F416166

General Info

Members Datasets Scaffolds Average Seq Length
344 232 344 158

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_64530_c1|nmdc:mga0qj67_64530_c1_25_603
Length 192
Sequence VRARRESGAVSSVAGLPSTLKPAHDEHRIASRRSKDVHRHTARVSWLRNGAAFTDNRYSRGHQWSFDGGARIAASSSPSVVPLPYSVAEAVDPEEALVAAASSCHMLTFLYVAAKQGFVVDSYEDDAYGTMAKNAAGRIGIDRITLRPKIEFAGTKVPNVDELASLHHAAHQECFIANSVKCEITVEGVGGA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
176 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
179 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.78
Nodule 0
Rhizoplane 1.45
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006082 3300003203 Bacteria 5577
2 Ga0065714_10174651 3300005288 Unclassified 988
3 Ga0065712_10391296 3300005290 Bacteria 728
4 Ga0065715_10117355 3300005293 Bacteria 2351
5 Ga0065715_10130506 3300005293 Bacteria 2025
6 Ga0065707_10046849 3300005295 Bacteria 971
7 Ga0070676_10012209 3300005328 Bacteria 4684
8 Ga0070676_10013099 3300005328 Bacteria 4544
9 Ga0070683_100290763 3300005329 Bacteria 1554
10 Ga0070670_100002328 3300005331 Bacteria 15650
11 Ga0070670_100065883 3300005331 Bacteria 3108
12 Ga0070670_100114928 3300005331 Unclassified 2320
13 Ga0070670_100123911 3300005331 Bacteria 2230
14 Ga0070677_10002689 3300005333 Bacteria 5687
15 Ga0068869_100002258 3300005334 Bacteria 11594
16 Ga0070666_10607024 3300005335 Bacteria 799
17 Ga0070680_100000090 3300005336 Bacteria 51110
18 Ga0070682_100000162 3300005337 Bacteria 51215
19 Ga0070660_100000899 3300005339 Bacteria 19892
20 Ga0070689_100205588 3300005340 Bacteria 1609
21 Ga0070691_10010379 3300005341 Bacteria 4248
22 Ga0070691_10123284 3300005341 Bacteria 1307
23 Ga0070687_100113429 3300005343 Bacteria 1538
24 Ga0070661_100003027 3300005344 Bacteria 11561
25 Ga0070692_10000960 3300005345 Bacteria 9826
26 Ga0070669_100028890 3300005353 Bacteria 3994
27 Ga0070669_100355208 3300005353 Bacteria 1190
28 Ga0070675_100110145 3300005354 Bacteria 2328
29 Ga0070671_101350877 3300005355 Bacteria 629
30 Ga0070674_100007709 3300005356 Bacteria 6357
31 Ga0070674_100064184 3300005356 Bacteria 2572
32 Ga0070673_100004562 3300005364 Bacteria 8777
33 Ga0070673_100023151 3300005364 Bacteria 4535
34 Ga0070688_100264610 3300005365 Bacteria 1229
35 Ga0070659_100001226 3300005366 Bacteria 18631
36 Ga0070659_101303993 3300005366 Bacteria 644
37 Ga0070703_10003344 3300005406 Bacteria 4576
38 Ga0070713_101526459 3300005436 Unclassified 648
39 Ga0070701_10092057 3300005438 Bacteria 1663
40 Ga0070701_10116411 3300005438 Bacteria 1500
41 Ga0070701_10437215 3300005438 Bacteria 837
42 Ga0070701_10533386 3300005438 Bacteria 767
43 Ga0070705_100000632 3300005440 Bacteria 20239
44 Ga0070700_100029242 3300005441 Bacteria 3284
45 Ga0070700_100106841 3300005441 Bacteria 1854
46 Ga0070700_100134587 3300005441 Bacteria 1672
47 Ga0070700_100315924 3300005441 Bacteria 1146
48 Ga0070694_100000169 3300005444 Bacteria 33670
49 Ga0070694_100111001 3300005444 Bacteria 1953
50 Ga0070694_100332050 3300005444 Bacteria 1173
51 Ga0070694_100570184 3300005444 Bacteria 908
52 Ga0070663_100000723 3300005455 Bacteria 17811
53 Ga0070678_100010213 3300005456 Bacteria 5723
54 Ga0070662_100103768 3300005457 Bacteria 2156
55 Ga0070662_100214260 3300005457 Bacteria 1534
56 Ga0070681_10433131 3300005458 Bacteria 1227
57 Ga0070681_10885371 3300005458 Bacteria 811
58 Ga0070681_11295564 3300005458 Bacteria 651
59 Ga0068867_100000366 3300005459 Bacteria 30109
60 Ga0068867_100013778 3300005459 Bacteria 5725
61 Ga0068867_100180417 3300005459 Bacteria 1678
62 Ga0068867_100533577 3300005459 Unclassified 1014
63 Ga0070698_101189191 3300005471 Bacteria 712
64 Ga0070679_100030315 3300005530 Bacteria 5341
65 Ga0070684_100030739 3300005535 Bacteria 4567
66 Ga0068853_100000163 3300005539 Bacteria 45425
67 Ga0070672_100018193 3300005543 Bacteria 5074
68 Ga0070672_100061075 3300005543 Bacteria 2970
69 Ga0070672_100144637 3300005543 Bacteria 1964
70 Ga0070686_100023412 3300005544 Bacteria 3690
71 Ga0070695_100003433 3300005545 Bacteria 9258
72 Ga0070695_100116101 3300005545 Bacteria 1824
73 Ga0070696_100000864 3300005546 Bacteria 19586
74 Ga0070696_101001266 3300005546 Bacteria 698
75 Ga0070693_100000214 3300005547 Bacteria 26958
76 Ga0070665_100440518 3300005548 Bacteria 1312
77 Ga0070704_100000066 3300005549 Bacteria 34508
78 Ga0068855_100000802 3300005563 Bacteria 38912
79 Ga0068855_100784912 3300005563 Bacteria 1013
80 Ga0070664_100001574 3300005564 Bacteria 18242
81 Ga0068857_100026932 3300005577 Bacteria 5069
82 Ga0068857_100068270 3300005577 Bacteria 3164
83 Ga0068854_100001721 3300005578 Bacteria 13338
84 Ga0068856_100001017 3300005614 Bacteria 29866
85 Ga0070702_100512567 3300005615 Bacteria 883
86 Ga0068859_100000501 3300005617 Bacteria 38572
87 Ga0068859_100078586 3300005617 Bacteria 3340
88 Ga0068859_100504347 3300005617 Bacteria 1305
89 Ga0068864_100000978 3300005618 Bacteria 23978
