F416143

General Info

Members Datasets Scaffolds Average Seq Length
344 171 688 81

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0098722|Ga0501036_0098722_1423_1698
Length 91
Sequence VRDGASVRALGIGLVYAWRWTFGLLTPPGTCKYHPSCSQYAIDAFRQFGLVRGGVLAGWRLLRCNPWSHGGVDRVEQQTVFRARGSRRRPA

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
83 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 8.72
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 9.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0098722 3300049572 Bacteria 2469
2 JGI25407J50210_10104114 3300003373 Bacteria 701
3 Ga0070670_100015545 3300005331 Bacteria 6536
4 Ga0070666_10441599 3300005335 Bacteria 939
5 Ga0070668_100534257 3300005347 Bacteria 1019
6 Ga0070659_100662203 3300005366 Unclassified 901
7 Ga0070681_10052509 3300005458 Bacteria 4065
8 Ga0070681_10396867 3300005458 Bacteria 1290
9 Ga0070707_100395023 3300005468 Bacteria 1343
10 Ga0070698_101820438 3300005471 Unclassified 562
11 Ga0070699_100024263 3300005518 Bacteria 5225
12 Ga0070679_100090369 3300005530 Bacteria 3050
13 Ga0070684_100564385 3300005535 Bacteria 1057
14 Ga0070684_101580010 3300005535 Unclassified 618
15 Ga0068855_100183682 3300005563 Bacteria 2363
16 Ga0068855_100192666 3300005563 Bacteria 2298
17 Ga0070664_100581597 3300005564 Bacteria 1037
18 Ga0068857_100061875 3300005577 Bacteria 3326
19 Ga0068857_100990978 3300005577 Bacteria 809
20 Ga0068854_100644714 3300005578 Bacteria 909
21 Ga0068851_10471816 3300005834 Bacteria 749
22 Ga0068870_10254547 3300005840 Bacteria 1090
23 Ga0068870_10356910 3300005840 Bacteria 939
24 Ga0081455_10007720 3300005937 Bacteria 11286
25 Ga0081455_10086738 3300005937 Bacteria 2549
26 Ga0081455_10475255 3300005937 Bacteria 847
27 Ga0081538_10000100 3300005981 Bacteria 83917
28 Ga0081538_10001451 3300005981 Bacteria 24366
29 Ga0081538_10003047 3300005981 Bacteria 15965
30 Ga0081538_10017837 3300005981 Bacteria 5363
31 Ga0081540_1049749 3300005983 Unclassified 2088
32 Ga0081539_10009862 3300005985 Bacteria 7879
33 Ga0075365_10305713 3300006038 Bacteria 1119
34 Ga0075363_100029684 3300006048 Bacteria 2825
35 Ga0075364_10078965 3300006051 Bacteria 2174
36 Ga0075364_11247297 3300006051 Bacteria 504
37 Ga0075367_10219624 3300006178 Bacteria 1189
38 Ga0075370_10090136 3300006353 Bacteria 1769
39 Ga0075428_100100903 3300006844 Bacteria 3147
40 Ga0075428_100159538 3300006844 Unclassified 2448
41 Ga0075428_101333958 3300006844 Unclassified 754
42 Ga0075430_100012796 3300006846 Bacteria 7148
43 Ga0075430_100136503 3300006846 Bacteria 2043
44 Ga0075431_100021811 3300006847 Bacteria 6548
45 Ga0075431_100219325 3300006847 Bacteria 1941
46 Ga0075429_100012543 3300006880 Bacteria 7353
47 Ga0075435_100039466 3300007076 Bacteria 3768
48 Ga0105240_10483997 3300009093 Bacteria 1379
49 Ga0111539_10297618 3300009094 Bacteria 1878
50 Ga0111539_11359768 3300009094 Unclassified 824
51 Ga0111539_11584763 3300009094 Bacteria 760
52 Ga0114129_10052759 3300009147 Bacteria 5706
53 Ga0114129_11097012 3300009147 Bacteria 997
54 Ga0114129_12054180 3300009147 Bacteria 690
55 Ga0114129_12186518 3300009147 Unclassified 666
56 Ga0105243_10484259 3300009148 Bacteria 1168
57 Ga0105242_10150713 3300009176 Bacteria 2027
58 Ga0105242_10357796 3300009176 Bacteria 1350
