F416057

General Info

Members Datasets Scaffolds Average Seq Length
344 181 688 162

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0643609|Ga0436365_0643609_18021_18563
Length 180
Sequence VEKLCLSSYGRIAPGEKTTMALAATKSFDLSPPTDQQMRQLVGNLSSEERGVLLEHGTEAPFCGVFLAEKREGVYTCRLCGLPLFKAGAKFESGTGWPSFTTPFAQQHLREISDRSYGMVRTEIVCARCGGHQGHVFPDGPPPTGLRFCINSVSLSFVPKESPLPDKLGRGAPEGETWTD

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
108 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0.87
Rhizoplane 1.74
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0643609 3300039437 Bacteria 115180
2 Ga0065712_10097357 3300005290 Bacteria 2153
3 Ga0070658_10008342 3300005327 Bacteria 8334
4 Ga0070683_100012620 3300005329 Bacteria 7345
5 Ga0070670_100005456 3300005331 Bacteria 10725
6 Ga0070677_10094091 3300005333 Bacteria 1309
7 Ga0070666_10122776 3300005335 Bacteria 1802
8 Ga0070666_10256081 3300005335 Bacteria 1240
9 Ga0070680_100181813 3300005336 Bacteria 1771
10 Ga0070680_101472113 3300005336 Bacteria 590
11 Ga0070682_100074009 3300005337 Bacteria 2187
12 Ga0070660_100235904 3300005339 Bacteria 1489
13 Ga0070689_100080060 3300005340 Bacteria 2563
14 Ga0070661_100234285 3300005344 Bacteria 1412
15 Ga0070692_10029666 3300005345 Bacteria 2728
16 Ga0070668_100682346 3300005347 Bacteria 905
17 Ga0070669_100114665 3300005353 Bacteria 2049
18 Ga0070671_100001398 3300005355 Bacteria 18024
19 Ga0070671_100006707 3300005355 Bacteria 9211
20 Ga0070671_100007525 3300005355 Bacteria 8709
21 Ga0070671_100028974 3300005355 Bacteria 4564
22 Ga0070674_100005411 3300005356 Bacteria 7372
23 Ga0070674_100020129 3300005356 Bacteria 4256
24 Ga0070673_100570917 3300005364 Bacteria 1029
25 Ga0070688_100283797 3300005365 Bacteria 1191
26 Ga0070659_100144538 3300005366 Bacteria 1937
27 Ga0070667_100019881 3300005367 Bacteria 5572
28 Ga0070667_100306151 3300005367 Bacteria 1431
29 Ga0070667_100367142 3300005367 Bacteria 1305
30 Ga0070678_100003813 3300005456 Bacteria 8456
31 Ga0070662_100084822 3300005457 Bacteria 2366
32 Ga0070662_100195935 3300005457 Bacteria 1600
33 Ga0070662_100627849 3300005457 Bacteria 905
34 Ga0070662_100739120 3300005457 Bacteria 834
35 Ga0070681_10648593 3300005458 Bacteria 971
36 Ga0068867_100184869 3300005459 Bacteria 1659
37 Ga0070685_10293085 3300005466 Bacteria 1094
38 Ga0070679_100150644 3300005530 Bacteria 2303
39 Ga0070684_100013242 3300005535 Bacteria 6644
40 Ga0068853_100021762 3300005539 Bacteria 5350
41 Ga0070672_100249697 3300005543 Bacteria 1494
42 Ga0070672_101197288 3300005543 Bacteria 677
43 Ga0070696_100375151 3300005546 Bacteria 1107
44 Ga0070665_100000078 3300005548 Bacteria 188101
45 Ga0068855_100000583 3300005563 Bacteria 44861
46 Ga0070664_100949596 3300005564 Bacteria 807
47 Ga0068857_100811859 3300005577 Bacteria 894
48 Ga0068856_100044952 3300005614 Bacteria 4347
49 Ga0068852_101276612 3300005616 Bacteria 756
50 Ga0068859_100004017 3300005617 Bacteria 14998
51 Ga0068859_100075828 3300005617 Bacteria 3403
52 Ga0068859_100358799 3300005617 Bacteria 1552
53 Ga0068859_100389763 3300005617 Bacteria 1489
54 Ga0068864_100000074 3300005618 Bacteria 109458
55 Ga0068864_100034123 3300005618 Bacteria 4326
56 Ga0068864_100068080 3300005618 Bacteria 3092
57 Ga0068864_100110691 3300005618 Bacteria 2446