90 Ga0068864_101280623 3300005618 Bacteria 733
91 Ga0068861_100026940 3300005719 Bacteria 4183
92 Ga0068861_100036796 3300005719 Bacteria 3635
93 Ga0068870_10000094 3300005840 Bacteria 29013
94 Ga0068863_100653194 3300005841 Bacteria 1043
95 Ga0068858_100021761 3300005842 Bacteria 5990
96 Ga0068858_100637584 3300005842 Bacteria 1035
97 Ga0068858_101095630 3300005842 Bacteria 782
98 Ga0068860_100030100 3300005843 Bacteria 5222
99 Ga0068862_100006068 3300005844 Bacteria 10060
100 Ga0068862_100841358 3300005844 Bacteria 899
101 Ga0081455_10083682 3300005937 Bacteria 2606
102 Ga0081539_10003162 3300005985 Bacteria 20881
103 Ga0081539_10227762 3300005985 Bacteria 843
104 Ga0075364_10013406 3300006051 Bacteria 5037
105 Ga0070712_100716610 3300006175 Bacteria 854
106 Ga0075362_10082660 3300006177 Bacteria 1482
107 Ga0075367_10133782 3300006178 Bacteria 1534
108 Ga0075428_100026197 3300006844 Bacteria 6457
109 Ga0075428_100035701 3300006844 Bacteria 5479
110 Ga0075428_100868108 3300006844 Bacteria 958
111 Ga0075430_100040268 3300006846 Bacteria 3956
112 Ga0075430_100415442 3300006846 Bacteria 1111
113 Ga0075431_100012643 3300006847 Bacteria 8525
114 Ga0075431_100018084 3300006847 Bacteria 7169
115 Ga0075431_100038837 3300006847 Bacteria 4904
116 Ga0075433_10528726 3300006852 Unclassified 1037
117 Ga0075434_100021977 3300006871 Bacteria 6210
118 Ga0075434_100749278 3300006871 Bacteria 994
119 Ga0075429_100028746 3300006880 Bacteria 4828
120 Ga0075429_100560795 3300006880 Bacteria 1001
121 Ga0075429_101308053 3300006880 Bacteria 632
122 Ga0068865_100041645 3300006881 Bacteria 3127
123 Ga0068865_100191632 3300006881 Bacteria 1581
124 Ga0068865_100354743 3300006881 Bacteria 1189
125 Ga0068865_100567912 3300006881 Bacteria 955
126 Ga0075436_100192668 3300006914 Bacteria 1442
127 Ga0097620_100000501 3300006931 Bacteria 38572
128 Ga0097620_100078584 3300006931 Bacteria 3340
129 Ga0097620_100504380 3300006931 Bacteria 1305
130 Ga0075435_100251249 3300007076 Bacteria 1505
131 Ga0099794_10002660 3300007265 Bacteria 6652
132 Ga0111539_10041580 3300009094 Bacteria 5525
133 Ga0111539_10393621 3300009094 Bacteria 1614
134 Ga0111539_11298840 3300009094 Bacteria 844
135 Ga0111539_11618387 3300009094 Bacteria 751
136 Ga0111539_11772589 3300009094 Bacteria 716
137 Ga0105245_12982320 3300009098 Unclassified 525
138 Ga0114129_10000586 3300009147 Bacteria 44931
139 Ga0114129_10866901 3300009147 Bacteria 1147
140 Ga0105243_10281386 3300009148 Bacteria 1498
141 Ga0105243_10461409 3300009148 Bacteria 1194
142 Ga0105241_10000522 3300009174 Bacteria 28914
143 Ga0105248_10231946 3300009177 Unclassified 2078
144 Ga0105248_13040830 3300009177 Bacteria 534
145 Ga0105249_10382593 3300009553 Bacteria 1433
146 Ga0105239_10464596 3300010375 Bacteria 1437
147 Ga0157373_10000051 3300013100 Bacteria 105264
148 Ga0157370_10061902 3300013104 Bacteria 3551
149 Ga0157369_10016193 3300013105 Bacteria 8392
150 Ga0157374_10718045 3300013296 Bacteria 1013
151 Ga0157378_11458309 3300013297 Bacteria 728
152 Ga0157378_12297974 3300013297 Bacteria 591
153 Ga0163162_10524883 3300013306 Bacteria 1313
154 Ga0163162_10721675 3300013306 Bacteria 1117
155 Ga0163162_10906906 3300013306 Bacteria 994
156 Ga0157372_10000119 3300013307 Bacteria 83602
157 Ga0157375_10075042 3300013308 Bacteria 3405
158 Ga0157375_10128266 3300013308 Bacteria 2654
159 Ga0157375_10562944 3300013308 Bacteria 1301
160 Ga0157380_10107193 3300014326 Bacteria 2340
161 Ga0157380_10832748 3300014326 Bacteria 943
162 Ga0157380_11042830 3300014326 Bacteria 854
163 Ga0182008_10036322 3300014497 Bacteria 2465
164 Ga0157377_10346555 3300014745 Bacteria 995
165 Ga0182007_10199081 3300015262 Bacteria 699
166 Ga0163161_10471034 3300017792 Bacteria 1018
167 Ga0207653_10001500 3300025885 Bacteria 7551
168 Ga0207682_10001461 3300025893 Bacteria 10921
169 Ga0207682_10016075 3300025893 Bacteria 2916
170 Ga0207688_10036857 3300025901 Bacteria 2711
171 Ga0207680_10185848 3300025903 Bacteria 1408
172 Ga0207647_10202779 3300025904 Bacteria 1147
173 Ga0207647_10447074 3300025904 Bacteria 725
174 Ga0207643_10016047 3300025908 Bacteria 4080
175 Ga0207643_10282301 3300025908 Bacteria 1030
176 Ga0207654_10000643 3300025911 Bacteria 19695
177 Ga0207707_10000604 3300025912 Bacteria 36158
178 Ga0207707_10401548 3300025912 Bacteria 1176
179 Ga0207707_10896083 3300025912 Bacteria 734
180 Ga0207693_10457479 3300025915 Bacteria 997
181 Ga0207660_10004337 3300025917 Bacteria 9251
182 Ga0207660_10370128 3300025917 Bacteria 1151
183 Ga0207662_10067973 3300025918 Bacteria 2151
184 Ga0207662_10158931 3300025918 Bacteria 1442
185 Ga0207657_10000021 3300025919 Bacteria 155900
186 Ga0207649_10000495 3300025920 Bacteria 27982
187 Ga0207652_10000745 3300025921 Bacteria 31363
188 Ga0207681_10008978 3300025923 Bacteria 6106
189 Ga0207681_10330695 3300025923 Bacteria 1214
190 Ga0207681_10402937 3300025923 Bacteria 1105