59 Ga0105249_12905053 3300009553 Bacteria 550
60 Ga0105030_102028 3300009987 Unclassified 1778
61 Ga0157369_10443160 3300013105 Bacteria 1345
62 Ga0157378_10769980 3300013297 Bacteria 986
63 Ga0163162_10403184 3300013306 Bacteria 1500
64 Ga0157372_10124595 3300013307 Bacteria 2962
65 Ga0157372_12350916 3300013307 Bacteria 612
66 Ga0157375_13179016 3300013308 Bacteria 548
67 Ga0163163_10205589 3300014325 Bacteria 2017
68 Ga0157377_10041611 3300014745 Bacteria 2550
69 Ga0157376_11015600 3300014969 Bacteria 852
70 Ga0206354_11384343 3300020081 Bacteria 617
71 Ga0206353_11673524 3300020082 Bacteria 712
72 Ga0207643_10003738 3300025908 Bacteria 8174
73 Ga0207705_10457984 3300025909 Bacteria 989
74 Ga0207707_10228766 3300025912 Bacteria 1618
75 Ga0207707_10495217 3300025912 Bacteria 1043
76 Ga0207657_10146597 3300025919 Bacteria 1925
77 Ga0207652_10463960 3300025921 Bacteria 1141
78 Ga0207646_10188665 3300025922 Bacteria 1862
79 Ga0207646_11611801 3300025922 Unclassified 560
80 Ga0207650_10005967 3300025925 Bacteria 8313
81 Ga0207650_10839807 3300025925 Bacteria 779
82 Ga0207704_11173020 3300025938 Bacteria 654
83 Ga0207661_10075625 3300025944 Bacteria 2764
84 Ga0207679_10919900 3300025945 Bacteria 800
85 Ga0207667_10146198 3300025949 Bacteria 2433
86 Ga0207667_10322287 3300025949 Bacteria 1578
87 Ga0207677_11032643 3300026023 Bacteria 747
88 Ga0207639_11289599 3300026041 Bacteria 685
89 Ga0207674_10010540 3300026116 Bacteria 10460
90 Ga0207683_10714876 3300026121 Bacteria 929
91 Ga0209983_1056360 3300027665 Bacteria 864
92 Ga0207428_10001046 3300027907 Bacteria 30438
93 Ga0265338_10985641 3300028800 Unclassified 571
94 Ga0265331_10149019 3300031250 Bacteria 1063
95 Ga0316583_10097318 3300032133 Bacteria 1026
96 Ga0373944_0027741 3300035089 Bacteria 1681
97 Ga0373943_0008256 3300035170 Bacteria 4672
98 Ga0373946_0012626 3300035171 Bacteria 3166
99 Ga0373935_0044056 3300035692 Bacteria 2811
100 Ga0373927_0484344 3300035695 Bacteria 817
101 Ga0373947_0035103 3300035725 Bacteria 2968
102 Ga0373925_0040532 3300037068 Bacteria 3448
103 Ga0395899_0011055 3300037312 Bacteria 6913
104 Ga0395899_0023255 3300037312 Bacteria 4697
105 Ga0395900_0044282 3300037418 Bacteria 4586
106 Ga0395900_0067054 3300037418 Bacteria 3687
107 Ga0395900_0192803 3300037418 Bacteria 2066
108 Ga0395900_0197065 3300037418 Bacteria 2040
109 Ga0395898_0018520 3300037466 Bacteria 7096
110 Ga0395898_0043350 3300037466 Bacteria 4433
111 Ga0395905_0034958 3300037471 Bacteria 4717
112 Ga0395905_0072521 3300037471 Unclassified 3228
113 Ga0395901_0047434 3300038443 Bacteria 4460
114 Ga0395901_0059207 3300038443 Bacteria 3984
115 Ga0395901_1212664 3300038443 Bacteria 720
116 Ga0395901_1961757 3300038443 Bacteria 532
117 Ga0242420_050649 3300038996 Bacteria 811
118 Ga0450907_049453 3300042146 Bacteria 722
119 Ga0466972_0151941 3300044658 Bacteria 1088
120 Ga0466968_0341213 3300044735 Bacteria 726
121 Ga0495603_0001496 3300046455 Bacteria 13612
122 Ga0495603_0068184 3300046455 Bacteria 2093
123 Ga0495629_0180761 3300046459 Bacteria 1462
124 Ga0495641_0002909 3300046461 Bacteria 13186
125 Ga0495641_0015471 3300046461 Bacteria 4070
126 Ga0495582_0066395 3300046473 Bacteria 1993
127 Ga0495584_0019623 3300046491 Bacteria 3434
128 Ga0495584_0592310 3300046491 Unclassified 565
