F416059

General Info

Members Datasets Scaffolds Average Seq Length
344 158 334 272

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_017392|Ga0439438_017392_913_1839
Length 308
Sequence VAAYGERLPKKAGRTEEAGAKSAQKALIVSALKDRFPLAAVLQLADLPRSTFYYQLQAQAKPDKHAVLKQLIQRVYHEEKGLYGYRRVTAVIRNAGTLVNKKVVERLMVALDLRSLVRPKKYRSYKGVVGTIAPNLLERNFLAQRPNQKWVTDVTEFKVAEKKVYLSPVMDLYNAEIVAYEVASRPCLGLVTNMLDKAFKRLGNKPKLVLHSDQGWHYQHSQYRHKLAERGLNQSMSRKGNCLDNAAMESFFGTLKSEFFYLKRFESVEELKAGLDEYIHYYNHDRIKLKLNGMSPVEYRAHAAESAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
3 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
4 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
32 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
52 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
53 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
54 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
55 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
56 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
57 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
58 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
92 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
147 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
148 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
149 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
150 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
151 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
154 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
157 8052494512 Pseudomonas putida LD6 Isolate Unclassified
158 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0.58
Rhizoplane 4.07
Rhizosphere 82.85
Stem 0
Stem Tuber 0
Unclassified 9.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1800014 2162886007 Bacteria 1433
2 SwRhRL2b_contig_237405 2162886007 Bacteria 1581
3 SwRhRL2b_contig_3696287 2162886007 Bacteria 1522
4 rootL2_10253537 3300003322 Bacteria 1121
5 rootH1_10010600 3300003323 Bacteria 1428
6 Ga0055536_1027385 3300003781 Bacteria 1577
7 Ga0055530_10030373 3300003791 Bacteria 1432
8 Ga0055540_1019974 3300003792 Bacteria 1788
9 Ga0055531_10027814 3300003794 Bacteria 1970
10 Ga0065165_1017628 3300005262 Bacteria 2621
11 Ga0065714_10014121 3300005288 Bacteria 2572
12 Ga0065704_10098732 3300005289 Bacteria 2341
13 Ga0065704_10162089 3300005289 Bacteria 1347
14 Ga0065712_10013267 3300005290 Bacteria 1828
15 Ga0070659_100074498 3300005366 Bacteria 2704
16 Ga0070709_10281177 3300005434 Bacteria 1209
17 Ga0070665_100167070 3300005548 Bacteria 2202
18 Ga0068855_100251240 3300005563 Bacteria 1972
19 Ga0068857_100415862 3300005577 Bacteria 1253
20 Ga0099823_1074517 3300006944 Bacteria 1431
21 Ga0105251_10066621 3300009011 Bacteria 1683
22 Ga0105244_10009518 3300009036 Bacteria 5968
23 Ga0105244_10029685 3300009036 Bacteria 2918
24 Ga0105250_10025496 3300009092 Bacteria 2382
25 Ga0105250_10029291 3300009092 Bacteria 2216
26 Ga0105250_10070939 3300009092 Bacteria 1407
27 Ga0105243_10042419 3300009148 Bacteria 3562
28 Ga0105243_10517882 3300009148 Bacteria 1134
29 Ga0105242_10073515 3300009176 Bacteria 2842
30 Ga0157370_10006242 3300013104 Bacteria 13200
31 Ga0157370_10206627 3300013104 Bacteria 1821
32 Ga0157372_10310644 3300013307 Bacteria 1835
33 Ga0157372_10324088 3300013307 Bacteria 1794
34 Ga0157372_10337167 3300013307 Bacteria 1756
35 Ga0157372_10390218 3300013307 Bacteria 1622
36 Ga0182008_10069876 3300014497 Bacteria 1728
37 Ga0182008_10072591 3300014497 Bacteria 1693
38 Ga0182006_1055239 3300015261 Bacteria 1516
39 Ga0182007_10046144 3300015262 Bacteria 1443
40 Ga0224570_102731 3300022730 Bacteria 1159
41 Ga0207696_1000065 3300025711 Bacteria 231818
42 Ga0207696_1029021 3300025711 Bacteria 1692
43 Ga0207696_1034948 3300025711 Bacteria 1499
44 Ga0207696_1040681 3300025711 Bacteria 1361
45 Ga0207696_1045706 3300025711 Bacteria 1265
46 Ga0207655_1009044 3300025728 Bacteria 6237
47 Ga0207655_1044685 3300025728 Bacteria 1859
48 Ga0207713_1023577 3300025735 Bacteria 2893
49 Ga0207713_1054510 3300025735 Bacteria 1567
50 Ga0207705_10136874 3300025909 Bacteria 1826
51 Ga0207705_10191060 3300025909 Bacteria 1548
52 Ga0207690_10100810 3300025932 Bacteria 2062
53 Ga0207706_10294774 3300025933 Bacteria 1414
54 Ga0207686_10035316 3300025934 Bacteria 2999
55 Ga0207709_10003377 3300025935 Bacteria 9534
56 Ga0207709_10009521 3300025935 Bacteria 5346
57 Ga0207667_10094099 3300025949 Bacteria 3094
58 Ga0209389_1085243 3300027296 Bacteria 1431
59 Ga0268266_10315570 3300028379 Bacteria 1461
60 Ga0307413_10125424 3300031824 Bacteria 1747
61 Ga0307416_100254265 3300032002 Bacteria 1712
62 Ga0307414_10239029 3300032004 Bacteria 1502
63 Ga0395899_0006654 3300037312 Bacteria 8956
64 Ga0395899_0138160 3300037312 Bacteria 1735
65 Ga0395899_0148711 3300037312 Bacteria 1661
66 Ga0395899_0175476 3300037312 Bacteria 1507
67 Ga0395900_0084308 3300037418 Bacteria 3265
68 Ga0395900_0153803 3300037418 Bacteria 2350
69 Ga0395900_0229715 3300037418 Bacteria 1866
70 Ga0395900_0346349 3300037418 Bacteria 1460
71 Ga0395900_0374657 3300037418 Bacteria 1392
72 Ga0395898_0180844 3300037466 Bacteria 2015
73 Ga0395898_0220064 3300037466 Bacteria 1811
74 Ga0395898_0425906 3300037466 Bacteria 1264
75 Ga0395905_0191616 3300037471 Bacteria 1917
76 Ga0395901_0263524 3300038443 Bacteria 1793
77 Ga0395901_0402255 3300038443 Bacteria 1406
78 Ga0439438_017392 3300041405 Bacteria 2071
79 Ga0439448_0056446 3300042005 Bacteria 1293
80 Ga0439450_032604 3300042008 Bacteria 1177
81 Ga0450900_002784 3300042136 Bacteria 1886