191 Ga0207681_10643693 3300025923 Bacteria 878
192 Ga0207650_10025293 3300025925 Bacteria 4228
193 Ga0207650_10120658 3300025925 Bacteria 2041
194 Ga0207659_10018767 3300025926 Bacteria 4539
195 Ga0207644_10067897 3300025931 Bacteria 2600
196 Ga0207644_10843029 3300025931 Bacteria 767
197 Ga0207690_10002113 3300025932 Bacteria 12171
198 Ga0207706_10012297 3300025933 Bacteria 7799
199 Ga0207706_10105928 3300025933 Bacteria 2474
200 Ga0207686_10463683 3300025934 Bacteria 977
201 Ga0207686_10671272 3300025934 Bacteria 821
202 Ga0207709_10142256 3300025935 Bacteria 1650
203 Ga0207709_10214402 3300025935 Bacteria 1384
204 Ga0207670_10935239 3300025936 Bacteria 727
205 Ga0207669_10004802 3300025937 Bacteria 5996
206 Ga0207669_10016694 3300025937 Bacteria 3739
207 Ga0207704_10142645 3300025938 Bacteria 1678
208 Ga0207691_10013335 3300025940 Bacteria 7871
209 Ga0207691_10210208 3300025940 Bacteria 1690
210 Ga0207691_10939909 3300025940 Bacteria 723
211 Ga0207691_10975404 3300025940 Bacteria 708
212 Ga0207711_10363499 3300025941 Bacteria 1341
213 Ga0207689_10000119 3300025942 Bacteria 65346
214 Ga0207661_10117506 3300025944 Bacteria 2259
215 Ga0207679_10000975 3300025945 Bacteria 18382
216 Ga0207667_10001546 3300025949 Bacteria 28942
217 Ga0207667_11662829 3300025949 Unclassified 606
218 Ga0207651_10040730 3300025960 Bacteria 3077
219 Ga0207651_10697768 3300025960 Bacteria 894
220 Ga0207668_10123873 3300025972 Bacteria 1962
221 Ga0207668_11494052 3300025972 Bacteria 610
222 Ga0207677_10026309 3300026023 Bacteria 3647
223 Ga0207703_10081363 3300026035 Bacteria 2700
224 Ga0207703_11638507 3300026035 Bacteria 619
225 Ga0207639_10053084 3300026041 Bacteria 3091
226 Ga0207678_10000942 3300026067 Bacteria 26548
227 Ga0207678_10703212 3300026067 Bacteria 890
228 Ga0207708_10145983 3300026075 Bacteria 1859
229 Ga0207708_10195339 3300026075 Bacteria 1612
230 Ga0207708_10201676 3300026075 Bacteria 1587
231 Ga0207708_10441458 3300026075 Bacteria 1082
232 Ga0207702_10000786 3300026078 Bacteria 33628
233 Ga0207641_10019208 3300026088 Bacteria 5608
234 Ga0207648_10001581 3300026089 Bacteria 24964
235 Ga0207648_10001740 3300026089 Bacteria 23835
236 Ga0207648_10011945 3300026089 Bacteria 8153
237 Ga0207648_10252493 3300026089 Bacteria 1572
238 Ga0207676_10406031 3300026095 Bacteria 1274
239 Ga0207674_10000508 3300026116 Bacteria 51046
240 Ga0207675_100000180 3300026118 Bacteria 56974
241 Ga0207675_100483556 3300026118 Bacteria 1231
242 Ga0207683_10050647 3300026121 Bacteria 3638
243 Ga0209973_1000877 3300027252 Bacteria 2440
244 Ga0209982_1004599 3300027552 Bacteria 1979
245 Ga0209970_1000384 3300027614 Bacteria 7476
246 Ga0210002_1001384 3300027617 Bacteria 3399
247 Ga0209983_1002298 3300027665 Bacteria 4189
248 Ga0209588_1010207 3300027671 Bacteria 2819
249 Ga0209998_10000931 3300027717 Bacteria 7476
250 Ga0209974_10000237 3300027876 Bacteria 17757
251 Ga0207428_10139664 3300027907 Bacteria 1850
252 Ga0207428_10196641 3300027907 Bacteria 1518
253 Ga0268266_10791672 3300028379 Bacteria 916
254 Ga0268265_10058409 3300028380 Bacteria 2945
255 Ga0268265_10939812 3300028380 Bacteria 851
256 Ga0265325_10183542 3300031241 Bacteria 973
257 Ga0307408_101517183 3300031548 Bacteria 634
258 Ga0307405_10038914 3300031731 Unclassified 2870
259 Ga0307413_10000929 3300031824 Bacteria 10425
260 Ga0307406_10032919 3300031901 Bacteria 3168
261 Ga0307407_10002362 3300031903 Bacteria 7357
262 Ga0307412_10016649 3300031911 Bacteria 4385
263 Ga0307409_100000174 3300031995 Bacteria 24996
264 Ga0307416_100000208 3300032002 Bacteria 30656
265 Ga0307411_10000045 3300032005 Bacteria 36356
266 Ga0307415_100119992 3300032126 Bacteria 1969
267 Ga0373931_1205286 3300035691 Unclassified 518
268 Ga0373937_0879659 3300036401 Unclassified 845
269 Ga0436363_1295498 3300039450 Bacteria 670
270 Ga0436362_0136997 3300039453 Bacteria 1436
271 Ga0439453_0041121 3300041408 Bacteria 906
272 Ga0439448_0000124 3300042005 Bacteria 14517
273 Ga0439455_0001305 3300042012 Bacteria 4100
274 Ga0450895_017458 3300042132 Bacteria 650
275 Ga0450889_004765 3300042144 Bacteria 1343
276 Ga0439458_0003338 3300042157 Bacteria 3773
277 Ga0439435_0005631 3300042436 Bacteria 2768
278 Ga0439459_0000133 3300042438 Bacteria 7422
279 Ga0439464_0087578 3300042439 Bacteria 936
280 Ga0439460_0009028 3300042461 Bacteria 2523
281 Ga0451577_0060887 3300042876 Bacteria 3365
282 Ga0439440_0012749 3300042993 Bacteria 1793
283 Ga0453683_0295016 3300044673 Bacteria 1037
284 Ga0453684_0194769 3300044712 Bacteria 2368
285 Ga0451576_0020546 3300045051 Bacteria 7187
286 Ga0495638_0056894 3300046460 Bacteria 2426
287 Ga0495676_0201650 3300047321 Bacteria 1382
288 Ga0496102_0021278 3300048905 Bacteria 5737
289 Ga0496106_0160392 3300048909 Bacteria 1778
290 Ga0496106_0272263 3300048909 Bacteria 1356
291 Ga0496108_1010879 3300048911 Bacteria 710
292 Ga0496112_0109310 3300048915 Bacteria 2735
293 Ga0501036_0088422 3300049572 Bacteria 2618