129 Ga0495594_0000426 3300046499 Bacteria 21208
130 Ga0495596_0091227 3300046500 Bacteria 1183
131 Ga0495608_0162396 3300046511 Bacteria 1420
132 Ga0495666_0009353 3300046526 Bacteria 4903
133 Ga0495665_0154276 3300046531 Bacteria 1198
134 Ga0495622_0089670 3300046557 Bacteria 1413
135 Ga0495667_0121568 3300046559 Bacteria 1686
136 Ga0495635_0071022 3300046663 Bacteria 2386
137 Ga0495588_0004468 3300046674 Bacteria 6179
138 Ga0495647_0234644 3300046681 Bacteria 813
139 Ga0495647_0627086 3300046681 Bacteria 506
140 Ga0495658_0363778 3300046683 Bacteria 920
141 Ga0495624_0077852 3300046690 Bacteria 2057
142 Ga0495670_0359009 3300046691 Bacteria 785
143 Ga0495589_0138661 3300046794 Bacteria 1166
144 Ga0495600_0050146 3300046809 Bacteria 2724
145 Ga0495604_0237688 3300047317 Bacteria 1247
146 Ga0495674_0022723 3300047319 Bacteria 5781
147 Ga0495676_0017624 3300047321 Bacteria 6309
148 Ga0495680_0003831 3300047322 Bacteria 14604
149 Ga0495684_0036129 3300047471 Bacteria 3789
150 Ga0496100_0800351 3300048903 Bacteria 738
151 Ga0496101_0207739 3300048904 Bacteria 1516
152 Ga0496102_0183729 3300048905 Bacteria 1970
153 Ga0496102_0624286 3300048905 Bacteria 1001
154 Ga0496104_0521733 3300048907 Bacteria 1099
155 Ga0496104_1383720 3300048907 Bacteria 607
156 Ga0496104_1409116 3300048907 Bacteria 600
157 Ga0496105_0314613 3300048908 Bacteria 1256
158 Ga0496105_0475008 3300048908 Bacteria 984
159 Ga0496106_0137247 3300048909 Bacteria 1922
160 Ga0496106_0336215 3300048909 Bacteria 1213
161 Ga0496108_0038299 3300048911 Bacteria 3994
162 Ga0496108_0183018 3300048911 Bacteria 1815
163 Ga0496108_0210338 3300048911 Bacteria 1689
164 Ga0496109_0478955 3300048912 Bacteria 1175
165 Ga0496109_0530062 3300048912 Bacteria 1111
166 Ga0496109_0631950 3300048912 Bacteria 1007
167 Ga0496109_0772812 3300048912 Bacteria 899
168 Ga0496110_0131633 3300048913 Bacteria 2259
169 Ga0496110_0237677 3300048913 Bacteria 1658
170 Ga0496111_0119994 3300048914 Bacteria 1942
171 Ga0496111_0631953 3300048914 Bacteria 782
172 Ga0496111_0882182 3300048914 Bacteria 645
173 Ga0496111_1146464 3300048914 Bacteria 553
174 Ga0496112_0017852 3300048915 Bacteria 6678
175 Ga0496112_0034648 3300048915 Bacteria 4913
176 Ga0496113_1177854 3300048916 Unclassified 599
177 Ga0496114_0165064 3300048917 Bacteria 1928
178 Ga0496114_0579934 3300048917 Bacteria 990
179 Ga0496114_1069761 3300048917 Bacteria 691
180 Ga0501031_0007618 3300049568 Bacteria 7049
181 Ga0501031_0031831 3300049568 Bacteria 3440
182 Ga0501031_0157867 3300049568 Bacteria 1483
183 Ga0501032_0076563 3300049569 Bacteria 2227
184 Ga0501032_0427334 3300049569 Bacteria 850
185 Ga0501033_0001828 3300049570 Bacteria 18532
186 Ga0501033_0737053 3300049570 Bacteria 669
187 Ga0501036_0004382 3300049572 Bacteria 11391
188 Ga0501036_0031522 3300049572 Bacteria 4480
189 Ga0501036_1030010 3300049572 Bacteria 673
190 Ga0501036_1356330 3300049572 Unclassified 577
191 Ga0501037_0017634 3300049573 Bacteria 5256
192 Ga0501038_0021281 3300049574 Bacteria 5823
193 Ga0501038_0299175 3300049574 Bacteria 1263
194 Ga0501038_1338756 3300049574 Bacteria 516
195 Ga0501039_0010608 3300049575 Bacteria 7020
196 Ga0501039_0035277 3300049575 Bacteria 3860
197 Ga0501039_0724147 3300049575 Bacteria 777
198 Ga0501040_0005007 3300049576 Bacteria 8567