82 Ga0450902_009513 3300042137 Bacteria 1531
83 Ga0450902_017813 3300042137 Bacteria 1162
84 Ga0450905_006937 3300042142 Bacteria 1537
85 Ga0439458_0014869 3300042157 Bacteria 1759
86 Ga0450901_005770 3300042533 Bacteria 1271
87 Ga0466969_0050121 3300044656 Bacteria 2059
88 Ga0466969_0087588 3300044656 Bacteria 1478
89 Ga0466972_0115130 3300044658 Bacteria 1269
90 Ga0466965_0002471 3300044683 Bacteria 7861
91 Ga0466965_0032084 3300044683 Bacteria 2565
92 Ga0466965_0096744 3300044683 Bacteria 1506
93 Ga0466965_0103579 3300044683 Bacteria 1457
94 Ga0466966_0003054 3300044684 Bacteria 11043
95 Ga0466966_0019460 3300044684 Bacteria 4466
96 Ga0466966_0058816 3300044684 Bacteria 2428
97 Ga0466971_0081693 3300044719 Bacteria 1474
98 Ga0466971_0094738 3300044719 Bacteria 1369
99 Ga0466968_0142535 3300044735 Bacteria 1097
100 Ga0466970_0127491 3300044765 Bacteria 1396
101 Ga0466957_0298721 3300044842 Bacteria 1081
102 Ga0466959_0124959 3300045049 Bacteria 1826
103 Ga0466959_0454068 3300045049 Bacteria 868
104 Ga0466958_0037247 3300045836 Bacteria 2914
105 Ga0466967_0578844 3300045976 Bacteria 1107
106 Ga0495627_012321 3300046453 Bacteria 3040
107 Ga0495627_040033 3300046453 Bacteria 1444
108 Ga0495590_0056231 3300046457 Bacteria 1375
109 Ga0495591_019965 3300046458 Bacteria 2227
110 Ga0495591_038179 3300046458 Bacteria 1384
111 Ga0495653_0032683 3300046463 Bacteria 4129
112 Ga0495653_0085421 3300046463 Bacteria 2321
113 Ga0495605_0002841 3300046474 Bacteria 10532
114 Ga0495605_0017242 3300046474 Bacteria 3892
115 Ga0495605_0042709 3300046474 Bacteria 2251
116 Ga0495605_0069188 3300046474 Bacteria 1672
117 Ga0495664_0192334 3300046477 Bacteria 1237
118 Ga0495584_0000096 3300046491 Bacteria 59703
119 Ga0495584_0034483 3300046491 Bacteria 2560
120 Ga0495584_0087283 3300046491 Bacteria 1572
121 Ga0495584_0089013 3300046491 Bacteria 1556
122 Ga0495585_0000129 3300046492 Bacteria 81888
123 Ga0495585_0011066 3300046492 Bacteria 5356
124 Ga0495585_0061595 3300046492 Bacteria 2062
125 Ga0495585_0101070 3300046492 Bacteria 1542
126 Ga0495585_0112350 3300046492 Bacteria 1447
127 Ga0495594_0051652 3300046499 Bacteria 2262
128 Ga0495594_0107239 3300046499 Bacteria 1573
129 Ga0495596_0004634 3300046500 Bacteria 6652
130 Ga0495596_0057827 3300046500 Bacteria 1512
131 Ga0495596_0066624 3300046500 Bacteria 1400
132 Ga0495607_0016564 3300046501 Bacteria 4755
133 Ga0495607_0058033 3300046501 Bacteria 2215
134 Ga0495607_0085312 3300046501 Bacteria 1725
135 Ga0495607_0099346 3300046501 Bacteria 1561
136 Ga0495607_0116558 3300046501 Bacteria 1408
137 Ga0495607_0116876 3300046501 Bacteria 1406
138 Ga0495583_0008390 3300046506 Bacteria 6323
139 Ga0495583_0067792 3300046506 Bacteria 1575
140 Ga0495606_0031310 3300046507 Bacteria 3701
141 Ga0495606_0043489 3300046507 Bacteria 2995
142 Ga0495606_0089062 3300046507 Bacteria 1901
143 Ga0495606_0090866 3300046507 Bacteria 1878
144 Ga0495606_0112932 3300046507 Bacteria 1636
145 Ga0495606_0135705 3300046507 Bacteria 1457
146 Ga0495610_0024472 3300046512 Bacteria 3257
147 Ga0495610_0053052 3300046512 Bacteria 1966
148 Ga0495610_0084743 3300046512 Bacteria 1447
149 Ga0495616_0000100 3300046513 Bacteria 73588
150 Ga0495616_0000123 3300046513 Bacteria 67114
151 Ga0495616_0004752 3300046513 Bacteria 8512
152 Ga0495616_0008769 3300046513 Bacteria 5959
153 Ga0495616_0033074 3300046513 Bacteria 2697
154 Ga0495616_0049174 3300046513 Bacteria 2115
155 Ga0495616_0050741 3300046513 Bacteria 2073
156 Ga0495616_0073646 3300046513 Bacteria 1647
157 Ga0495616_0112570 3300046513 Bacteria 1263
158 Ga0495616_0127725 3300046513 Bacteria 1168
159 Ga0495616_0139023 3300046513 Bacteria 1107
160 Ga0495631_0000356 3300046518 Bacteria 31531
161 Ga0495631_0000891 3300046518 Bacteria 18671
162 Ga0495631_0008517 3300046518 Bacteria 5164
163 Ga0495631_0010077 3300046518 Bacteria 4694
164 Ga0495631_0029957 3300046518 Bacteria 2472
165 Ga0495632_0000130 3300046519 Bacteria 77011
166 Ga0495632_0002109 3300046519 Bacteria 15548
167 Ga0495632_0046588 3300046519 Bacteria 2153
168 Ga0495632_0051327 3300046519 Bacteria 2030
169 Ga0495632_0089830 3300046519 Bacteria 1457
170 Ga0495632_0101142 3300046519 Bacteria 1358
171 Ga0495637_0019569 3300046520 Bacteria 3128
172 Ga0495637_0037107 3300046520 Bacteria 2118
173 Ga0495637_0068208 3300046520 Bacteria 1441
174 Ga0495643_0116305 3300046522 Bacteria 1354
175 Ga0495644_0008463 3300046523 Bacteria 3962
176 Ga0495644_0016053 3300046523 Bacteria 2868
177 Ga0495648_0023013 3300046524 Bacteria 4275
178 Ga0495648_0063130 3300046524 Bacteria 2189
179 Ga0495648_0117590 3300046524 Bacteria 1434
180 Ga0495648_0137922 3300046524 Bacteria 1287
181 Ga0495642_0000302 3300046528 Bacteria 27840
182 Ga0495642_0000573 3300046528 Bacteria 18451
183 Ga0495642_0019544 3300046528 Bacteria 2656
184 Ga0495642_0036843 3300046528 Bacteria 1977
185 Ga0495642_0045821 3300046528 Bacteria 1788
186 Ga0495642_0068162 3300046528 Bacteria 1484
187 Ga0495654_0027882 3300046530 Bacteria 2890
188 Ga0495654_0056692 3300046530 Bacteria 1893
189 Ga0495654_0070788 3300046530 Bacteria 1653
190 Ga0495654_0073176 3300046530 Bacteria 1621
191 Ga0495654_0079644 3300046530 Bacteria 1538
192 Ga0495586_0232030 3300046535 Bacteria 1050
193 Ga0495587_0217677 3300046536 Bacteria 1077
194 Ga0495609_0061576 3300046538 Bacteria 1657
195 Ga0495609_0128648 3300046538 Bacteria 1085
196 Ga0495597_0061320 3300046542 Bacteria 1638
197 Ga0495597_0068707 3300046542 Bacteria 1530
198 Ga0495597_0135576 3300046542 Bacteria 1018
199 Ga0495622_0016064 3300046557 Bacteria 3482