294 Ga0501037_0495483 3300049573 Unclassified 829
295 Ga0501038_0246956 3300049574 Bacteria 1415
296 Ga0501039_0015319 3300049575 Bacteria 5868
297 Ga0501040_0009533 3300049576 Bacteria 6334
298 Ga0501041_0017212 3300049577 Bacteria 4301
299 Ga0501046_0067297 3300049580 Bacteria 2789
300 Ga0501048_0067130 3300049582 Bacteria 2536
301 Ga0501067_0089178 3300049583 Bacteria 1712
302 Ga0501068_0022642 3300049584 Unclassified 3675
303 Ga0501071_0025487 3300049587 Unclassified 4143
304 Ga0501072_0008262 3300049588 Bacteria 7908
305 Ga0501074_0024666 3300049590 Unclassified 4369
306 Ga0501075_1281509 3300049591 Unclassified 555
307 Ga0501076_0066853 3300049592 Bacteria 2869
308 Ga0501077_0015611 3300049593 Bacteria 4783
309 Ga0501079_0007009 3300049741 Bacteria 8499
310 Ga0501079_0015891 3300049741 Bacteria 5753
311 Ga0501081_0001345 3300049743 Bacteria 14996
312 Ga0501083_0222834 3300049744 Bacteria 1228
313 Ga0501083_0507331 3300049744 Bacteria 785
314 Ga0501045_0024700 3300049824 Bacteria 4315
315 nmdc:mga0k408_444287_c1 3300050493 Bacteria 770
316 nmdc:mga0k408_77731_c1 3300050493 Bacteria 1941
317 nmdc:mga05p37_179_c1 3300050507 Bacteria 62007
318 nmdc:mga09592_11693_c1 3300050508 Bacteria 7139
319 nmdc:mga0qj67_13986_c1 3300050509 Bacteria 6061
320 nmdc:mga0qj67_64530_c1 3300050509 Bacteria 2913
321 nmdc:mga06r32_16253_c1 3300050510 Bacteria 6779
322 nmdc:mga06r32_485185_c1 3300050510 Bacteria 1214
323 nmdc:mga08y16_1311972_c1 3300050511 Bacteria 690
324 nmdc:mga08y16_276523_c1 3300050511 Bacteria 1733
325 nmdc:mga08y16_431490_c1 3300050511 Bacteria 1346
326 nmdc:mga08y16_539879_c1 3300050511 Bacteria 1181
327 nmdc:mga08y16_689260_c1 3300050511 Bacteria 1023
328 nmdc:mga08y16_87607_c1 3300050511 Bacteria 3244
329 nmdc:mga0n895_1642950_c1 3300050512 Bacteria 606
330 nmdc:mga0n895_60386_c1 3300050512 Bacteria 3741
331 nmdc:mga0rr50_95343_c1 3300050513 Bacteria 1500
332 nmdc:mga0a205_539901_c1 3300050515 Bacteria 1022
333 nmdc:mga0sz30_237995_c1 3300050516 Bacteria 810
334 Ga0500646_0121128 3300053090 Bacteria 841
335 Ga0500650_0170739 3300053098 Bacteria 1000
336 Ga0500642_0035562 3300053130 Bacteria 2116
337 Ga0500658_0217209 3300053134 Bacteria 876
338 Ga0500577_0209375 3300053142 Bacteria 842
339 Ga0500616_0018559 3300053153 Bacteria 3931
340 Ga0500636_0347235 3300053177 Bacteria 710
341 Ga0501084_0061616 3300054114 Bacteria 3141
342 Ga0501082_0006879 3300060353 Bacteria 9837
343 Ga0501082_0100335 3300060353 Bacteria 2504
344 Ga0530510_0010878 3300061734 Bacteria 6384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10174651 Ga0065714_101746512 153
2 3300005290 Ga0065712_10391296 Ga0065712_103912961 153
3 3300005331 Ga0070670_100114928 Ga0070670_1001149284 153
4 3300005436 Ga0070713_101526459 Ga0070713_1015264592 153
5 3300005577 Ga0068857_100026932 Ga0068857_1000269325 153
6 3300005617 Ga0068859_100504347 Ga0068859_1005043471 153
7 3300006846 Ga0075430_100040268 Ga0075430_1000402683 153
8 3300006847 Ga0075431_100012643 Ga0075431_1000126439 153
9 3300006847 Ga0075431_100018084 Ga0075431_1000180844 153
10 3300006871 Ga0075434_100749278 Ga0075434_1007492781 153
11 3300006881 Ga0068865_100041645 Ga0068865_1000416454 153
12 3300006931 Ga0097620_100504380 Ga0097620_1005043801 153
13 3300009094 Ga0111539_11298840 Ga0111539_112988402 153
14 3300005438 Ga0070701_10533386 Ga0070701_105333861 154
15 3300005546 Ga0070696_101001266 Ga0070696_1010012661 154
16 3300005563 Ga0068855_100784912 Ga0068855_1007849122 154
17 3300005937 Ga0081455_10083682 Ga0081455_100836822 154
18 3300006844 Ga0075428_100868108 Ga0075428_1008681082 154
19 3300025934 Ga0207686_10671272 Ga0207686_106712722 154
20 3300025949 Ga0207667_11662829 Ga0207667_116628291 154
21 3300036401 Ga0373937_0879659 Ga0373937_0879659_64_552 154
22 3300042461 Ga0439460_0009028 Ga0439460_0009028_579_1076 154
23 3300047321 Ga0495676_0201650 Ga0495676_0201650_888_1352 154
24 3300009177 Ga0105248_10231946 Ga0105248_102319462 155
25 3300025972 Ga0207668_11494052 Ga0207668_114940521 155
26 3300049572 Ga0501036_0088422 Ga0501036_0088422_2028_2495 155
27 3300049573 Ga0501037_0495483 Ga0501037_0495483_302_769 155
28 3300049574 Ga0501038_0246956 Ga0501038_0246956_918_1385 155
29 3300049575 Ga0501039_0015319 Ga0501039_0015319_5257_5724 155
30 3300049576 Ga0501040_0009533 Ga0501040_0009533_1903_2370 155
31 3300049577 Ga0501041_0017212 Ga0501041_0017212_3704_4171 155
32 3300049580 Ga0501046_0067297 Ga0501046_0067297_116_583 155
33 3300049582 Ga0501048_0067130 Ga0501048_0067130_1342_1809 155
34 3300049584 Ga0501068_0022642 Ga0501068_0022642_684_1151 155
35 3300049587 Ga0501071_0025487 Ga0501071_0025487_32_499 155
36 3300049588 Ga0501072_0008262 Ga0501072_0008262_5206_5673 155
37 3300049590 Ga0501074_0024666 Ga0501074_0024666_3306_3773 155
38 3300049591 Ga0501075_1281509 Ga0501075_1281509_40_507 155
39 3300049592 Ga0501076_0066853 Ga0501076_0066853_156_623 155