199 Ga0501040_0026502 3300049576 Bacteria 3899
200 Ga0501040_0176198 3300049576 Bacteria 1515
201 Ga0501040_0309990 3300049576 Bacteria 1128
202 Ga0501040_0604109 3300049576 Bacteria 792
203 Ga0501041_0065989 3300049577 Bacteria 2217
204 Ga0501041_0357281 3300049577 Bacteria 923
205 Ga0501042_0020220 3300049578 Bacteria 4632
206 Ga0501042_0060954 3300049578 Bacteria 2695
207 Ga0501042_0296390 3300049578 Bacteria 1168
208 Ga0501046_0009369 3300049580 Bacteria 8468
209 Ga0501046_0111166 3300049580 Bacteria 2093
210 Ga0501046_0124036 3300049580 Bacteria 1963
211 Ga0501046_0653418 3300049580 Bacteria 743
212 Ga0501047_0535946 3300049581 Bacteria 996
213 Ga0501047_1245543 3300049581 Bacteria 558
214 Ga0501048_0336491 3300049582 Bacteria 1076
215 Ga0501048_0751729 3300049582 Bacteria 700
216 Ga0501048_0929936 3300049582 Bacteria 625
217 Ga0501048_1078179 3300049582 Bacteria 578
218 Ga0501048_1287520 3300049582 Bacteria 525
219 Ga0501067_0221567 3300049583 Unclassified 1053
220 Ga0501067_0495946 3300049583 Bacteria 683
221 Ga0501068_0000380 3300049584 Bacteria 22330
222 Ga0501068_0027829 3300049584 Bacteria 3340
223 Ga0501068_0344304 3300049584 Unclassified 957
224 Ga0501068_1004265 3300049584 Unclassified 551
225 Ga0501069_0019192 3300049585 Bacteria 3694
226 Ga0501069_0213713 3300049585 Bacteria 1119
227 Ga0501069_0243802 3300049585 Bacteria 1047
228 Ga0501070_0014014 3300049586 Bacteria 6749
229 Ga0501070_0798527 3300049586 Bacteria 741
230 Ga0501071_0024830 3300049587 Bacteria 4193
231 Ga0501071_0033681 3300049587 Bacteria 3640
232 Ga0501071_0035889 3300049587 Bacteria 3533
233 Ga0501071_0135583 3300049587 Bacteria 1831
234 Ga0501071_0228587 3300049587 Bacteria 1401
235 Ga0501071_0249893 3300049587 Unclassified 1338
236 Ga0501071_0261645 3300049587 Bacteria 1307
237 Ga0501071_0573285 3300049587 Bacteria 867
238 Ga0501071_1228727 3300049587 Bacteria 579
239 Ga0501072_0108181 3300049588 Bacteria 2212
240 Ga0501072_0299158 3300049588 Bacteria 1279
241 Ga0501072_0353528 3300049588 Unclassified 1166
242 Ga0501072_0510703 3300049588 Bacteria 950
243 Ga0501072_0514230 3300049588 Bacteria 947
244 Ga0501072_1032253 3300049588 Unclassified 641
245 Ga0501072_1474200 3300049588 Bacteria 525
246 Ga0501072_1474214 3300049588 Bacteria 525
247 Ga0501073_0035947 3300049589 Bacteria 3520
248 Ga0501073_0976109 3300049589 Bacteria 583
249 Ga0501074_0004117 3300049590 Bacteria 10379
250 Ga0501075_0345709 3300049591 Bacteria 1133
251 Ga0501075_0554627 3300049591 Bacteria 877
252 Ga0501075_1244032 3300049591 Unclassified 564
253 Ga0501076_0061900 3300049592 Bacteria 2979
254 Ga0501076_0083990 3300049592 Bacteria 2557
255 Ga0501076_0163035 3300049592 Bacteria 1816
256 Ga0501076_0266479 3300049592 Bacteria 1403
257 Ga0501076_0484884 3300049592 Bacteria 1019
258 Ga0501076_0551386 3300049592 Bacteria 950
259 Ga0501076_0746702 3300049592 Bacteria 807
260 Ga0501076_1305730 3300049592 Bacteria 597
261 Ga0501077_0032598 3300049593 Bacteria 3316
262 Ga0501077_0168939 3300049593 Bacteria 1389
263 Ga0501077_0272468 3300049593 Unclassified 1077
264 Ga0501077_0408723 3300049593 Bacteria 868
265 Ga0501079_0002049 3300049741 Bacteria 14438
266 Ga0501079_0062458 3300049741 Bacteria 2873
267 Ga0501079_0294445 3300049741 Bacteria 1269