200 Ga0495622_0044676 3300046557 Bacteria 2059
201 Ga0495633_0063637 3300046558 Bacteria 1725
202 Ga0495656_0070460 3300046615 Bacteria 1551
203 Ga0495668_0015359 3300046616 Bacteria 4472
204 Ga0495668_0038823 3300046616 Bacteria 2659
205 Ga0495668_0070245 3300046616 Bacteria 1925
206 Ga0495668_0092275 3300046616 Bacteria 1659
207 Ga0495668_0096728 3300046616 Bacteria 1615
208 Ga0495668_0113842 3300046616 Bacteria 1479
209 Ga0495668_0137112 3300046616 Bacteria 1339
210 Ga0495611_0000133 3300046648 Bacteria 52066
211 Ga0495611_0016283 3300046648 Bacteria 3178
212 Ga0495611_0067689 3300046648 Bacteria 1629
213 Ga0495625_0056381 3300046660 Bacteria 2797
214 Ga0495625_0113803 3300046660 Bacteria 1847
215 Ga0495625_0164971 3300046660 Bacteria 1482
216 Ga0495625_0196567 3300046660 Bacteria 1333
217 Ga0495661_0013667 3300046665 Bacteria 5449
218 Ga0495661_0046746 3300046665 Bacteria 2640
219 Ga0495661_0049810 3300046665 Bacteria 2538
220 Ga0495661_0070913 3300046665 Bacteria 2037
221 Ga0495661_0087010 3300046665 Bacteria 1787
222 Ga0495661_0091948 3300046665 Bacteria 1724
223 Ga0495661_0096615 3300046665 Bacteria 1670
224 Ga0495661_0099607 3300046665 Bacteria 1638
225 Ga0495661_0105645 3300046665 Bacteria 1577
226 Ga0495661_0111013 3300046665 Bacteria 1528
227 Ga0495661_0116557 3300046665 Bacteria 1481
228 Ga0495661_0139001 3300046665 Bacteria 1323
229 Ga0495588_0077230 3300046674 Bacteria 1736
230 Ga0495588_0089865 3300046674 Bacteria 1608
231 Ga0495588_0098340 3300046674 Bacteria 1536
232 Ga0495588_0114574 3300046674 Bacteria 1420
233 Ga0495669_0052437 3300046684 Bacteria 1832
234 Ga0495669_0085623 3300046684 Bacteria 1450
235 Ga0495670_0020466 3300046691 Bacteria 3263
236 Ga0495670_0093431 3300046691 Bacteria 1541
237 Ga0495670_0206419 3300046691 Bacteria 1041
238 Ga0495671_0019323 3300046692 Bacteria 3604
239 Ga0495671_0047286 3300046692 Bacteria 2150
240 Ga0495671_0060318 3300046692 Bacteria 1873
241 Ga0495671_0112482 3300046692 Bacteria 1329
242 Ga0495649_0018370 3300046694 Bacteria 3934
243 Ga0495649_0034447 3300046694 Bacteria 2786
244 Ga0495649_0110489 3300046694 Bacteria 1457
245 Ga0495649_0153921 3300046694 Bacteria 1207
246 Ga0495589_0049583 3300046794 Bacteria 2077
247 Ga0495589_0085520 3300046794 Bacteria 1532
248 Ga0495660_0001207 3300046810 Bacteria 18078
249 Ga0495660_0065997 3300046810 Bacteria 1930
250 Ga0495660_0101287 3300046810 Bacteria 1482
251 Ga0495636_0003971 3300047318 Bacteria 5778
252 Ga0495636_0060201 3300047318 Bacteria 1604
253 Ga0495672_0011378 3300047320 Bacteria 6286
254 Ga0495672_0016054 3300047320 Bacteria 5063
255 Ga0495672_0017818 3300047320 Bacteria 4738
256 Ga0495672_0055457 3300047320 Bacteria 2312
257 Ga0495676_0000181 3300047321 Bacteria 49744
258 Ga0495676_0019799 3300047321 Bacteria 5916
259 Ga0495683_0045815 3300047323 Bacteria 2196
260 Ga0495683_0070602 3300047323 Bacteria 1715
261 Ga0495683_0077539 3300047323 Bacteria 1624
262 Ga0495683_0177572 3300047323 Bacteria 975
263 Ga0495687_000256 3300047443 Bacteria 71778
264 Ga0495677_0040292 3300047445 Bacteria 1708
265 Ga0495677_0048536 3300047445 Bacteria 1559
266 Ga0495677_0057771 3300047445 Bacteria 1434
267 Ga0495677_0064389 3300047445 Bacteria 1362
268 Ga0495677_0067047 3300047445 Bacteria 1335
269 Ga0495679_011835 3300047446 Bacteria 3351
270 Ga0495679_038626 3300047446 Bacteria 1494
271 Ga0495685_023919 3300047447 Bacteria 2103
272 Ga0495673_0001443 3300047469 Bacteria 18957
273 Ga0495673_0072782 3300047469 Bacteria 1441
274 Ga0495681_0047154 3300047470 Bacteria 2051
275 Ga0495686_0153978 3300047472 Bacteria 1348
276 Ga0495602_0109619 3300048088 Bacteria 2245
277 Ga0495615_0020291 3300048090 Bacteria 1487
278 Ga0495626_0001074 3300048091 Bacteria 23269
279 Ga0495626_0002958 3300048091 Bacteria 11300
280 Ga0495626_0011867 3300048091 Bacteria 4587
281 Ga0495626_0016463 3300048091 Bacteria 3754
282 Ga0495626_0066402 3300048091 Bacteria 1631
283 Ga0495626_0084853 3300048091 Bacteria 1401
284 Ga0496100_0070330 3300048903 Bacteria 2333
285 Ga0496100_0134759 3300048903 Bacteria 1744
286 Ga0496102_0235536 3300048905 Bacteria 1726
287 Ga0496102_0317567 3300048905 Bacteria 1467
288 Ga0496102_0363620 3300048905 Bacteria 1362
289 Ga0496103_0099238 3300048906 Bacteria 1842
290 Ga0496103_0154955 3300048906 Bacteria 1468
291 Ga0496104_0223939 3300048907 Bacteria 1793
292 Ga0496107_0118987 3300048910 Bacteria 1945
293 Ga0496108_0139613 3300048911 Bacteria 2087
294 Ga0496109_0384347 3300048912 Bacteria 1326
295 Ga0496110_0265599 3300048913 Bacteria 1562
296 Ga0496110_0355789 3300048913 Bacteria 1334
297 Ga0496115_0169027 3300048918 Bacteria 1808
298 Ga0496116_0093065 3300048919 Bacteria 1826
299 Ga0496116_0125931 3300048919 Bacteria 1471
300 Ga0496118_0063773 3300048921 Bacteria 2709
301 Ga0496119_0041959 3300048922 Bacteria 2906
302 Ga0496121_0245873 3300048924 Bacteria 1243
303 Ga0496121_0349913 3300048924 Bacteria 984
304 Ga0496122_0056568 3300048925 Bacteria 2923
305 Ga0496122_0159340 3300048925 Bacteria 1379
306 Ga0496123_0036408 3300048926 Bacteria 3491
307 Ga0496123_0047179 3300048926 Bacteria 2914
308 Ga0496123_0103811 3300048926 Bacteria 1645
309 Ga0496124_0000989 3300048927 Bacteria 45009
310 Ga0496124_0022033 3300048927 Bacteria 5853
311 Ga0496124_0101821 3300048927 Bacteria 2326
312 Ga0496124_0156831 3300048927 Bacteria 1779
313 Ga0496124_0198053 3300048927 Bacteria 1530
314 Ga0496124_0218441 3300048927 Bacteria 1435
315 Ga0496124_0377361 3300048927 Bacteria 993
316 Ga0496125_0130473 3300048928 Bacteria 1770
317 Ga0496125_0149255 3300048928 Bacteria 1609