40 3300049593 Ga0501077_0015611 Ga0501077_0015611_1576_2043 155
41 3300049741 Ga0501079_0007009 Ga0501079_0007009_1735_2202 155
42 3300049743 Ga0501081_0001345 Ga0501081_0001345_9779_10246 155
43 3300049824 Ga0501045_0024700 Ga0501045_0024700_2861_3328 155
44 3300053153 Ga0500616_0018559 Ga0500616_0018559_2282_2749 155
45 3300060353 Ga0501082_0006879 Ga0501082_0006879_143_610 155
46 3300061734 Ga0530510_0010878 Ga0530510_0010878_5767_6234 155
47 3300005293 Ga0065715_10117355 Ga0065715_101173552 156
48 3300005328 Ga0070676_10012209 Ga0070676_100122093 156
49 3300005329 Ga0070683_100290763 Ga0070683_1002907631 156
50 3300005331 Ga0070670_100002328 Ga0070670_10000232813 156
51 3300005334 Ga0068869_100002258 Ga0068869_1000022584 156
52 3300005336 Ga0070680_100000090 Ga0070680_10000009016 156
53 3300005337 Ga0070682_100000162 Ga0070682_10000016233 156
54 3300005339 Ga0070660_100000899 Ga0070660_10000089911 156
55 3300005341 Ga0070691_10010379 Ga0070691_100103794 156
56 3300005341 Ga0070691_10123284 Ga0070691_101232842 156
57 3300005343 Ga0070687_100113429 Ga0070687_1001134292 156
58 3300005344 Ga0070661_100003027 Ga0070661_1000030274 156
59 3300005345 Ga0070692_10000960 Ga0070692_100009606 156
60 3300005353 Ga0070669_100355208 Ga0070669_1003552082 156
61 3300005355 Ga0070671_101350877 Ga0070671_1013508771 156
62 3300005356 Ga0070674_100007709 Ga0070674_1000077095 156
63 3300005364 Ga0070673_100004562 Ga0070673_10000456212 156
64 3300005365 Ga0070688_100264610 Ga0070688_1002646102 156
65 3300005366 Ga0070659_100001226 Ga0070659_1000012264 156
66 3300005366 Ga0070659_101303993 Ga0070659_1013039931 156
67 3300005406 Ga0070703_10003344 Ga0070703_100033443 156
68 3300005438 Ga0070701_10116411 Ga0070701_101164112 156
69 3300005440 Ga0070705_100000632 Ga0070705_1000006324 156
70 3300005441 Ga0070700_100029242 Ga0070700_1000292422 156
71 3300005441 Ga0070700_100106841 Ga0070700_1001068413 156
72 3300005444 Ga0070694_100000169 Ga0070694_10000016923 156
73 3300005444 Ga0070694_100111001 Ga0070694_1001110012 156
74 3300005444 Ga0070694_100332050 Ga0070694_1003320502 156
75 3300005444 Ga0070694_100570184 Ga0070694_1005701841 156
76 3300005455 Ga0070663_100000723 Ga0070663_10000072313 156
77 3300005457 Ga0070662_100103768 Ga0070662_1001037683 156
78 3300005459 Ga0068867_100000366 Ga0068867_1000003669 156
79 3300005459 Ga0068867_100180417 Ga0068867_1001804173 156
80 3300005471 Ga0070698_101189191 Ga0070698_1011891911 156
81 3300005530 Ga0070679_100030315 Ga0070679_1000303156 156
82 3300005535 Ga0070684_100030739 Ga0070684_1000307394 156
83 3300005539 Ga0068853_100000163 Ga0068853_10000016349 156
84 3300005543 Ga0070672_100061075 Ga0070672_1000610752 156
85 3300005545 Ga0070695_100003433 Ga0070695_1000034334 156
86 3300005545 Ga0070695_100116101 Ga0070695_1001161012 156
87 3300005546 Ga0070696_100000864 Ga0070696_10000086417 156
88 3300005547 Ga0070693_100000214 Ga0070693_10000021415 156
89 3300005549 Ga0070704_100000066 Ga0070704_10000006627 156
90 3300005563 Ga0068855_100000802 Ga0068855_10000080228 156
91 3300005564 Ga0070664_100001574 Ga0070664_1000015744 156
92 3300005577 Ga0068857_100068270 Ga0068857_1000682705 156
93 3300005578 Ga0068854_100001721 Ga0068854_10000172115 156
94 3300005614 Ga0068856_100001017 Ga0068856_10000101713 156
95 3300005615 Ga0070702_100512567 Ga0070702_1005125672 156
96 3300005617 Ga0068859_100000501 Ga0068859_10000050122 156
97 3300005617 Ga0068859_100078586 Ga0068859_1000785864 156
98 3300005618 Ga0068864_100000978 Ga0068864_10000097811 156
99 3300005719 Ga0068861_100026940 Ga0068861_1000269403 156
100 3300005719 Ga0068861_100036796 Ga0068861_1000367963 156
101 3300005840 Ga0068870_10000094 Ga0068870_100000942 156
102 3300005842 Ga0068858_100021761 Ga0068858_1000217617 156
103 3300005842 Ga0068858_100637584 Ga0068858_1006375841 156
104 3300005842 Ga0068858_101095630 Ga0068858_1010956301 156
105 3300005843 Ga0068860_100030100 Ga0068860_1000301002 156
106 3300005844 Ga0068862_100006068 Ga0068862_1000060686 156
107 3300006844 Ga0075428_100026197 Ga0075428_1000261974 156
108 3300006844 Ga0075428_100035701 Ga0075428_1000357016 156
109 3300006846 Ga0075430_100415442 Ga0075430_1004154422 156
110 3300006847 Ga0075431_100038837 Ga0075431_1000388374 156
111 3300006852 Ga0075433_10528726 Ga0075433_105287262 156
112 3300006871 Ga0075434_100021977 Ga0075434_1000219772 156
113 3300006880 Ga0075429_100028746 Ga0075429_1000287466 156
114 3300006880 Ga0075429_100560795 Ga0075429_1005607951 156
115 3300006881 Ga0068865_100191632 Ga0068865_1001916322 156
116 3300006881 Ga0068865_100567912 Ga0068865_1005679122 156
117 3300006914 Ga0075436_100192668 Ga0075436_1001926682 156
118 3300006931 Ga0097620_100000501 Ga0097620_10000050124 156
119 3300006931 Ga0097620_100078584 Ga0097620_1000785844 156
120 3300007076 Ga0075435_100251249 Ga0075435_1002512491 156
121 3300007265 Ga0099794_10002660 Ga0099794_100026603 156