268 Ga0501079_0384814 3300049741 Bacteria 1100
269 Ga0501079_0707535 3300049741 Bacteria 793
270 Ga0501079_0781567 3300049741 Unclassified 752
271 Ga0501080_0011205 3300049742 Bacteria 8207
272 Ga0501080_0205783 3300049742 Unclassified 1805
273 Ga0501080_0354421 3300049742 Bacteria 1324
274 Ga0501080_0378532 3300049742 Unclassified 1276
275 Ga0501080_0494132 3300049742 Bacteria 1094
276 Ga0501080_0514402 3300049742 Unclassified 1069
277 Ga0501080_0663352 3300049742 Bacteria 922
278 Ga0501080_0768401 3300049742 Bacteria 846
279 Ga0501081_0097356 3300049743 Bacteria 2076
280 Ga0501081_0143098 3300049743 Bacteria 1714
281 Ga0501081_0149570 3300049743 Bacteria 1677
282 Ga0501081_0156985 3300049743 Bacteria 1637
283 Ga0501081_1342422 3300049743 Bacteria 542
284 Ga0501081_1345259 3300049743 Unclassified 542
285 Ga0501081_1470371 3300049743 Unclassified 517
286 Ga0501083_0033561 3300049744 Bacteria 3513
287 Ga0501083_0313506 3300049744 Bacteria 1020
288 Ga0501035_0042714 3300049822 Bacteria 4088
289 Ga0501035_0077014 3300049822 Bacteria 2948
290 Ga0501035_0247484 3300049822 Bacteria 1515
291 Ga0501044_0405916 3300049823 Bacteria 1274
292 Ga0501045_0000951 3300049824 Bacteria 18911
293 Ga0501045_0032448 3300049824 Bacteria 3784
294 Ga0501045_0380673 3300049824 Bacteria 1050
295 Ga0501045_0661609 3300049824 Bacteria 772
296 Ga0501045_0836439 3300049824 Bacteria 677
297 Ga0501045_1018039 3300049824 Bacteria 607
298 nmdc:mga03n38_893561_c1 3300050490 Bacteria 522
299 nmdc:mga00v17_25424_c1 3300050491 Bacteria 3442
300 nmdc:mga0yw44_389252_c1 3300050492 Bacteria 942
301 nmdc:mga0yw44_63011_c2 3300050492 Bacteria 2036
302 nmdc:mga06z11_60943_c1 3300050494 Bacteria 1966
303 nmdc:mga05p37_131818_c1 3300050507 Bacteria 3067
304 nmdc:mga05p37_1594554_c1 3300050507 Unclassified 643
305 nmdc:mga05p37_1666997_c1 3300050507 Unclassified 624
306 nmdc:mga05p37_1988073_c1 3300050507 Bacteria 551
307 nmdc:mga05p37_246700_c1 3300050507 Bacteria 2144
308 nmdc:mga09592_29785_c1 3300050508 Bacteria 4540
309 nmdc:mga09592_559596_c1 3300050508 Bacteria 982
310 nmdc:mga0qj67_198881_c1 3300050509 Bacteria 1628
311 nmdc:mga0qj67_29097_c1 3300050509 Bacteria 4291
312 nmdc:mga06r32_165091_c1 3300050510 Bacteria 2197
313 nmdc:mga06r32_40883_c1 3300050510 Bacteria 4404
314 nmdc:mga08y16_120377_c1 3300050511 Bacteria 2732
315 nmdc:mga08y16_537475_c1 3300050511 Bacteria 1184
316 nmdc:mga0n895_18363_c1 3300050512 Bacteria 6469
317 nmdc:mga0n895_1900275_c1 3300050512 Bacteria 554
318 nmdc:mga0rr50_279796_c1 3300050513 Unclassified 1392
319 nmdc:mga08x19_80729_c1 3300050514 Bacteria 2135
320 nmdc:mga0a205_19617_c1 3300050515 Bacteria 6377
321 Ga0495619_0160367 3300053085 Bacteria 1553
322 Ga0501084_0018799 3300054114 Bacteria 5752
323 Ga0501084_0140935 3300054114 Bacteria 2030
324 Ga0501084_0269140 3300054114 Bacteria 1438
325 Ga0501084_0328815 3300054114 Bacteria 1291
326 Ga0501084_0401946 3300054114 Bacteria 1158
327 Ga0501084_1100033 3300054114 Bacteria 667
328 Ga0590071_174752 3300059421 Bacteria 562
329 Ga0501082_0019335 3300060353 Bacteria 5870
330 Ga0501082_0174402 3300060353 Bacteria 1869
331 Ga0501082_0260744 3300060353 Bacteria 1508
332 Ga0501082_0778020 3300060353 Bacteria 837
333 Ga0501082_0832715 3300060353 Unclassified 807