58 Ga0068864_101590149 3300005618 Bacteria 658
59 Ga0068861_100912219 3300005719 Bacteria 833
60 Ga0068851_10179255 3300005834 Bacteria 1173
61 Ga0068863_100001987 3300005841 Bacteria 20326
62 Ga0068863_100043522 3300005841 Bacteria 4262
63 Ga0068863_100061189 3300005841 Bacteria 3559
64 Ga0068863_100112799 3300005841 Bacteria 2589
65 Ga0068863_100455753 3300005841 Bacteria 1255
66 Ga0068863_100649216 3300005841 Bacteria 1046
67 Ga0068858_100001903 3300005842 Bacteria 21300
68 Ga0068858_100006692 3300005842 Bacteria 11213
69 Ga0068860_100031789 3300005843 Bacteria 5075
70 Ga0068860_100037394 3300005843 Bacteria 4647
71 Ga0068860_100449113 3300005843 Bacteria 1282
72 Ga0068862_100033863 3300005844 Bacteria 4321
73 Ga0075366_10005714 3300006195 Bacteria 6751
74 Ga0097621_100175619 3300006237 Bacteria 1849
75 Ga0097621_100317151 3300006237 Bacteria 1380
76 Ga0075428_100715755 3300006844 Bacteria 1066
77 Ga0075430_100014035 3300006846 Bacteria 6830
78 Ga0075431_100095120 3300006847 Bacteria 3075
79 Ga0075431_100438603 3300006847 Bacteria 1303
80 Ga0097620_100004017 3300006931 Bacteria 14998
81 Ga0097620_100008294 3300006931 Bacteria 10532
82 Ga0097620_100075829 3300006931 Bacteria 3403
83 Ga0097620_100358797 3300006931 Bacteria 1552
84 Ga0097620_100389794 3300006931 Bacteria 1489
85 Ga0079104_1033083 3300006946 Bacteria 1269
86 Ga0105251_10122469 3300009011 Bacteria 1181
87 Ga0105251_10144318 3300009011 Bacteria 1076
88 Ga0105250_10006044 3300009092 Bacteria 5332
89 Ga0105240_10021839 3300009093 Bacteria 8504
90 Ga0111539_10078702 3300009094 Bacteria 3878
91 Ga0111539_10200993 3300009094 Bacteria 2324
92 Ga0111539_12061836 3300009094 Bacteria 662
93 Ga0105247_10134131 3300009101 Bacteria 1616
94 Ga0114129_10078747 3300009147 Bacteria 4584
95 Ga0114129_10087869 3300009147 Bacteria 4310
96 Ga0105248_10000075 3300009177 Bacteria 114243
97 Ga0105248_10013570 3300009177 Bacteria 8971
98 Ga0105248_10024296 3300009177 Bacteria 6738
99 Ga0105248_10024705 3300009177 Bacteria 6682
100 Ga0105248_10084188 3300009177 Bacteria 3577
101 Ga0105249_10023140 3300009553 Bacteria 5572
102 Ga0105249_10044498 3300009553 Bacteria 4036
103 Ga0105249_10325676 3300009553 Bacteria 1549
104 Ga0105249_11042551 3300009553 Bacteria 887
105 Ga0105249_11388299 3300009553 Bacteria 774
106 Ga0105239_10654697 3300010375 Bacteria 1200
107 Ga0105246_10663639 3300011119 Unclassified 909
108 Ga0157373_10095977 3300013100 Bacteria 2087
109 Ga0157371_10008928 3300013102 Bacteria 7935
110 Ga0157370_10718937 3300013104 Bacteria 911
111 Ga0157369_11102100 3300013105 Bacteria 811
112 Ga0157372_10043372 3300013307 Bacteria 4979
113 Ga0157372_10378148 3300013307 Bacteria 1650
114 Ga0157375_10530593 3300013308 Bacteria 1340
115 Ga0157375_11143547 3300013308 Bacteria 912
116 Ga0163163_10000219 3300014325 Bacteria 59481
117 Ga0163163_10261168 3300014325 Bacteria 1783
118 Ga0157379_10002745 3300014968 Bacteria 14852
119 Ga0157379_10005712 3300014968 Bacteria 10700
120 Ga0213876_10000909 3300021384 Bacteria 19677
121 Ga0207656_10124178 3300025321 Bacteria 1204
122 Ga0207696_1011967 3300025711 Bacteria 3094
123 Ga0207653_10286673 3300025885 Bacteria 636
124 Ga0207682_10035917 3300025893 Bacteria 2003
125 Ga0207682_10515491 3300025893 Bacteria 566