122 3300009147 Ga0114129_10000586 Ga0114129_100005867 156
123 3300009147 Ga0114129_10866901 Ga0114129_108669013 156
124 3300009174 Ga0105241_10000522 Ga0105241_1000052221 156
125 3300009177 Ga0105248_13040830 Ga0105248_130408301 156
126 3300010375 Ga0105239_10464596 Ga0105239_104645963 156
127 3300013100 Ga0157373_10000051 Ga0157373_1000005120 156
128 3300013104 Ga0157370_10061902 Ga0157370_100619022 156
129 3300013105 Ga0157369_10016193 Ga0157369_100161939 156
130 3300013306 Ga0163162_10721675 Ga0163162_107216752 156
131 3300013307 Ga0157372_10000119 Ga0157372_1000011942 156
132 3300013308 Ga0157375_10075042 Ga0157375_100750425 156
133 3300013308 Ga0157375_10562944 Ga0157375_105629441 156
134 3300014326 Ga0157380_10107193 Ga0157380_101071932 156
135 3300014497 Ga0182008_10036322 Ga0182008_100363225 156
136 3300015262 Ga0182007_10199081 Ga0182007_101990812 156
137 3300025885 Ga0207653_10001500 Ga0207653_100015005 156
138 3300025893 Ga0207682_10016075 Ga0207682_100160752 156
139 3300025901 Ga0207688_10036857 Ga0207688_100368574 156
140 3300025904 Ga0207647_10447074 Ga0207647_104470742 156
141 3300025908 Ga0207643_10016047 Ga0207643_100160477 156
142 3300025911 Ga0207654_10000643 Ga0207654_100006437 156
143 3300025912 Ga0207707_10000604 Ga0207707_1000060423 156
144 3300025917 Ga0207660_10004337 Ga0207660_1000433711 156
145 3300025917 Ga0207660_10370128 Ga0207660_103701282 156
146 3300025918 Ga0207662_10158931 Ga0207662_101589312 156
147 3300025919 Ga0207657_10000021 Ga0207657_10000021152 156
148 3300025920 Ga0207649_10000495 Ga0207649_1000049525 156
149 3300025921 Ga0207652_10000745 Ga0207652_1000074526 156
150 3300025923 Ga0207681_10008978 Ga0207681_100089787 156
151 3300025923 Ga0207681_10330695 Ga0207681_103306951 156
152 3300025923 Ga0207681_10643693 Ga0207681_106436932 156
153 3300025925 Ga0207650_10025293 Ga0207650_100252935 156
154 3300025931 Ga0207644_10843029 Ga0207644_108430292 156
155 3300025932 Ga0207690_10002113 Ga0207690_1000211317 156
156 3300025933 Ga0207706_10012297 Ga0207706_100122976 156
157 3300025934 Ga0207686_10463683 Ga0207686_104636832 156
158 3300025937 Ga0207669_10016694 Ga0207669_100166943 156
159 3300025938 Ga0207704_10142645 Ga0207704_101426453 156
160 3300025940 Ga0207691_10939909 Ga0207691_109399091 156
161 3300025940 Ga0207691_10975404 Ga0207691_109754042 156
162 3300025942 Ga0207689_10000119 Ga0207689_1000011926 156
163 3300025944 Ga0207661_10117506 Ga0207661_101175063 156
164 3300025945 Ga0207679_10000975 Ga0207679_1000097517 156
165 3300025949 Ga0207667_10001546 Ga0207667_1000154611 156
166 3300025960 Ga0207651_10040730 Ga0207651_100407302 156
167 3300026023 Ga0207677_10026309 Ga0207677_100263092 156
168 3300026035 Ga0207703_10081363 Ga0207703_100813632 156
169 3300026035 Ga0207703_11638507 Ga0207703_116385071 156
170 3300026041 Ga0207639_10053084 Ga0207639_100530845 156
171 3300026067 Ga0207678_10000942 Ga0207678_1000094213 156
172 3300026075 Ga0207708_10145983 Ga0207708_101459832 156
173 3300026075 Ga0207708_10195339 Ga0207708_101953392 156
174 3300026078 Ga0207702_10000786 Ga0207702_1000078620 156
175 3300026088 Ga0207641_10019208 Ga0207641_100192086 156
176 3300026089 Ga0207648_10001581 Ga0207648_100015817 156
177 3300026089 Ga0207648_10001740 Ga0207648_1000174017 156
178 3300026116 Ga0207674_10000508 Ga0207674_1000050846 156
179 3300026118 Ga0207675_100000180 Ga0207675_1000001801 156
180 3300027252 Ga0209973_1000877 Ga0209973_10008774 156
181 3300027552 Ga0209982_1004599 Ga0209982_10045992 156
182 3300027614 Ga0209970_1000384 Ga0209970_10003841 156
183 3300027617 Ga0210002_1001384 Ga0210002_10013843 156
184 3300027665 Ga0209983_1002298 Ga0209983_10022983 156
185 3300027671 Ga0209588_1010207 Ga0209588_10102074 156
186 3300027717 Ga0209998_10000931 Ga0209998_100009311 156
187 3300027876 Ga0209974_10000237 Ga0209974_1000023715 156
188 3300027907 Ga0207428_10196641 Ga0207428_101966413 156
189 3300028380 Ga0268265_10058409 Ga0268265_100584093 156
190 3300042005 Ga0439448_0000124 Ga0439448_0000124_8891_9364 156
191 3300042012 Ga0439455_0001305 Ga0439455_0001305_1798_2271 156
192 3300042132 Ga0450895_017458 Ga0450895_017458_158_634 156
193 3300042144 Ga0450889_004765 Ga0450889_004765_670_1143 156
194 3300042157 Ga0439458_0003338 Ga0439458_0003338_1077_1550 156
195 3300042438 Ga0439459_0000133 Ga0439459_0000133_3989_4462 156
196 3300042876 Ga0451577_0060887 Ga0451577_0060887_203_676 156
197 3300044673 Ga0453683_0295016 Ga0453683_0295016_63_536 156
198 3300044712 Ga0453684_0194769 Ga0453684_0194769_925_1398 156
199 3300045051 Ga0451576_0020546 Ga0451576_0020546_398_871 156
200 3300048905 Ga0496102_0021278 Ga0496102_0021278_2628_3101 156
201 3300048909 Ga0496106_0160392 Ga0496106_0160392_1023_1496 156
202 3300048915 Ga0496112_0109310 Ga0496112_0109310_1447_1920 156
203 3300049583 Ga0501067_0089178 Ga0501067_0089178_227_700 156
204 3300050508 nmdc:mga09592_11693_c1 nmdc:mga09592_11693_c1_1748_2224 156