318 Ga0496126_0071057 3300048929 Bacteria 3099
319 Ga0496126_0085554 3300048929 Bacteria 2779
320 Ga0496126_0138112 3300048929 Bacteria 2100
321 Ga0495678_059393 3300049459 Bacteria 1441
322 Ga0495682_0046343 3300049460 Bacteria 1587
323 Ga0501034_0297233 3300049571 Bacteria 1552
324 Ga0501224_008097 3300049664 Bacteria 1532
325 Ga0501238_002874 3300049671 Bacteria 2091
326 Ga0501241_003829 3300049758 Bacteria 2836
327 Ga0501226_003216 3300049853 Bacteria 1946
328 Ga0500647_0067086 3300053091 Bacteria 1725
329 Ga0500618_005663 3300053125 Bacteria 3767
330 Ga0500642_0150168 3300053130 Bacteria 1093
331 Ga0500573_0115594 3300053140 Bacteria 1497
332 Ga0500634_0026371 3300053161 Bacteria 3165
333 Ga0466962_0029621 3300061719 Bacteria 2620
334 Ga0466962_0034661 3300061719 Bacteria 2416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003794 Ga0055531_10027814 Ga0055531_100278142 241
2 3300003781 Ga0055536_1027385 Ga0055536_10273852 244
3 3300003791 Ga0055530_10030373 Ga0055530_100303731 244
4 3300003792 Ga0055540_1019974 Ga0055540_10199741 244
5 3300013104 Ga0157370_10006242 Ga0157370_100062423 247
6 3300013307 Ga0157372_10324088 Ga0157372_103240882 247
7 3300014497 Ga0182008_10069876 Ga0182008_100698763 247
8 3300015262 Ga0182007_10046144 Ga0182007_100461441 247
9 3300032004 Ga0307414_10239029 Ga0307414_102390292 247
10 3300032002 Ga0307416_100254265 Ga0307416_1002542652 248
11 3300046500 Ga0495596_0066624 Ga0495596_0066624_114_950 248
12 3300046616 Ga0495668_0113842 Ga0495668_0113842_124_960 248
13 3300046665 Ga0495661_0105645 Ga0495661_0105645_627_1463 248
14 3300047445 Ga0495677_0067047 Ga0495677_0067047_155_991 248
15 3300047447 Ga0495685_023919 Ga0495685_023919_760_1596 248
16 3300048921 Ga0496118_0063773 Ga0496118_0063773_742_1491 248
17 3300048927 Ga0496124_0000989 Ga0496124_0000989_20039_20866 249
18 3300005434 Ga0070709_10281177 Ga0070709_102811772 258
19 3300045049 Ga0466959_0454068 Ga0466959_0454068_33_815 259
20 3300048907 Ga0496104_0223939 Ga0496104_0223939_342_1124 259
21 3300046513 Ga0495616_0112570 Ga0495616_0112570_92_904 260
22 3300047320 Ga0495672_0016054 Ga0495672_0016054_3222_4058 260
23 iso_pu_bacteria 2842815866 2842821331 260
24 3300003323 rootH1_10010600 rootH1_100106001 261
25 3300049571 Ga0501034_0297233 Ga0501034_0297233_141_926 261
26 3300005366 Ga0070659_100074498 Ga0070659_1000744982 262
27 3300005548 Ga0070665_100167070 Ga0070665_1001670702 262
28 3300009036 Ga0105244_10009518 Ga0105244_100095188 262
29 3300009148 Ga0105243_10517882 Ga0105243_105178821 262
30 3300025711 Ga0207696_1000065 Ga0207696_100006535 262
31 3300025728 Ga0207655_1009044 Ga0207655_10090447 262
32 3300025735 Ga0207713_1023577 Ga0207713_10235773 262
33 3300025935 Ga0207709_10009521 Ga0207709_100095213 262
34 3300028379 Ga0268266_10315570 Ga0268266_103155701 262
35 3300042142 Ga0450905_006937 Ga0450905_006937_655_1443 262
36 3300048913 Ga0496110_0265599 Ga0496110_0265599_108_896 262
37 3300048922 Ga0496119_0041959 Ga0496119_0041959_1107_1895 262
38 3300048927 Ga0496124_0218441 Ga0496124_0218441_618_1406 262
39 3300048929 Ga0496126_0071057 Ga0496126_0071057_1411_2199 262
40 3300053161 Ga0500634_0026371 Ga0500634_0026371_1655_2446 262
41 3300044658 Ga0466972_0115130 Ga0466972_0115130_104_898 263
42 3300044683 Ga0466965_0096744 Ga0466965_0096744_51_845 263
43 3300044684 Ga0466966_0058816 Ga0466966_0058816_33_827 263
44 3300045976 Ga0466967_0578844 Ga0466967_0578844_289_1083 263
45 iso_pu_bacteria 8052494512 8052496388 263
46 iso_pu_bacteria 8052494512 8052496595 263
47 iso_pu_bacteria 8052494512 8052497876 263
48 iso_pu_bacteria 8052494512 8052498704 263
49 iso_pu_bacteria 8052494512 8052499753 263
50 3300009092 Ga0105250_10025496 Ga0105250_100254962 264
51 3300025711 Ga0207696_1029021 Ga0207696_10290213 264
52 3300046474 Ga0495605_0069188 Ga0495605_0069188_219_1016 264
53 3300046501 Ga0495607_0099346 Ga0495607_0099346_62_859 264
54 3300046535 Ga0495586_0232030 Ga0495586_0232030_97_894 264
55 3300049664 Ga0501224_008097 Ga0501224_008097_28_825 264
56 3300053091 Ga0500647_0067086 Ga0500647_0067086_884_1681 264
57 3300005262 Ga0065165_1017628 Ga0065165_10176281 265
58 3300037418 Ga0395900_0346349 Ga0395900_0346349_505_1305 265
59 3300046453 Ga0495627_012321 Ga0495627_012321_1076_1876 265
60 3300046463 Ga0495653_0032683 Ga0495653_0032683_629_1429 265
61 3300046507 Ga0495606_0112932 Ga0495606_0112932_210_1010 265
62 3300046512 Ga0495610_0084743 Ga0495610_0084743_36_836 265
63 3300046536 Ga0495587_0217677 Ga0495587_0217677_227_1027 265
64 3300046615 Ga0495656_0070460 Ga0495656_0070460_107_907 265
65 3300046616 Ga0495668_0137112 Ga0495668_0137112_94_894 265
66 3300046665 Ga0495661_0099607 Ga0495661_0099607_713_1513 265
67 3300046691 Ga0495670_0093431 Ga0495670_0093431_683_1483 265
68 3300046694 Ga0495649_0034447 Ga0495649_0034447_414_1214 265
69 3300047445 Ga0495677_0048536 Ga0495677_0048536_701_1501 265
70 3300048090 Ga0495615_0020291 Ga0495615_0020291_96_896 265
71 iso_pu_bacteria 2734482258 2735818530 265
72 iso_pu_bacteria 2842805378 2842809383 266
73 2162886007 SwRhRL2b_contig_237405 SwRhRL2b_0392.00004300 267
74 2162886007 SwRhRL2b_contig_3696287 SwRhRL2b_0103.00006970 267
75 3300005289 Ga0065704_10098732 Ga0065704_100987321 267
76 3300006944 Ga0099823_1074517 Ga0099823_10745172 267
77 3300027296 Ga0209389_1085243 Ga0209389_10852432 267
78 3300042136 Ga0450900_002784 Ga0450900_002784_724_1527 267
79 3300042137 Ga0450902_009513 Ga0450902_009513_167_970 267
80 3300042533 Ga0450901_005770 Ga0450901_005770_175_978 267