334 Ga0501082_1014786 3300060353 Bacteria 725
335 Ga0501082_1247006 3300060353 Bacteria 650
336 Ga0530510_0010183 3300061734 Bacteria 6587
337 Ga0530510_0172800 3300061734 Unclassified 1601
338 Ga0530510_0443790 3300061734 Bacteria 981
339 Ga0530510_0453623 3300061734 Bacteria 969
340 Ga0530510_0516388 3300061734 Bacteria 906
341 Ga0530510_0847441 3300061734 Bacteria 698
342 Ga0530510_0936291 3300061734 Bacteria 662
343 Ga0530510_1344483 3300061734 Bacteria 548
344 Ga0530510_1547938 3300061734 Bacteria 509
345 Ga0501036_0098722
346 JGI25407J50210_10104114
347 Ga0070670_100015545
348 Ga0070666_10441599
349 Ga0070668_100534257
350 Ga0070659_100662203
351 Ga0070681_10052509
352 Ga0070681_10396867
353 Ga0070707_100395023
354 Ga0070698_101820438
355 Ga0070699_100024263
356 Ga0070679_100090369
357 Ga0070684_100564385
358 Ga0070684_101580010
359 Ga0068855_100183682
360 Ga0068855_100192666
361 Ga0070664_100581597
362 Ga0068857_100061875
363 Ga0068857_100990978
364 Ga0068854_100644714
365 Ga0068851_10471816
366 Ga0068870_10254547
367 Ga0068870_10356910
368 Ga0081455_10007720
369 Ga0081455_10086738
370 Ga0081455_10475255
371 Ga0081538_10000100
372 Ga0081538_10001451
373 Ga0081538_10003047
374 Ga0081538_10017837
375 Ga0081540_1049749
376 Ga0081539_10009862
377 Ga0075365_10305713
378 Ga0075363_100029684
379 Ga0075364_10078965
380 Ga0075364_11247297
381 Ga0075367_10219624
382 Ga0075370_10090136
383 Ga0075428_100100903
384 Ga0075428_100159538
385 Ga0075428_101333958
386 Ga0075430_100012796
387 Ga0075430_100136503
388 Ga0075431_100021811
389 Ga0075431_100219325
390 Ga0075429_100012543
391 Ga0075435_100039466
392 Ga0105240_10483997
393 Ga0111539_10297618
394 Ga0111539_11359768
395 Ga0111539_11584763
396 Ga0114129_10052759
397 Ga0114129_11097012
398 Ga0114129_12054180
399 Ga0114129_12186518
400 Ga0105243_10484259
401 Ga0105242_10150713
402 Ga0105242_10357796
403 Ga0105249_12905053
404 Ga0105030_102028
405 Ga0157369_10443160
406 Ga0157378_10769980
407 Ga0163162_10403184
408 Ga0157372_10124595
409 Ga0157372_12350916
410 Ga0157375_13179016
411 Ga0163163_10205589
412 Ga0157377_10041611
413 Ga0157376_11015600
414 Ga0206354_11384343
415 Ga0206353_11673524
416 Ga0207643_10003738
417 Ga0207705_10457984
418 Ga0207707_10228766
419 Ga0207707_10495217
420 Ga0207657_10146597
421 Ga0207652_10463960
422 Ga0207646_10188665
423 Ga0207646_11611801
424 Ga0207650_10005967
425 Ga0207650_10839807
426 Ga0207704_11173020
427 Ga0207661_10075625
428 Ga0207679_10919900
429 Ga0207667_10146198
430 Ga0207667_10322287
431 Ga0207677_11032643
432 Ga0207639_11289599
433 Ga0207674_10010540
434 Ga0207683_10714876
435 Ga0209983_1056360
436 Ga0207428_10001046
437 Ga0265338_10985641
438 Ga0265331_10149019
439 Ga0316583_10097318
440 Ga0373944_0027741
441 Ga0373943_0008256
442 Ga0373946_0012626
443 Ga0373935_0044056
444 Ga0373927_0484344
445 Ga0373947_0035103
446 Ga0373925_0040532
447 Ga0395899_0011055
448 Ga0395899_0023255
449 Ga0395900_0044282
450 Ga0395900_0067054
451 Ga0395900_0192803
452 Ga0395900_0197065
453 Ga0395898_0018520
454 Ga0395898_0043350
455 Ga0395905_0034958
456 Ga0395905_0072521
457 Ga0395901_0047434
458 Ga0395901_0059207
459 Ga0395901_1212664
460 Ga0395901_1961757
461 Ga0242420_050649
462 Ga0450907_049453
463 Ga0466972_0151941
464 Ga0466968_0341213