126 Ga0207680_10130007 3300025903 Bacteria 1659
127 Ga0207705_10009217 3300025909 Bacteria 7186
128 Ga0207705_10241789 3300025909 Bacteria 1375
129 Ga0207707_10187325 3300025912 Bacteria 1806
130 Ga0207660_11164936 3300025917 Bacteria 628
131 Ga0207657_10235646 3300025919 Bacteria 1463
132 Ga0207657_10711354 3300025919 Bacteria 780
133 Ga0207657_10966939 3300025919 Bacteria 654
134 Ga0207652_10508179 3300025921 Bacteria 1085
135 Ga0207681_10032653 3300025923 Bacteria 3409
136 Ga0207681_10096235 3300025923 Bacteria 2125
137 Ga0207650_10326601 3300025925 Bacteria 1257
138 Ga0207644_10000368 3300025931 Bacteria 29425
139 Ga0207644_10003177 3300025931 Bacteria 10573
140 Ga0207644_10011343 3300025931 Bacteria 5895
141 Ga0207644_10111818 3300025931 Bacteria 2066
142 Ga0207644_10360670 3300025931 Bacteria 1182
143 Ga0207690_10025378 3300025932 Bacteria 3721
144 Ga0207706_10004109 3300025933 Bacteria 13739
145 Ga0207706_10030807 3300025933 Bacteria 4784
146 Ga0207706_10227374 3300025933 Bacteria 1633
147 Ga0207706_10356306 3300025933 Bacteria 1271
148 Ga0207706_10584331 3300025933 Bacteria 960
149 Ga0207669_10024019 3300025937 Bacteria 3269
150 Ga0207704_10142741 3300025938 Bacteria 1678
151 Ga0207704_11239251 3300025938 Bacteria 637
152 Ga0207691_10255134 3300025940 Bacteria 1513
153 Ga0207691_10734827 3300025940 Bacteria 831
154 Ga0207711_10000077 3300025941 Bacteria 106500
155 Ga0207711_10000305 3300025941 Bacteria 52775
156 Ga0207711_10016211 3300025941 Bacteria 6186
157 Ga0207711_10017142 3300025941 Bacteria 6016
158 Ga0207711_10129107 3300025941 Bacteria 2264
159 Ga0207711_10156301 3300025941 Bacteria 2061
160 Ga0207661_10011899 3300025944 Bacteria 6318
161 Ga0207679_10631708 3300025945 Bacteria 967
162 Ga0207667_10002926 3300025949 Bacteria 21201
163 Ga0207651_10016998 3300025960 Bacteria 4283
164 Ga0207651_10019475 3300025960 Bacteria 4069
165 Ga0207651_10388303 3300025960 Bacteria 1185
166 Ga0207712_10016648 3300025961 Bacteria 4766
167 Ga0207712_10285590 3300025961 Bacteria 1348
168 Ga0207640_11819892 3300025981 Bacteria 550
169 Ga0207658_10004463 3300025986 Bacteria 9726
170 Ga0207658_10007530 3300025986 Bacteria 7414
171 Ga0207658_10009652 3300025986 Bacteria 6547
172 Ga0207658_10386754 3300025986 Bacteria 1226
173 Ga0207658_10434705 3300025986 Bacteria 1159
174 Ga0207703_10007149 3300026035 Bacteria 8880
175 Ga0207703_10017366 3300026035 Bacteria 5617
176 Ga0207703_11721620 3300026035 Bacteria 603
177 Ga0207639_10145339 3300026041 Bacteria 1980
178 Ga0207708_10445916 3300026075 Bacteria 1077
179 Ga0207702_10050718 3300026078 Bacteria 3504
180 Ga0207702_11227146 3300026078 Bacteria 744
181 Ga0207641_10000140 3300026088 Bacteria 105699
182 Ga0207641_10000401 3300026088 Bacteria 50998
183 Ga0207641_10060857 3300026088 Bacteria 3219
184 Ga0207641_10159912 3300026088 Bacteria 2047
185 Ga0207641_10418412 3300026088 Bacteria 1290
186 Ga0207641_11037294 3300026088 Bacteria 817
187 Ga0207648_10028951 3300026089 Bacteria 4911
188 Ga0207648_10141229 3300026089 Bacteria 2122
189 Ga0207676_10014796 3300026095 Bacteria 5619
190 Ga0207676_10068860 3300026095 Bacteria 2832
191 Ga0207676_10277377 3300026095 Bacteria 1520
192 Ga0207676_11615982 3300026095 Bacteria 646
193 Ga0207674_10812113 3300026116 Bacteria 902
194 Ga0207683_10003996 3300026121 Bacteria 12787
