495588_0001725
480 Ga0495588_0008618
481 Ga0495657_0000997
482 Ga0495657_0022146
483 Ga0495646_0005312
484 Ga0495613_0000571
485 Ga0495613_0109018
486 Ga0495613_0111831
487 Ga0495613_0232693
488 Ga0495670_0092481
489 Ga0495671_0017411
490 Ga0495671_0046863
491 Ga0495649_0084817
492 Ga0495589_0016963
493 Ga0495589_0020871
494 Ga0495600_0019253
495 Ga0495600_0061255
496 Ga0495581_0015484
497 Ga0495581_0049588
498 Ga0495604_0000623
499 Ga0495604_0069754
500 Ga0495604_0282988
501 Ga0495636_0051961
502 Ga0495636_0053077
503 Ga0495674_0211685
504 Ga0495676_0013591
505 Ga0495676_0041632
506 Ga0495676_0082828
507 Ga0495676_0084399
508 Ga0495676_0100176
509 Ga0495676_0113242
510 Ga0495676_0209944
511 Ga0495687_022709
512 Ga0495687_032470
513 Ga0495675_0053720
514 Ga0495685_006836
515 Ga0495685_007532
516 Ga0495685_009070
517 Ga0495685_009113
518 Ga0495681_0000926
519 Ga0495681_0085138
520 Ga0495684_0181796
521 Ga0495593_0006464
522 Ga0495602_0036652
523 Ga0495614_0002764
524 Ga0495626_0025356
525 Ga0496109_0044727
526 Ga0501031_0003389
527 Ga0501031_0187858
528 Ga0501032_0012955
529 Ga0501033_0005722
530 Ga0501033_0010056
531 Ga0501033_0015813
532 Ga0501033_0027732
533 Ga0501033_0194225
534 Ga0501034_0003253
535 Ga0501034_0031253
536 Ga0501034_0052466
537 Ga0501034_0100962
538 Ga0501034_0174163
539 Ga0501034_0262770
540 Ga0501034_0269809
541 Ga0501036_0055929
542 Ga0501036_0067784
543 Ga0501036_0083301
544 Ga0501036_0138116
545 Ga0501036_0146258
546 Ga0501036_0181199
547 Ga0501037_0001515
548 Ga0501037_0115229
549 Ga0501037_0136179
550 Ga0501038_0006047
551 Ga0501038_0023161
552 Ga0501039_0029109
553 Ga0501039_0188542
554 Ga0501039_0259827
555 Ga0501040_0032561
556 Ga0501042_0078593
557 Ga0501042_0103546
558 Ga0501043_0001919
559 Ga0501043_0099706
560 Ga0501043_0152600
561 Ga0501043_0176868
562 Ga0501046_0038225
563 Ga0501046_0091787
564 Ga0501046_0191680
565 Ga0501047_0002638
566 Ga0501047_0011176
567 Ga0501047_0098562
568 Ga0501047_0162680
569 Ga0501047_0245354
570 Ga0501047_0304632
571 Ga0501048_0196797
572 Ga0501067_0006408
573 Ga0501068_0001150
574 Ga0501069_0138254
575 Ga0501070_0000119
576 Ga0501071_0001359
577 Ga0501072_0020393
578 Ga0501073_0017216
579 Ga0501074_0001283
580 Ga0501074_0005339
581 Ga0501077_0122403
582 Ga0501079_0001004
583 Ga0501080_0020347
584 Ga0501083_0002036
585 Ga0501035_0007390
586 Ga0501035_0011307
587 Ga0501035_0027159
588 Ga0501035_0032714
589 Ga0501035_0136819
590 Ga0501044_0009949
591 Ga0501044_0027468
592 Ga0501044_0039748
593 Ga0501044_0155708
594 Ga0501044_0165054
595 Ga0501044_0187400
596 Ga0501044_0213605
597 nmdc:mga06z11_2838_c1
598 nmdc:mga04h51_26220_c1
599 Ga0500610_0016110
600 Ga0500640_038855
601 Ga0500573_0057556
602 Ga0501084_0025772
603 Ga0501082_0151489
604 Ga0466962_0000418
605 Ga0466962_0029506
606 Ga0530510_0053229
607 2946077737
608 2547408421
609 2554256252
610 2585296587
611 2585309028
612 2585319218
613 2616697272
614 2616899937
615 2643763995
616 2643902287
617 2643943883
618 2644265833
619 2644386870
620 2644403857
621 2644434620
622 2644440027
623 2644461572
624 2644632649
625 2784590385
626 2785341230
627 2785371474
628 2786672633
629 2804847877
630 2808844005
631 2808913596
632 2809234059
633 2811844437
634 2812355971
635 2812478780
636 2852640996
637 2862186385
638 2862284775
639 2862291085
640 2862388111
641 2862512704
642 2862575697
643 2862577536
644 2862580539
645 2863408584
646 2867430543
647 2867481135
648 2873154081
649 2873158373
650 2875396669
651 2877679129
652 2912717641
653 2912730194
654 2912762722
655 2918506479
656 2919471710
657 2935395049
658 2946047886
659 2946069816
660 2947226984
661 2954005445
662 2954384033
663 2954678925
664 2954685226
665 2954694832
666 2954710034
667 2954714344
668 2954724293
669 2954737546
670 2954743190
671 2954756380
672 2954762148
673 2990062916
674 2990092817
675 2997452838
676 3006322567
677 3006393565
678 3006429918
679 3006491292
680 3006500094
681 8008562759
682 8008577194
683 8023627164
684 8025413938
685 8025531343
686 8048411952
687 8054163332
688 8056832173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03816

LytR_cpsA_psr

LytR_cpsA_psr family

126

283

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mpt-assembly1.cif.gz_A tagt bound to li-wta 0.814 57 334
3nxh-assembly1.cif.gz_A crystal structure of the transcriptional regulator yvhj from bacillus subtilis. northeast structural genomics consortium target sr735. 0.8073 63 334
4de9-assembly1.cif.gz_A lytr-cps2a-psr family protein ywtf (tagt) with bound octaprenyl pyrophosphate lipid 0.8048 57 334
6uf3-assembly1.cif.gz_A crystal structure of b. subtilis tagv 0.8022 63 334
3mej-assembly1.cif.gz_A crystal structure of putative transcriptional regulator ywtf from bacillus subtilis, northeast structural genomics consortium target sr736 0.7979 57 338
ID Description Score Start End Superfamily
af_I6WZI4_217_505_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.8098 66 330 3.40.630.190
4de9A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8015 57 334 3.30.420.590
af_Q7BHL7_76_327_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.7919 64 333 3.40.630.190
af_P96872_54_354_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.789 63 335 3.40.630.190
3nxhA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.7853 64 334 3.40.630.190
ID Description Score Start End GO Terms
AF-A0A563EQR6-F1-model_v4 LytR family transcriptional regulator 0.9345 33 331 GO:0016020
AF-A0A6G3AFL7-F1-model_v4 LytR family transcriptional regulator 0.9263 33 348
AF-A0A4D4LU13-F1-model_v4 Transcriptional regulator 0.9258 100 318
AF-A0A846RW41-F1-model_v4 LCP family protein required for cell wall assembly 0.9204 33 343 GO:0016020
AF-A0A100JH17-F1-model_v4 deleted 0.9166 32 335

Map