81 iso_pu_bacteria 8054929484 8054932217 267
82 2162886007 SwRhRL2b_contig_1800014 SwRhRL2b_0555.00005000 268
83 3300003322 rootL2_10253537 rootL2_102535371 268
84 3300005288 Ga0065714_10014121 Ga0065714_100141212 268
85 3300005289 Ga0065704_10162089 Ga0065704_101620891 268
86 3300005290 Ga0065712_10013267 Ga0065712_100132672 268
87 3300005563 Ga0068855_100251240 Ga0068855_1002512402 268
88 3300005577 Ga0068857_100415862 Ga0068857_1004158621 268
89 3300009011 Ga0105251_10066621 Ga0105251_100666211 268
90 3300009036 Ga0105244_10029685 Ga0105244_100296852 268
91 3300009092 Ga0105250_10029291 Ga0105250_100292913 268
92 3300009092 Ga0105250_10070939 Ga0105250_100709391 268
93 3300009148 Ga0105243_10042419 Ga0105243_100424195 268
94 3300009176 Ga0105242_10073515 Ga0105242_100735154 268
95 3300013104 Ga0157370_10206627 Ga0157370_102066273 268
96 3300013307 Ga0157372_10310644 Ga0157372_103106443 268
97 3300013307 Ga0157372_10337167 Ga0157372_103371672 268
98 3300013307 Ga0157372_10390218 Ga0157372_103902183 268
99 3300014497 Ga0182008_10072591 Ga0182008_100725913 268
100 3300015261 Ga0182006_1055239 Ga0182006_10552392 268
101 3300022730 Ga0224570_102731 Ga0224570_1027312 268
102 3300025711 Ga0207696_1034948 Ga0207696_10349481 268
103 3300025711 Ga0207696_1040681 Ga0207696_10406812 268
104 3300025711 Ga0207696_1045706 Ga0207696_10457062 268
105 3300025728 Ga0207655_1044685 Ga0207655_10446851 268
106 3300025735 Ga0207713_1054510 Ga0207713_10545101 268
107 3300025909 Ga0207705_10136874 Ga0207705_101368743 268
108 3300025909 Ga0207705_10191060 Ga0207705_101910602 268
109 3300025932 Ga0207690_10100810 Ga0207690_101008102 268
110 3300025933 Ga0207706_10294774 Ga0207706_102947742 268
111 3300025934 Ga0207686_10035316 Ga0207686_100353163 268
112 3300025935 Ga0207709_10003377 Ga0207709_100033775 268
113 3300025949 Ga0207667_10094099 Ga0207667_100940994 268
114 3300031824 Ga0307413_10125424 Ga0307413_101254242 268
115 3300037312 Ga0395899_0006654 Ga0395899_0006654_6658_7494 268
116 3300037312 Ga0395899_0138160 Ga0395899_0138160_356_1192 268
117 3300037312 Ga0395899_0148711 Ga0395899_0148711_98_934 268
118 3300037312 Ga0395899_0175476 Ga0395899_0175476_55_891 268
119 3300037418 Ga0395900_0084308 Ga0395900_0084308_137_973 268
120 3300037418 Ga0395900_0153803 Ga0395900_0153803_859_1695 268
121 3300037418 Ga0395900_0229715 Ga0395900_0229715_503_1339 268
122 3300037418 Ga0395900_0374657 Ga0395900_0374657_27_863 268
123 3300037466 Ga0395898_0180844 Ga0395898_0180844_1118_1954 268
124 3300037466 Ga0395898_0220064 Ga0395898_0220064_385_1221 268
125 3300037466 Ga0395898_0425906 Ga0395898_0425906_27_863 268
126 3300037471 Ga0395905_0191616 Ga0395905_0191616_552_1388 268
127 3300038443 Ga0395901_0263524 Ga0395901_0263524_157_993 268
128 3300038443 Ga0395901_0402255 Ga0395901_0402255_544_1380 268
129 3300041405 Ga0439438_017392 Ga0439438_017392_913_1839 268
130 3300042005 Ga0439448_0056446 Ga0439448_0056446_71_907 268
131 3300042008 Ga0439450_032604 Ga0439450_032604_46_882 268
132 3300042137 Ga0450902_017813 Ga0450902_017813_224_1057 268
133 3300042157 Ga0439458_0014869 Ga0439458_0014869_281_1117 268
134 3300044656 Ga0466969_0050121 Ga0466969_0050121_300_1136 268
135 3300044656 Ga0466969_0087588 Ga0466969_0087588_55_891 268
136 3300044683 Ga0466965_0002471 Ga0466965_0002471_847_1683 268
137 3300044683 Ga0466965_0032084 Ga0466965_0032084_587_1423 268
138 3300044683 Ga0466965_0103579 Ga0466965_0103579_638_1447 268
139 3300044684 Ga0466966_0003054 Ga0466966_0003054_4086_4922 268
140 3300044684 Ga0466966_0019460 Ga0466966_0019460_2873_3709 268
141 3300044719 Ga0466971_0081693 Ga0466971_0081693_51_887 268
142 3300044719 Ga0466971_0094738 Ga0466971_0094738_340_1176 268
143 3300044735 Ga0466968_0142535 Ga0466968_0142535_19_855 268
144 3300044765 Ga0466970_0127491 Ga0466970_0127491_78_887 268
145 3300044842 Ga0466957_0298721 Ga0466957_0298721_196_1032 268
146 3300045049 Ga0466959_0124959 Ga0466959_0124959_859_1668 268
147 3300045836 Ga0466958_0037247 Ga0466958_0037247_696_1532 268
148 3300046453 Ga0495627_040033 Ga0495627_040033_588_1421 268
149 3300046457 Ga0495590_0056231 Ga0495590_0056231_458_1267 268
150 3300046458 Ga0495591_019965 Ga0495591_019965_601_1437 268
151 3300046458 Ga0495591_038179 Ga0495591_038179_520_1353 268
152 3300046463 Ga0495653_0085421 Ga0495653_0085421_878_1714 268
153 3300046474 Ga0495605_0002841 Ga0495605_0002841_275_1108 268
154 3300046474 Ga0495605_0017242 Ga0495605_0017242_1637_2473 268
155 3300046474 Ga0495605_0042709 Ga0495605_0042709_1244_2077 268
156 3300046477 Ga0495664_0192334 Ga0495664_0192334_278_1114 268
157 3300046491 Ga0495584_0000096 Ga0495584_0000096_58354_59163 268
158 3300046491 Ga0495584_0034483 Ga0495584_0034483_767_1603 268
159 3300046491 Ga0495584_0087283 Ga0495584_0087283_540_1376 268
160 3300046491 Ga0495584_0089013 Ga0495584_0089013_56_892 268
161 3300046492 Ga0495585_0000129 Ga0495585_0000129_7566_8402 268
162 3300046492 Ga0495585_0011066 Ga0495585_0011066_35_844 268
163 3300046492 Ga0495585_0061595 Ga0495585_0061595_654_1487 268
164 3300046492 Ga0495585_0101070 Ga0495585_0101070_63_872 268
165 3300046492 Ga0495585_0112350 Ga0495585_0112350_36_845 268
166 3300046499 Ga0495594_0051652 Ga0495594_0051652_671_1480 268
167 3300046499 Ga0495594_0107239 Ga0495594_0107239_632_1468 268
168 3300046500 Ga0495596_0004634 Ga0495596_0004634_4947_5756 268
169 3300046500 Ga0495596_0057827 Ga0495596_0057827_118_927 268
170 3300046501 Ga0495607_0016564 Ga0495607_0016564_3544_4353 268
171 3300046501 Ga0495607_0058033 Ga0495607_0058033_162_998 268