195 Ga0207683_10286695 3300026121 Bacteria 1505
196 Ga0209281_1025232 3300027111 Bacteria 1109
197 Ga0209970_1018906 3300027614 Bacteria 1159
198 Ga0209974_10010094 3300027876 Bacteria 3191
199 Ga0207428_10174740 3300027907 Bacteria 1625
200 Ga0268266_10000131 3300028379 Bacteria 146628
201 Ga0268265_10003643 3300028380 Bacteria 10991
202 Ga0268265_10010674 3300028380 Bacteria 6203
203 Ga0268265_10803230 3300028380 Bacteria 917
204 Ga0268264_10001714 3300028381 Bacteria 20207
205 Ga0268264_10010181 3300028381 Bacteria 7782
206 Ga0268264_10100656 3300028381 Bacteria 2510
207 Ga0307515_10199625 3300028794 Bacteria 1880
208 Ga0307408_100042329 3300031548 Bacteria 3234
209 Ga0307408_100213302 3300031548 Bacteria 1570
210 Ga0307408_100905557 3300031548 Bacteria 808
211 Ga0307405_10019315 3300031731 Bacteria 3782
212 Ga0307405_10205878 3300031731 Bacteria 1432
213 Ga0307405_10222965 3300031731 Bacteria 1384
214 Ga0307405_10579736 3300031731 Bacteria 912
215 Ga0307413_10067562 3300031824 Bacteria 2235
216 Ga0307413_10078066 3300031824 Bacteria 2111
217 Ga0307413_10168532 3300031824 Bacteria 1547
218 Ga0307413_10954006 3300031824 Bacteria 732
219 Ga0307410_10022481 3300031852 Bacteria 3899
220 Ga0307410_10064236 3300031852 Bacteria 2521
221 Ga0307410_10112033 3300031852 Bacteria 1975
222 Ga0307410_10147946 3300031852 Bacteria 1745
223 Ga0307410_10186775 3300031852 Bacteria 1573
224 Ga0307410_10196009 3300031852 Bacteria 1539
225 Ga0307410_10319176 3300031852 Bacteria 1232
226 Ga0307410_10386310 3300031852 Bacteria 1127
227 Ga0307410_10709689 3300031852 Bacteria 848
228 Ga0307406_10009362 3300031901 Bacteria 5491
229 Ga0307406_10034643 3300031901 Bacteria 3099
230 Ga0307406_10065390 3300031901 Bacteria 2363
231 Ga0307407_10055263 3300031903 Bacteria 2293
232 Ga0307407_10121027 3300031903 Bacteria 1659
233 Ga0307407_10264476 3300031903 Bacteria 1184
234 Ga0307407_10352276 3300031903 Bacteria 1043
235 Ga0307412_10003244 3300031911 Bacteria 9042
236 Ga0307412_10052470 3300031911 Bacteria 2700
237 Ga0307412_10186343 3300031911 Bacteria 1565
238 Ga0307409_100021600 3300031995 Bacteria 4417
239 Ga0307409_100041948 3300031995 Bacteria 3422
240 Ga0307409_100124323 3300031995 Bacteria 2191
241 Ga0307409_100261058 3300031995 Bacteria 1589
242 Ga0307409_100326335 3300031995 Bacteria 1438
243 Ga0307409_100367524 3300031995 Bacteria 1363
244 Ga0307409_100955630 3300031995 Bacteria 873
245 Ga0307409_100985115 3300031995 Bacteria 860
246 Ga0307416_100061768 3300032002 Bacteria 3060
247 Ga0307416_100068888 3300032002 Bacteria 2925
248 Ga0307416_100117201 3300032002 Bacteria 2363
249 Ga0307416_100733474 3300032002 Bacteria 1079
250 Ga0307416_100838166 3300032002 Bacteria 1017
251 Ga0307416_100853579 3300032002 Bacteria 1009
252 Ga0307416_101819472 3300032002 Bacteria 713
253 Ga0307414_10004893 3300032004 Bacteria 7317
254 Ga0307414_10110339 3300032004 Bacteria 2092
255 Ga0307414_10119248 3300032004 Bacteria 2025
256 Ga0307414_10135675 3300032004 Bacteria 1918
257 Ga0307411_10001005 3300032005 Bacteria 10875
258 Ga0307411_10023058 3300032005 Bacteria 3678
259 Ga0307411_10043926 3300032005 Bacteria 2862
260 Ga0307411_10131972 3300032005 Bacteria 1827
261 Ga0307411_10277018 3300032005 Bacteria 1333