465 Ga0495603_0001496
466 Ga0495603_0068184
467 Ga0495629_0180761
468 Ga0495641_0002909
469 Ga0495641_0015471
470 Ga0495582_0066395
471 Ga0495584_0019623
472 Ga0495584_0592310
473 Ga0495594_0000426
474 Ga0495596_0091227
475 Ga0495608_0162396
476 Ga0495666_0009353
477 Ga0495665_0154276
478 Ga0495622_0089670
479 Ga0495667_0121568
480 Ga0495635_0071022
481 Ga0495588_0004468
482 Ga0495647_0234644
483 Ga0495647_0627086
484 Ga0495658_0363778
485 Ga0495624_0077852
486 Ga0495670_0359009
487 Ga0495589_0138661
488 Ga0495600_0050146
489 Ga0495604_0237688
490 Ga0495674_0022723
491 Ga0495676_0017624
492 Ga0495680_0003831
493 Ga0495684_0036129
494 Ga0496100_0800351
495 Ga0496101_0207739
496 Ga0496102_0183729
497 Ga0496102_0624286
498 Ga0496104_0521733
499 Ga0496104_1383720
500 Ga0496104_1409116
501 Ga0496105_0314613
502 Ga0496105_0475008
503 Ga0496106_0137247
504 Ga0496106_0336215
505 Ga0496108_0038299
506 Ga0496108_0183018
507 Ga0496108_0210338
508 Ga0496109_0478955
509 Ga0496109_0530062
510 Ga0496109_0631950
511 Ga0496109_0772812
512 Ga0496110_0131633
513 Ga0496110_0237677
514 Ga0496111_0119994
515 Ga0496111_0631953
516 Ga0496111_0882182
517 Ga0496111_1146464
518 Ga0496112_0017852
519 Ga0496112_0034648
520 Ga0496113_1177854
521 Ga0496114_0165064
522 Ga0496114_0579934
523 Ga0496114_1069761
524 Ga0501031_0007618
525 Ga0501031_0031831
526 Ga0501031_0157867
527 Ga0501032_0076563
528 Ga0501032_0427334
529 Ga0501033_0001828
530 Ga0501033_0737053
531 Ga0501036_0004382
532 Ga0501036_0031522
533 Ga0501036_1030010
534 Ga0501036_1356330
535 Ga0501037_0017634
536 Ga0501038_0021281
537 Ga0501038_0299175
538 Ga0501038_1338756
539 Ga0501039_0010608
540 Ga0501039_0035277
541 Ga0501039_0724147
542 Ga0501040_0005007
543 Ga0501040_0026502
544 Ga0501040_0176198
545 Ga0501040_0309990
546 Ga0501040_0604109
547 Ga0501041_0065989
548 Ga0501041_0357281
549 Ga0501042_0020220
550 Ga0501042_0060954
551 Ga0501042_0296390
552 Ga0501046_0009369
553 Ga0501046_0111166
554 Ga0501046_0124036
555 Ga0501046_0653418
556 Ga0501047_0535946
557 Ga0501047_1245543
558 Ga0501048_0336491
559 Ga0501048_0751729
560 Ga0501048_0929936
561 Ga0501048_1078179
562 Ga0501048_1287520
563 Ga0501067_0221567
564 Ga0501067_0495946
565 Ga0501068_0000380
566 Ga0501068_0027829
567 Ga0501068_0344304
568 Ga0501068_1004265
569 Ga0501069_0019192
570 Ga0501069_0213713
571 Ga0501069_0243802
572 Ga0501070_0014014
573 Ga0501070_0798527
574 Ga0501071_0024830
575 Ga0501071_0033681
576 Ga0501071_0035889
577 Ga0501071_0135583
578 Ga0501071_0228587
579 Ga0501071_0249893
580 Ga0501071_0261645
581 Ga0501071_0573285
582 Ga0501071_1228727
583 Ga0501072_0108181
584 Ga0501072_0299158
585 Ga0501072_0353528
586 Ga0501072_0510703
587 Ga0501072_0514230
588 Ga0501072_1032253
589 Ga0501072_1474200
590 Ga0501072_1474214
591 Ga0501073_0035947
592 Ga0501073_0976109
593 Ga0501074_0004117
594 Ga0501075_0345709
595 Ga0501075_0554627
596 Ga0501075_1244032
597 Ga0501076_0061900
598 Ga0501076_0083990
599 Ga0501076_0163035
600 Ga0501076_0266479
601 Ga0501076_0484884
602 Ga0501076_0551386
603 Ga0501076_0746702
604 Ga0501076_1305730
605 Ga0501077_0032598
606 Ga0501077_0168939
607 Ga0501077_0272468
608 Ga0501077_0408723
609 Ga0501079_0002049
610 Ga0501079_0062458
611 Ga0501079_0294445
612 Ga0501079_0384814
613 Ga0501079_0707535