172 3300046501 Ga0495607_0085312 Ga0495607_0085312_405_1244 268
173 3300046501 Ga0495607_0116558 Ga0495607_0116558_32_865 268
174 3300046501 Ga0495607_0116876 Ga0495607_0116876_46_855 268
175 3300046506 Ga0495583_0008390 Ga0495583_0008390_907_1743 268
176 3300046506 Ga0495583_0067792 Ga0495583_0067792_216_1034 268
177 3300046507 Ga0495606_0031310 Ga0495606_0031310_1121_1930 268
178 3300046507 Ga0495606_0043489 Ga0495606_0043489_932_1768 268
179 3300046507 Ga0495606_0089062 Ga0495606_0089062_475_1284 268
180 3300046507 Ga0495606_0090866 Ga0495606_0090866_599_1408 268
181 3300046507 Ga0495606_0135705 Ga0495606_0135705_597_1424 268
182 3300046512 Ga0495610_0024472 Ga0495610_0024472_479_1312 268
183 3300046512 Ga0495610_0053052 Ga0495610_0053052_215_1024 268
184 3300046513 Ga0495616_0000100 Ga0495616_0000100_41466_42293 268
185 3300046513 Ga0495616_0000123 Ga0495616_0000123_66243_67079 268
186 3300046513 Ga0495616_0004752 Ga0495616_0004752_206_1015 268
187 3300046513 Ga0495616_0008769 Ga0495616_0008769_3999_4835 268
188 3300046513 Ga0495616_0033074 Ga0495616_0033074_1637_2446 268
189 3300046513 Ga0495616_0049174 Ga0495616_0049174_845_1678 268
190 3300046513 Ga0495616_0050741 Ga0495616_0050741_507_1346 268
191 3300046513 Ga0495616_0073646 Ga0495616_0073646_671_1480 268
192 3300046513 Ga0495616_0127725 Ga0495616_0127725_317_1153 268
193 3300046513 Ga0495616_0139023 Ga0495616_0139023_43_852 268
194 3300046518 Ga0495631_0000356 Ga0495631_0000356_1220_2056 268
195 3300046518 Ga0495631_0000891 Ga0495631_0000891_5965_6774 268
196 3300046518 Ga0495631_0008517 Ga0495631_0008517_1522_2358 268
197 3300046518 Ga0495631_0010077 Ga0495631_0010077_3165_3974 268
198 3300046518 Ga0495631_0029957 Ga0495631_0029957_1288_2124 268
199 3300046519 Ga0495632_0000130 Ga0495632_0000130_7440_8246 268
200 3300046519 Ga0495632_0002109 Ga0495632_0002109_36_872 268
201 3300046519 Ga0495632_0046588 Ga0495632_0046588_394_1230 268
202 3300046519 Ga0495632_0051327 Ga0495632_0051327_306_1139 268
203 3300046519 Ga0495632_0089830 Ga0495632_0089830_579_1415 268
204 3300046519 Ga0495632_0101142 Ga0495632_0101142_267_1103 268
205 3300046520 Ga0495637_0019569 Ga0495637_0019569_2249_3088 268
206 3300046520 Ga0495637_0037107 Ga0495637_0037107_172_1008 268
207 3300046520 Ga0495637_0068208 Ga0495637_0068208_576_1412 268
208 3300046522 Ga0495643_0116305 Ga0495643_0116305_484_1326 268
209 3300046523 Ga0495644_0008463 Ga0495644_0008463_908_1717 268
210 3300046523 Ga0495644_0016053 Ga0495644_0016053_299_1132 268
211 3300046524 Ga0495648_0023013 Ga0495648_0023013_418_1227 268
212 3300046524 Ga0495648_0063130 Ga0495648_0063130_154_969 268
213 3300046524 Ga0495648_0117590 Ga0495648_0117590_600_1406 268
214 3300046524 Ga0495648_0137922 Ga0495648_0137922_202_1038 268
215 3300046528 Ga0495642_0000302 Ga0495642_0000302_7230_8066 268
216 3300046528 Ga0495642_0000573 Ga0495642_0000573_2021_2857 268
217 3300046528 Ga0495642_0019544 Ga0495642_0019544_296_1105 268
218 3300046528 Ga0495642_0036843 Ga0495642_0036843_520_1356 268
219 3300046528 Ga0495642_0045821 Ga0495642_0045821_46_882 268
220 3300046528 Ga0495642_0068162 Ga0495642_0068162_614_1423 268
221 3300046530 Ga0495654_0027882 Ga0495654_0027882_2021_2830 268
222 3300046530 Ga0495654_0056692 Ga0495654_0056692_675_1514 268
223 3300046530 Ga0495654_0070788 Ga0495654_0070788_670_1479 268
224 3300046530 Ga0495654_0073176 Ga0495654_0073176_581_1417 268
225 3300046530 Ga0495654_0079644 Ga0495654_0079644_576_1412 268
226 3300046538 Ga0495609_0061576 Ga0495609_0061576_177_1013 268
227 3300046538 Ga0495609_0128648 Ga0495609_0128648_199_1008 268
228 3300046542 Ga0495597_0061320 Ga0495597_0061320_101_934 268
229 3300046542 Ga0495597_0068707 Ga0495597_0068707_104_940 268
230 3300046542 Ga0495597_0135576 Ga0495597_0135576_155_964 268
231 3300046557 Ga0495622_0016064 Ga0495622_0016064_585_1394 268
232 3300046557 Ga0495622_0044676 Ga0495622_0044676_637_1473 268
233 3300046558 Ga0495633_0063637 Ga0495633_0063637_806_1615 268
234 3300046616 Ga0495668_0015359 Ga0495668_0015359_3325_4134 268
235 3300046616 Ga0495668_0038823 Ga0495668_0038823_1640_2449 268
236 3300046616 Ga0495668_0070245 Ga0495668_0070245_688_1524 268
237 3300046616 Ga0495668_0092275 Ga0495668_0092275_785_1621 268
238 3300046616 Ga0495668_0096728 Ga0495668_0096728_15_851 268
239 3300046648 Ga0495611_0000133 Ga0495611_0000133_2830_3666 268
240 3300046648 Ga0495611_0016283 Ga0495611_0016283_36_845 268
241 3300046648 Ga0495611_0067689 Ga0495611_0067689_664_1500 268
242 3300046660 Ga0495625_0056381 Ga0495625_0056381_689_1525 268
243 3300046660 Ga0495625_0113803 Ga0495625_0113803_680_1516 268
244 3300046660 Ga0495625_0164971 Ga0495625_0164971_38_877 268
245 3300046660 Ga0495625_0196567 Ga0495625_0196567_221_1030 268
246 3300046665 Ga0495661_0013667 Ga0495661_0013667_1839_2648 268
247 3300046665 Ga0495661_0046746 Ga0495661_0046746_65_904 268
248 3300046665 Ga0495661_0049810 Ga0495661_0049810_965_1801 268
249 3300046665 Ga0495661_0070913 Ga0495661_0070913_783_1619 268
250 3300046665 Ga0495661_0087010 Ga0495661_0087010_746_1582 268
251 3300046665 Ga0495661_0091948 Ga0495661_0091948_305_1141 268
252 3300046665 Ga0495661_0096615 Ga0495661_0096615_224_1060 268
253 3300046665 Ga0495661_0111013 Ga0495661_0111013_61_870 268
254 3300046665 Ga0495661_0116557 Ga0495661_0116557_62_898 268
255 3300046665 Ga0495661_0139001 Ga0495661_0139001_109_942 268
256 3300046674 Ga0495588_0077230 Ga0495588_0077230_277_1113 268
257 3300046674 Ga0495588_0089865 Ga0495588_0089865_163_972 268
258 3300046674 Ga0495588_0098340 Ga0495588_0098340_63_899 268