262 Ga0307411_10380643 3300032005 Bacteria 1160
263 Ga0307411_11057873 3300032005 Bacteria 729
264 Ga0307415_100006837 3300032126 Bacteria 6190
265 Ga0307415_100102676 3300032126 Bacteria 2101
266 Ga0307415_100115834 3300032126 Bacteria 1998
267 Ga0307415_100596195 3300032126 Bacteria 982
268 Ga0307415_101405508 3300032126 Bacteria 664
269 Ga0373943_0316668 3300035170 Bacteria 889
270 Ga0395899_0154563 3300037312 Bacteria 1624
271 Ga0395899_0238993 3300037312 Bacteria 1251
272 Ga0395900_0003156 3300037418 Bacteria 17867
273 Ga0395900_0033720 3300037418 Bacteria 5268
274 Ga0395898_0452369 3300037466 Bacteria 1223
275 Ga0395905_0000104 3300037471 Bacteria 141965
276 Ga0395905_0049674 3300037471 Bacteria 3931
277 Ga0395905_0292385 3300037471 Bacteria 1516
278 Ga0395905_0329125 3300037471 Bacteria 1418
279 Ga0395905_0356658 3300037471 Bacteria 1355
280 Ga0395905_0362486 3300037471 Bacteria 1342
281 Ga0395901_0003794 3300038443 Bacteria 15221
282 Ga0395901_0718692 3300038443 Bacteria 995
283 Ga0439439_0080247 3300041406 Bacteria 882
284 Ga0451853_0491202 3300041512 Bacteria 818
285 Ga0439445_0275725 3300042004 Bacteria 504
286 Ga0439449_0043005 3300042007 Bacteria 1678
287 Ga0466970_0095294 3300044765 Bacteria 1618
288 Ga0466970_0115420 3300044765 Bacteria 1468
289 Ga0466967_0043449 3300045976 Bacteria 3891
290 Ga0466967_0073424 3300045976 Bacteria 3069
291 Ga0466967_0163298 3300045976 Bacteria 2092
292 Ga0495585_0230604 3300046492 Bacteria 931
293 Ga0495643_0012421 3300046522 Bacteria 5139
294 Ga0495663_0057978 3300046525 Bacteria 1213
295 Ga0495663_0079697 3300046525 Bacteria 1053
296 Ga0495654_0056233 3300046530 Bacteria 1902
297 Ga0495622_0178113 3300046557 Bacteria 954
298 Ga0495668_0038068 3300046616 Bacteria 2689
299 Ga0495668_0063668 3300046616 Bacteria 2031
300 Ga0495625_0000758 3300046660 Bacteria 45114
301 Ga0495625_0463715 3300046660 Bacteria 780
302 Ga0495669_0010621 3300046684 Bacteria 3894
303 Ga0495670_0000009 3300046691 Bacteria 210956
304 Ga0496100_0765249 3300048903 Bacteria 756
305 Ga0496103_0625833 3300048906 Bacteria 685
306 Ga0496109_0104855 3300048912 Bacteria 2625
307 Ga0496110_0124209 3300048913 Bacteria 2328
308 Ga0496112_0272854 3300048915 Bacteria 1639
309 Ga0496113_0123967 3300048916 Bacteria 2022
310 Ga0501036_0107718 3300049572 Bacteria 2356
311 Ga0501039_0296849 3300049575 Bacteria 1270
312 Ga0501040_0022835 3300049576 Bacteria 4192
313 Ga0501041_0016113 3300049577 Bacteria 4439
314 Ga0501048_0561584 3300049582 Bacteria 819
315 Ga0501067_0038051 3300049583 Bacteria 2672
316 Ga0501069_0383299 3300049585 Bacteria 831
317 Ga0501072_0475479 3300049588 Bacteria 989
318 Ga0501073_0298099 3300049589 Bacteria 1112
319 Ga0501074_0485833 3300049590 Bacteria 875
320 Ga0501077_0132501 3300049593 Bacteria 1581
321 Ga0501233_047273 3300049668 Bacteria 1032
322 Ga0501233_181706 3300049668 Bacteria 603
323 Ga0501079_0059959 3300049741 Bacteria 2935
324 Ga0501079_1038460 3300049741 Bacteria 646
325 Ga0501080_0408833 3300049742 Bacteria 1220
326 Ga0501044_0669233 3300049823 Bacteria 926
327 Ga0501045_0152086 3300049824 Bacteria 1722
328 nmdc:mga0k408_11180_c1 3300050493 Bacteria 4880
329 nmdc:mga05p37_194013_c1 3300050507 Bacteria 2464
330 nmdc:mga0qj67_134648_c1 3300050509 Bacteria 2002
331 nmdc:mga06r32_15100_c1 3300050510 Bacteria 7013