614 Ga0501079_0781567
615 Ga0501080_0011205
616 Ga0501080_0205783
617 Ga0501080_0354421
618 Ga0501080_0378532
619 Ga0501080_0494132
620 Ga0501080_0514402
621 Ga0501080_0663352
622 Ga0501080_0768401
623 Ga0501081_0097356
624 Ga0501081_0143098
625 Ga0501081_0149570
626 Ga0501081_0156985
627 Ga0501081_1342422
628 Ga0501081_1345259
629 Ga0501081_1470371
630 Ga0501083_0033561
631 Ga0501083_0313506
632 Ga0501035_0042714
633 Ga0501035_0077014
634 Ga0501035_0247484
635 Ga0501044_0405916
636 Ga0501045_0000951
637 Ga0501045_0032448
638 Ga0501045_0380673
639 Ga0501045_0661609
640 Ga0501045_0836439
641 Ga0501045_1018039
642 nmdc:mga03n38_893561_c1
643 nmdc:mga00v17_25424_c1
644 nmdc:mga0yw44_389252_c1
645 nmdc:mga0yw44_63011_c2
646 nmdc:mga06z11_60943_c1
647 nmdc:mga05p37_131818_c1
648 nmdc:mga05p37_1594554_c1
649 nmdc:mga05p37_1666997_c1
650 nmdc:mga05p37_1988073_c1
651 nmdc:mga05p37_246700_c1
652 nmdc:mga09592_29785_c1
653 nmdc:mga09592_559596_c1
654 nmdc:mga0qj67_198881_c1
655 nmdc:mga0qj67_29097_c1
656 nmdc:mga06r32_165091_c1
657 nmdc:mga06r32_40883_c1
658 nmdc:mga08y16_120377_c1
659 nmdc:mga08y16_537475_c1
660 nmdc:mga0n895_18363_c1
661 nmdc:mga0n895_1900275_c1
662 nmdc:mga0rr50_279796_c1
663 nmdc:mga08x19_80729_c1
664 nmdc:mga0a205_19617_c1
665 Ga0495619_0160367
666 Ga0501084_0018799
667 Ga0501084_0140935
668 Ga0501084_0269140
669 Ga0501084_0328815
670 Ga0501084_0401946
671 Ga0501084_1100033
672 Ga0590071_174752
673 Ga0501082_0019335
674 Ga0501082_0174402
675 Ga0501082_0260744
676 Ga0501082_0778020
677 Ga0501082_0832715
678 Ga0501082_1014786
679 Ga0501082_1247006
680 Ga0530510_0010183
681 Ga0530510_0172800
682 Ga0530510_0443790
683 Ga0530510_0453623
684 Ga0530510_0516388
685 Ga0530510_0847441
686 Ga0530510_0936291
687 Ga0530510_1344483
688 Ga0530510_1547938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01809

YidD

Putative membrane protein insertion efficiency factor

8

75

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rtp-assembly1.cif.gz_A the 3d structure of [nifese] hydrogenase g50t variant from desulfovibrio vulgaris hildenborough at 1.10 angstrom resolution 0.7254 30 49
6rtp-assembly1.cif.gz_A the 3d structure of [nifese] hydrogenase g50t variant from desulfovibrio vulgaris hildenborough at 1.10 angstrom resolution 0.2568 30 49
ID Description Score Start End Superfamily
1fxhA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7983 30 52 1.10.287.150
af_P16433_180_255_1.20.1390.10 Mainly Alpha;Up-down Bundle;PWI domain;PWI domain 0.7953 27 55 1.20.1390.10
1k5sA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7897 30 52 1.10.287.150
1ajnA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7732 30 52 1.10.287.150
1ai7A02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7718 30 52 1.10.287.150
ID Description Score Start End GO Terms
AF-D3Q0H6-F1-model_v4 Membrane protein insertion efficiency factor 0.8553 2 58 GO:0016020
AF-A0A2K1JDZ2-F1-model_v4 Membrane protein insertion efficiency factor 0.847 2 59
AF-A0A1V1X366-F1-model_v4 Membrane protein insertion efficiency factor YidD 0.843 2 59
AF-C6XG53-F1-model_v4 Putative membrane protein insertion efficiency factor 0.8406 2 59 GO:0005886
AF-A0A538DP95-F1-model_v4 Putative membrane protein insertion efficiency factor 0.8345 2 75 GO:0005886

Map