259 3300046674 Ga0495588_0114574 Ga0495588_0114574_400_1209 268
260 3300046684 Ga0495669_0052437 Ga0495669_0052437_989_1798 268
261 3300046684 Ga0495669_0085623 Ga0495669_0085623_36_872 268
262 3300046691 Ga0495670_0020466 Ga0495670_0020466_154_981 268
263 3300046691 Ga0495670_0206419 Ga0495670_0206419_72_881 268
264 3300046692 Ga0495671_0019323 Ga0495671_0019323_2733_3569 268
265 3300046692 Ga0495671_0047286 Ga0495671_0047286_739_1575 268
266 3300046692 Ga0495671_0060318 Ga0495671_0060318_588_1421 268
267 3300046692 Ga0495671_0112482 Ga0495671_0112482_465_1301 268
268 3300046694 Ga0495649_0018370 Ga0495649_0018370_2523_3332 268
269 3300046694 Ga0495649_0110489 Ga0495649_0110489_34_861 268
270 3300046694 Ga0495649_0153921 Ga0495649_0153921_357_1193 268
271 3300046794 Ga0495589_0049583 Ga0495589_0049583_622_1431 268
272 3300046794 Ga0495589_0085520 Ga0495589_0085520_612_1448 268
273 3300046810 Ga0495660_0001207 Ga0495660_0001207_10236_11072 268
274 3300046810 Ga0495660_0065997 Ga0495660_0065997_914_1723 268
275 3300046810 Ga0495660_0101287 Ga0495660_0101287_59_892 268
276 3300047318 Ga0495636_0003971 Ga0495636_0003971_3603_4439 268
277 3300047318 Ga0495636_0060201 Ga0495636_0060201_583_1419 268
278 3300047320 Ga0495672_0011378 Ga0495672_0011378_4869_5678 268
279 3300047320 Ga0495672_0017818 Ga0495672_0017818_3704_4540 268
280 3300047320 Ga0495672_0055457 Ga0495672_0055457_559_1395 268
281 3300047321 Ga0495676_0000181 Ga0495676_0000181_617_1453 268
282 3300047321 Ga0495676_0019799 Ga0495676_0019799_2488_3324 268
283 3300047323 Ga0495683_0045815 Ga0495683_0045815_407_1216 268
284 3300047323 Ga0495683_0070602 Ga0495683_0070602_666_1475 268
285 3300047323 Ga0495683_0077539 Ga0495683_0077539_779_1588 268
286 3300047323 Ga0495683_0177572 Ga0495683_0177572_123_932 268
287 3300047443 Ga0495687_000256 Ga0495687_000256_40830_41639 268
288 3300047445 Ga0495677_0040292 Ga0495677_0040292_741_1577 268
289 3300047445 Ga0495677_0057771 Ga0495677_0057771_56_865 268
290 3300047445 Ga0495677_0064389 Ga0495677_0064389_503_1339 268
291 3300047446 Ga0495679_011835 Ga0495679_011835_1124_1933 268
292 3300047446 Ga0495679_038626 Ga0495679_038626_83_919 268
293 3300047469 Ga0495673_0001443 Ga0495673_0001443_30_866 268
294 3300047469 Ga0495673_0072782 Ga0495673_0072782_30_866 268
295 3300047470 Ga0495681_0047154 Ga0495681_0047154_1220_2029 268
296 3300047472 Ga0495686_0153978 Ga0495686_0153978_358_1197 268
297 3300048088 Ga0495602_0109619 Ga0495602_0109619_843_1679 268
298 3300048091 Ga0495626_0001074 Ga0495626_0001074_8070_8906 268
299 3300048091 Ga0495626_0002958 Ga0495626_0002958_4830_5639 268
300 3300048091 Ga0495626_0011867 Ga0495626_0011867_1361_2197 268
301 3300048091 Ga0495626_0016463 Ga0495626_0016463_2045_2854 268
302 3300048091 Ga0495626_0066402 Ga0495626_0066402_16_852 268
303 3300048091 Ga0495626_0084853 Ga0495626_0084853_409_1245 268
304 3300048903 Ga0496100_0070330 Ga0496100_0070330_635_1444 268
305 3300048903 Ga0496100_0134759 Ga0496100_0134759_250_1086 268
306 3300048905 Ga0496102_0235536 Ga0496102_0235536_853_1689 268
307 3300048905 Ga0496102_0317567 Ga0496102_0317567_44_853 268
308 3300048905 Ga0496102_0363620 Ga0496102_0363620_449_1285 268
309 3300048906 Ga0496103_0099238 Ga0496103_0099238_166_975 268
310 3300048906 Ga0496103_0154955 Ga0496103_0154955_578_1414 268
311 3300048910 Ga0496107_0118987 Ga0496107_0118987_919_1746 268
312 3300048911 Ga0496108_0139613 Ga0496108_0139613_906_1742 268
313 3300048912 Ga0496109_0384347 Ga0496109_0384347_389_1225 268
314 3300048913 Ga0496110_0355789 Ga0496110_0355789_87_923 268
315 3300048918 Ga0496115_0169027 Ga0496115_0169027_74_883 268
316 3300048919 Ga0496116_0093065 Ga0496116_0093065_170_976 268
317 3300048919 Ga0496116_0125931 Ga0496116_0125931_45_851 268
318 3300048924 Ga0496121_0245873 Ga0496121_0245873_22_846 268
319 3300048924 Ga0496121_0349913 Ga0496121_0349913_131_940 268
320 3300048925 Ga0496122_0056568 Ga0496122_0056568_1170_1979 268
321 3300048925 Ga0496122_0159340 Ga0496122_0159340_269_1111 268
322 3300048926 Ga0496123_0036408 Ga0496123_0036408_2066_2893 268
323 3300048926 Ga0496123_0047179 Ga0496123_0047179_806_1615 268
324 3300048926 Ga0496123_0103811 Ga0496123_0103811_135_977 268
325 3300048927 Ga0496124_0022033 Ga0496124_0022033_4439_5275 268
326 3300048927 Ga0496124_0101821 Ga0496124_0101821_425_1234 268
327 3300048927 Ga0496124_0156831 Ga0496124_0156831_188_1021 268
328 3300048927 Ga0496124_0198053 Ga0496124_0198053_598_1416 268
329 3300048927 Ga0496124_0377361 Ga0496124_0377361_18_827 268
330 3300048928 Ga0496125_0130473 Ga0496125_0130473_716_1552 268
331 3300048928 Ga0496125_0149255 Ga0496125_0149255_399_1235 268
332 3300048929 Ga0496126_0085554 Ga0496126_0085554_1326_2153 268
333 3300048929 Ga0496126_0138112 Ga0496126_0138112_691_1500 268
334 3300049459 Ga0495678_059393 Ga0495678_059393_30_866 268
335 3300049460 Ga0495682_0046343 Ga0495682_0046343_688_1515 268
336 3300049671 Ga0501238_002874 Ga0501238_002874_479_1315 268
337 3300049758 Ga0501241_003829 Ga0501241_003829_758_1594 268
338 3300049853 Ga0501226_003216 Ga0501226_003216_120_956 268
339 3300053125 Ga0500618_005663 Ga0500618_005663_401_1237 268
340 3300053130 Ga0500642_0150168 Ga0500642_0150168_245_1054 268
341 3300053140 Ga0500573_0115594 Ga0500573_0115594_58_891 268
342 3300061719 Ga0466962_0029621 Ga0466962_0029621_1146_1982 268
343 3300061719 Ga0466962_0034661 Ga0466962_0034661_841_1677 268
344 iso_pu_bacteria 8047673197 8047676350 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13333