332 nmdc:mga06r32_155844_c1 3300050510 Bacteria 2265
333 nmdc:mga08y16_1640196_c1 3300050511 Bacteria 600
334 nmdc:mga08y16_425862_c1 3300050511 Bacteria 1356
335 nmdc:mga08y16_75121_c1 3300050511 Bacteria 3523
336 Ga0500658_0000138 3300053134 Bacteria 34673
337 Ga0500604_0000019 3300053151 Bacteria 78330
338 Ga0500627_0000546 3300053158 Bacteria 10127
339 Ga0500645_001376 3300053730 Bacteria 12466
340 Ga0501084_0422906 3300054114 Bacteria 1126
341 Ga0501084_0768341 3300054114 Bacteria 812
342 Ga0530510_0382206 3300061734 Bacteria 1060
343 Ga0530510_1203425 3300061734 Bacteria 581
344 8055619612 8055617313 Bacteria 7548464
345 Ga0436365_0643609
346 Ga0065712_10097357
347 Ga0070658_10008342
348 Ga0070683_100012620
349 Ga0070670_100005456
350 Ga0070677_10094091
351 Ga0070666_10122776
352 Ga0070666_10256081
353 Ga0070680_100181813
354 Ga0070680_101472113
355 Ga0070682_100074009
356 Ga0070660_100235904
357 Ga0070689_100080060
358 Ga0070661_100234285
359 Ga0070692_10029666
360 Ga0070668_100682346
361 Ga0070669_100114665
362 Ga0070671_100001398
363 Ga0070671_100006707
364 Ga0070671_100007525
365 Ga0070671_100028974
366 Ga0070674_100005411
367 Ga0070674_100020129
368 Ga0070673_100570917
369 Ga0070688_100283797
370 Ga0070659_100144538
371 Ga0070667_100019881
372 Ga0070667_100306151
373 Ga0070667_100367142
374 Ga0070678_100003813
375 Ga0070662_100084822
376 Ga0070662_100195935
377 Ga0070662_100627849
378 Ga0070662_100739120
379 Ga0070681_10648593
380 Ga0068867_100184869
381 Ga0070685_10293085
382 Ga0070679_100150644
383 Ga0070684_100013242
384 Ga0068853_100021762
385 Ga0070672_100249697
386 Ga0070672_101197288
387 Ga0070696_100375151
388 Ga0070665_100000078
389 Ga0068855_100000583
390 Ga0070664_100949596
391 Ga0068857_100811859
392 Ga0068856_100044952
393 Ga0068852_101276612
394 Ga0068859_100004017
395 Ga0068859_100075828
396 Ga0068859_100358799
397 Ga0068859_100389763
398 Ga0068864_100000074
399 Ga0068864_100034123
400 Ga0068864_100068080
401 Ga0068864_100110691
402 Ga0068864_101590149
403 Ga0068861_100912219
404 Ga0068851_10179255
405 Ga0068863_100001987
406 Ga0068863_100043522
407 Ga0068863_100061189
408 Ga0068863_100112799
409 Ga0068863_100455753
410 Ga0068863_100649216
411 Ga0068858_100001903
412 Ga0068858_100006692
413 Ga0068860_100031789
414 Ga0068860_100037394
415 Ga0068860_100449113
416 Ga0068862_100033863
417 Ga0075366_10005714
418 Ga0097621_100175619
419 Ga0097621_100317151
420 Ga0075428_100715755
421 Ga0075430_100014035
422 Ga0075431_100095120
423 Ga0075431_100438603
424 Ga0097620_100004017
425 Ga0097620_100008294
426 Ga0097620_100075829
427 Ga0097620_100358797
428 Ga0097620_100389794
429 Ga0079104_1033083
430 Ga0105251_10122469
431 Ga0105251_10144318
432 Ga0105250_10006044
433 Ga0105240_10021839
434 Ga0111539_10078702
435 Ga0111539_10200993
436 Ga0111539_12061836
437 Ga0105247_10134131
438 Ga0114129_10078747
439 Ga0114129_10087869
440 Ga0105248_10000075
441 Ga0105248_10013570
442 Ga0105248_10024296
443 Ga0105248_10024705
444 Ga0105248_10084188
445 Ga0105249_10023140
446 Ga0105249_10044498
447 Ga0105249_10325676
448 Ga0105249_11042551
449 Ga0105249_11388299
450 Ga0105239_10654697
451 Ga0105246_10663639
452 Ga0157373_10095977
453 Ga0157371_10008928
454 Ga0157370_10718937
455 Ga0157369_11102100