205 3300050509 nmdc:mga0qj67_13986_c1 nmdc:mga0qj67_13986_c1_1666_2142 156
206 3300050510 nmdc:mga06r32_16253_c1 nmdc:mga06r32_16253_c1_3828_4304 156
207 3300050510 nmdc:mga06r32_485185_c1 nmdc:mga06r32_485185_c1_140_616 156
208 3300050511 nmdc:mga08y16_276523_c1 nmdc:mga08y16_276523_c1_1115_1591 156
209 3300050511 nmdc:mga08y16_689260_c1 nmdc:mga08y16_689260_c1_370_840 156
210 3300005331 Ga0070670_100123911 Ga0070670_1001239112 157
211 3300005441 Ga0070700_100134587 Ga0070700_1001345872 157
212 3300005618 Ga0068864_101280623 Ga0068864_1012806231 157
213 3300009094 Ga0111539_10041580 Ga0111539_100415802 157
214 3300009094 Ga0111539_11772589 Ga0111539_117725891 157
215 3300025925 Ga0207650_10120658 Ga0207650_101206582 157
216 3300026075 Ga0207708_10201676 Ga0207708_102016762 157
217 3300026095 Ga0207676_10406031 Ga0207676_104060312 157
218 3300028379 Ga0268266_10791672 Ga0268266_107916722 157
219 3300031731 Ga0307405_10038914 Ga0307405_100389143 157
220 3300031824 Ga0307413_10000929 Ga0307413_100009291 157
221 3300031901 Ga0307406_10032919 Ga0307406_100329192 157
222 3300031903 Ga0307407_10002362 Ga0307407_100023625 157
223 3300031911 Ga0307412_10016649 Ga0307412_100166492 157
224 3300031995 Ga0307409_100000174 Ga0307409_10000017411 157
225 3300032002 Ga0307416_100000208 Ga0307416_10000020825 157
226 3300032005 Ga0307411_10000045 Ga0307411_1000004525 157
227 3300032126 Ga0307415_100119992 Ga0307415_1001199922 157
228 3300050509 nmdc:mga0qj67_64530_c1 nmdc:mga0qj67_64530_c1_25_603 157
229 3300050511 nmdc:mga08y16_1311972_c1 nmdc:mga08y16_1311972_c1_143_616 157
230 3300050511 nmdc:mga08y16_87607_c1 nmdc:mga08y16_87607_c1_2402_2881 157
231 3300050512 nmdc:mga0n895_1642950_c1 nmdc:mga0n895_1642950_c1_67_540 157
232 3300005295 Ga0065707_10046849 Ga0065707_100468492 158
233 3300005438 Ga0070701_10437215 Ga0070701_104372151 158
234 3300005441 Ga0070700_100315924 Ga0070700_1003159243 158
235 3300005458 Ga0070681_10885371 Ga0070681_108853712 158
236 3300005459 Ga0068867_100533577 Ga0068867_1005335772 158
237 3300005543 Ga0070672_100144637 Ga0070672_1001446373 158
238 3300005548 Ga0070665_100440518 Ga0070665_1004405183 158
239 3300005844 Ga0068862_100841358 Ga0068862_1008413582 158
240 3300005985 Ga0081539_10227762 Ga0081539_102277622 158
241 3300006051 Ga0075364_10013406 Ga0075364_100134062 158
242 3300006177 Ga0075362_10082660 Ga0075362_100826601 158
243 3300006178 Ga0075367_10133782 Ga0075367_101337822 158
244 3300006880 Ga0075429_101308053 Ga0075429_1013080531 158
245 3300009094 Ga0111539_10393621 Ga0111539_103936212 158
246 3300009094 Ga0111539_11618387 Ga0111539_116183871 158
247 3300009098 Ga0105245_12982320 Ga0105245_129823201 158
248 3300009553 Ga0105249_10382593 Ga0105249_103825933 158
249 3300013297 Ga0157378_12297974 Ga0157378_122979741 158
250 3300013306 Ga0163162_10524883 Ga0163162_105248832 158
251 3300014326 Ga0157380_11042830 Ga0157380_110428302 158
252 3300014745 Ga0157377_10346555 Ga0157377_103465552 158
253 3300025904 Ga0207647_10202779 Ga0207647_102027793 158
254 3300025908 Ga0207643_10282301 Ga0207643_102823012 158
255 3300025912 Ga0207707_10896083 Ga0207707_108960832 158
256 3300025923 Ga0207681_10402937 Ga0207681_104029372 158
257 3300025933 Ga0207706_10105928 Ga0207706_101059282 158
258 3300025935 Ga0207709_10214402 Ga0207709_102144021 158
259 3300025940 Ga0207691_10210208 Ga0207691_102102084 158
260 3300025941 Ga0207711_10363499 Ga0207711_103634992 158
261 3300025960 Ga0207651_10697768 Ga0207651_106977681 158
262 3300026067 Ga0207678_10703212 Ga0207678_107032121 158
263 3300026075 Ga0207708_10441458 Ga0207708_104414582 158
264 3300026089 Ga0207648_10252493 Ga0207648_102524933 158
265 3300026118 Ga0207675_100483556 Ga0207675_1004835563 158
266 3300027907 Ga0207428_10139664 Ga0207428_101396643 158
267 3300031548 Ga0307408_101517183 Ga0307408_1015171831 158
268 3300035691 Ga0373931_1205286 Ga0373931_1205286_23_502 158
269 3300041408 Ga0439453_0041121 Ga0439453_0041121_261_737 158
270 3300042436 Ga0439435_0005631 Ga0439435_0005631_1019_1495 158
271 3300042439 Ga0439464_0087578 Ga0439464_0087578_323_799 158
272 3300042993 Ga0439440_0012749 Ga0439440_0012749_562_1038 158
273 3300046460 Ga0495638_0056894 Ga0495638_0056894_1525_2001 158
274 3300048909 Ga0496106_0272263 Ga0496106_0272263_831_1307 158
275 3300048911 Ga0496108_1010879 Ga0496108_1010879_165_656 158
276 3300049741 Ga0501079_0015891 Ga0501079_0015891_3391_3870 158
277 3300050493 nmdc:mga0k408_444287_c1 nmdc:mga0k408_444287_c1_188_664 158
278 3300050493 nmdc:mga0k408_77731_c1 nmdc:mga0k408_77731_c1_666_1157 158
279 3300050507 nmdc:mga05p37_179_c1 nmdc:mga05p37_179_c1_32584_33075 158
280 3300050511 nmdc:mga08y16_431490_c1 nmdc:mga08y16_431490_c1_393_869 158
281 3300050511 nmdc:mga08y16_539879_c1 nmdc:mga08y16_539879_c1_470_961 158
282 3300050512 nmdc:mga0n895_60386_c1 nmdc:mga0n895_60386_c1_2042_2533 158