rve_2

Integrase core domain

249

303

0.98

PF00665

rve

Integrase core domain

143

242

0.97

PF13683

rve_3

Integrase core domain

230

296

0.97

PF13276

HTH_21

HTH-like domain

62

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qbt-assembly1.cif.gz_A structure of the htlv-2 integrase catalytic core domain in complex with magnesium (trimeric form) 0.8303 97 248
7ku7-assembly1.cif.gz_F cryo-em structure of rous sarcoma virus cleaved synaptic complex (csc) with hiv-1 integrase strand transfer inhibitor mk-2048. cluster identified by 3-dimensional variability analysis in cryosparc. 0.8079 108 247
6qbv-assembly1.cif.gz_B structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.8027 109 262
6voy-assembly1.cif.gz_D cryo-em structure of htlv-1 instasome 0.802 108 247
7jn3-assembly1.cif.gz_H cryo-em structure of rous sarcoma virus cleaved synaptic complex (csc) with hiv-1 integrase strand transfer inhibitor mk-2048 0.8018 109 247
ID Description Score Start End Superfamily
af_P9WKH9_102_261_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9023 108 249 3.30.420.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9006 103 265 3.30.420.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8951 102 166 3.30.420.10
af_P19769_115_278_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8903 103 265 3.30.420.10
af_P0CF80_124_283_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8789 105 262 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A246JJB7-F1-model_v4 IS3 family transposase 0.9379 113 245 GO:0003676
GO:0015074
AF-A0A3D0IEF1-F1-model_v4 IS3 family transposase 0.9321 119 248 GO:0003676
GO:0015074
AF-A0A1I3BGM4-F1-model_v4 Integrase core domain-containing protein 0.9252 128 245 GO:0003676
GO:0015074
AF-W2ED20-F1-model_v4 deleted 0.9223 115 200
AF-A0A7X8K0X8-F1-model_v4 Transposase family protein 0.9193 108 200 GO:0003676
GO:0015074

Feature Viewer

pLDDT pTM Quality
81.41 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map