456 Ga0157372_10043372
457 Ga0157372_10378148
458 Ga0157375_10530593
459 Ga0157375_11143547
460 Ga0163163_10000219
461 Ga0163163_10261168
462 Ga0157379_10002745
463 Ga0157379_10005712
464 Ga0213876_10000909
465 Ga0207656_10124178
466 Ga0207696_1011967
467 Ga0207653_10286673
468 Ga0207682_10035917
469 Ga0207682_10515491
470 Ga0207680_10130007
471 Ga0207705_10009217
472 Ga0207705_10241789
473 Ga0207707_10187325
474 Ga0207660_11164936
475 Ga0207657_10235646
476 Ga0207657_10711354
477 Ga0207657_10966939
478 Ga0207652_10508179
479 Ga0207681_10032653
480 Ga0207681_10096235
481 Ga0207650_10326601
482 Ga0207644_10000368
483 Ga0207644_10003177
484 Ga0207644_10011343
485 Ga0207644_10111818
486 Ga0207644_10360670
487 Ga0207690_10025378
488 Ga0207706_10004109
489 Ga0207706_10030807
490 Ga0207706_10227374
491 Ga0207706_10356306
492 Ga0207706_10584331
493 Ga0207669_10024019
494 Ga0207704_10142741
495 Ga0207704_11239251
496 Ga0207691_10255134
497 Ga0207691_10734827
498 Ga0207711_10000077
499 Ga0207711_10000305
500 Ga0207711_10016211
501 Ga0207711_10017142
502 Ga0207711_10129107
503 Ga0207711_10156301
504 Ga0207661_10011899
505 Ga0207679_10631708
506 Ga0207667_10002926
507 Ga0207651_10016998
508 Ga0207651_10019475
509 Ga0207651_10388303
510 Ga0207712_10016648
511 Ga0207712_10285590
512 Ga0207640_11819892
513 Ga0207658_10004463
514 Ga0207658_10007530
515 Ga0207658_10009652
516 Ga0207658_10386754
517 Ga0207658_10434705
518 Ga0207703_10007149
519 Ga0207703_10017366
520 Ga0207703_11721620
521 Ga0207639_10145339
522 Ga0207708_10445916
523 Ga0207702_10050718
524 Ga0207702_11227146
525 Ga0207641_10000140
526 Ga0207641_10000401
527 Ga0207641_10060857
528 Ga0207641_10159912
529 Ga0207641_10418412
530 Ga0207641_11037294
531 Ga0207648_10028951
532 Ga0207648_10141229
533 Ga0207676_10014796
534 Ga0207676_10068860
535 Ga0207676_10277377
536 Ga0207676_11615982
537 Ga0207674_10812113
538 Ga0207683_10003996
539 Ga0207683_10286695
540 Ga0209281_1025232
541 Ga0209970_1018906
542 Ga0209974_10010094
543 Ga0207428_10174740
544 Ga0268266_10000131
545 Ga0268265_10003643
546 Ga0268265_10010674
547 Ga0268265_10803230
548 Ga0268264_10001714
549 Ga0268264_10010181
550 Ga0268264_10100656
551 Ga0307515_10199625
552 Ga0307408_100042329
553 Ga0307408_100213302
554 Ga0307408_100905557
555 Ga0307405_10019315
556 Ga0307405_10205878
557 Ga0307405_10222965
558 Ga0307405_10579736
559 Ga0307413_10067562
560 Ga0307413_10078066
561 Ga0307413_10168532
562 Ga0307413_10954006
563 Ga0307410_10022481
564 Ga0307410_10064236
565 Ga0307410_10112033
566 Ga0307410_10147946
567 Ga0307410_10186775
568 Ga0307410_10196009
569 Ga0307410_10319176
570 Ga0307410_10386310
571 Ga0307410_10709689
572 Ga0307406_10009362
573 Ga0307406_10034643
574 Ga0307406_10065390
575 Ga0307407_10055263
576 Ga0307407_10121027
577 Ga0307407_10264476
578 Ga0307407_10352276
579 Ga0307412_10003244
580 Ga0307412_10052470
581 Ga0307412_10186343
582 Ga0307409_100021600
583 Ga0307409_100041948
584 Ga0307409_100124323
585 Ga0307409_100261058
586 Ga0307409_100326335
587 Ga0307409_100367524
588 Ga0307409_100955630
589 Ga0307409_100985115
590 Ga0307416_100061768
591 Ga0307416_100068888
592 Ga0307416_100117201
593 Ga0307416_100733474
594 Ga0307416_100838166
595 Ga0307416_100853579
596 Ga0307416_101819472