283 3300050513 nmdc:mga0rr50_95343_c1 nmdc:mga0rr50_95343_c1_198_689 158
284 3300050515 nmdc:mga0a205_539901_c1 nmdc:mga0a205_539901_c1_518_1009 158
285 3300050516 nmdc:mga0sz30_237995_c1 nmdc:mga0sz30_237995_c1_83_574 158
286 3300053090 Ga0500646_0121128 Ga0500646_0121128_174_650 158
287 3300053098 Ga0500650_0170739 Ga0500650_0170739_144_620 158
288 3300053130 Ga0500642_0035562 Ga0500642_0035562_506_982 158
289 3300053134 Ga0500658_0217209 Ga0500658_0217209_134_610 158
290 3300053142 Ga0500577_0209375 Ga0500577_0209375_67_543 158
291 3300053177 Ga0500636_0347235 Ga0500636_0347235_187_663 158
292 3300003203 JGI25406J46586_10006082 JGI25406J46586_100060823 159
293 3300005293 Ga0065715_10130506 Ga0065715_101305062 159
294 3300005328 Ga0070676_10013099 Ga0070676_100130993 159
295 3300005331 Ga0070670_100065883 Ga0070670_1000658831 159
296 3300005333 Ga0070677_10002689 Ga0070677_100026893 159
297 3300005335 Ga0070666_10607024 Ga0070666_106070242 159
298 3300005340 Ga0070689_100205588 Ga0070689_1002055882 159
299 3300005353 Ga0070669_100028890 Ga0070669_1000288902 159
300 3300005354 Ga0070675_100110145 Ga0070675_1001101452 159
301 3300005356 Ga0070674_100064184 Ga0070674_1000641842 159
302 3300005364 Ga0070673_100023151 Ga0070673_1000231514 159
303 3300005438 Ga0070701_10092057 Ga0070701_100920572 159
304 3300005456 Ga0070678_100010213 Ga0070678_1000102133 159
305 3300005457 Ga0070662_100214260 Ga0070662_1002142603 159
306 3300005458 Ga0070681_10433131 Ga0070681_104331312 159
307 3300005458 Ga0070681_11295564 Ga0070681_112955641 159
308 3300005459 Ga0068867_100013778 Ga0068867_1000137785 159
309 3300005543 Ga0070672_100018193 Ga0070672_1000181933 159
310 3300005544 Ga0070686_100023412 Ga0070686_1000234123 159
311 3300005841 Ga0068863_100653194 Ga0068863_1006531941 159
312 3300005985 Ga0081539_10003162 Ga0081539_100031622 159
313 3300006175 Ga0070712_100716610 Ga0070712_1007166102 159
314 3300006881 Ga0068865_100354743 Ga0068865_1003547432 159
315 3300009148 Ga0105243_10281386 Ga0105243_102813861 159
316 3300009148 Ga0105243_10461409 Ga0105243_104614092 159
317 3300013296 Ga0157374_10718045 Ga0157374_107180452 159
318 3300013297 Ga0157378_11458309 Ga0157378_114583092 159
319 3300013306 Ga0163162_10906906 Ga0163162_109069061 159
320 3300013308 Ga0157375_10128266 Ga0157375_101282662 159
321 3300014326 Ga0157380_10832748 Ga0157380_108327482 159
322 3300017792 Ga0163161_10471034 Ga0163161_104710342 159
323 3300025893 Ga0207682_10001461 Ga0207682_1000146111 159
324 3300025903 Ga0207680_10185848 Ga0207680_101858482 159
325 3300025912 Ga0207707_10401548 Ga0207707_104015482 159
326 3300025915 Ga0207693_10457479 Ga0207693_104574793 159
327 3300025918 Ga0207662_10067973 Ga0207662_100679732 159
328 3300025926 Ga0207659_10018767 Ga0207659_100187672 159
329 3300025931 Ga0207644_10067897 Ga0207644_100678972 159
330 3300025935 Ga0207709_10142256 Ga0207709_101422563 159
331 3300025936 Ga0207670_10935239 Ga0207670_109352392 159
332 3300025937 Ga0207669_10004802 Ga0207669_100048025 159
333 3300025940 Ga0207691_10013335 Ga0207691_100133356 159
334 3300025972 Ga0207668_10123873 Ga0207668_101238732 159
335 3300026089 Ga0207648_10011945 Ga0207648_100119457 159
336 3300026121 Ga0207683_10050647 Ga0207683_100506472 159
337 3300028380 Ga0268265_10939812 Ga0268265_109398122 159
338 3300031241 Ga0265325_10183542 Ga0265325_101835422 159
339 3300039450 Ga0436363_1295498 Ga0436363_1295498_143_622 159
340 3300039453 Ga0436362_0136997 Ga0436362_0136997_544_1023 159
341 3300049744 Ga0501083_0222834 Ga0501083_0222834_135_629 159
342 3300049744 Ga0501083_0507331 Ga0501083_0507331_133_621 159
343 3300054114 Ga0501084_0061616 Ga0501084_0061616_303_797 159
344 3300060353 Ga0501082_0100335 Ga0501082_0100335_1697_2191 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

86

188

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.945 2 149
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9036 2 149
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8918 1 147
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8393 1 147
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.832 2 147
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9438 3 149 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9017 3 149 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8775 8 147 3.30.300.20
af_Q2FXK3_6_143_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8525 6 147 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8419 59 147 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A853WSU6-F1-model_v4 deleted 0.9572 2 145
AF-A0A536ZRM3-F1-model_v4 Peroxiredoxin 0.957 2 125
AF-A0A4S1E7C5-F1-model_v4 OsmC family peroxiredoxin 0.9505 1 145
AF-A0A2N7SF35-F1-model_v4 deleted 0.9484 40 149
AF-W2UFP9-F1-model_v4 OsmC-like protein 0.9437 2 138

Feature Viewer

pLDDT pTM Quality
87.3 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map