597 Ga0307414_10004893
598 Ga0307414_10110339
599 Ga0307414_10119248
600 Ga0307414_10135675
601 Ga0307411_10001005
602 Ga0307411_10023058
603 Ga0307411_10043926
604 Ga0307411_10131972
605 Ga0307411_10277018
606 Ga0307411_10380643
607 Ga0307411_11057873
608 Ga0307415_100006837
609 Ga0307415_100102676
610 Ga0307415_100115834
611 Ga0307415_100596195
612 Ga0307415_101405508
613 Ga0373943_0316668
614 Ga0395899_0154563
615 Ga0395899_0238993
616 Ga0395900_0003156
617 Ga0395900_0033720
618 Ga0395898_0452369
619 Ga0395905_0000104
620 Ga0395905_0049674
621 Ga0395905_0292385
622 Ga0395905_0329125
623 Ga0395905_0356658
624 Ga0395905_0362486
625 Ga0395901_0003794
626 Ga0395901_0718692
627 Ga0439439_0080247
628 Ga0451853_0491202
629 Ga0439445_0275725
630 Ga0439449_0043005
631 Ga0466970_0095294
632 Ga0466970_0115420
633 Ga0466967_0043449
634 Ga0466967_0073424
635 Ga0466967_0163298
636 Ga0495585_0230604
637 Ga0495643_0012421
638 Ga0495663_0057978
639 Ga0495663_0079697
640 Ga0495654_0056233
641 Ga0495622_0178113
642 Ga0495668_0038068
643 Ga0495668_0063668
644 Ga0495625_0000758
645 Ga0495625_0463715
646 Ga0495669_0010621
647 Ga0495670_0000009
648 Ga0496100_0765249
649 Ga0496103_0625833
650 Ga0496109_0104855
651 Ga0496110_0124209
652 Ga0496112_0272854
653 Ga0496113_0123967
654 Ga0501036_0107718
655 Ga0501039_0296849
656 Ga0501040_0022835
657 Ga0501041_0016113
658 Ga0501048_0561584
659 Ga0501067_0038051
660 Ga0501069_0383299
661 Ga0501072_0475479
662 Ga0501073_0298099
663 Ga0501074_0485833
664 Ga0501077_0132501
665 Ga0501233_047273
666 Ga0501233_181706
667 Ga0501079_0059959
668 Ga0501079_1038460
669 Ga0501080_0408833
670 Ga0501044_0669233
671 Ga0501045_0152086
672 nmdc:mga0k408_11180_c1
673 nmdc:mga05p37_194013_c1
674 nmdc:mga0qj67_134648_c1
675 nmdc:mga06r32_15100_c1
676 nmdc:mga06r32_155844_c1
677 nmdc:mga08y16_1640196_c1
678 nmdc:mga08y16_425862_c1
679 nmdc:mga08y16_75121_c1
680 Ga0500658_0000138
681 Ga0500604_0000019
682 Ga0500627_0000546
683 Ga0500645_001376
684 Ga0501084_0422906
685 Ga0501084_0768341
686 Ga0530510_0382206
687 Ga0530510_1203425
688 8055619612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

40

159

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hci-assembly2.cif.gz_B structure of msrb from xanthomonas campestris (complex-like form) 0.9408 9 158
3hci-assembly2.cif.gz_B structure of msrb from xanthomonas campestris (complex-like form) 0.9174 9 158
3e0o-assembly2.cif.gz_A crystal structure of msrb 0.893 14 141
7cto-assembly6.cif.gz_F staphylococcus aureus msrb 0.8884 24 141
7cto-assembly1.cif.gz_A staphylococcus aureus msrb 0.8867 26 140
ID Description Score Start End Superfamily
af_P34436_5_152_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9022 23 141 2.170.150.20
3e0oC00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.8743 18 141 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.8712 12 141 2.170.150.20
af_P25566_29_168_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.868 25 140 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.8589 12 141 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A849I8T1-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.945 9 152 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A0R0E3T1-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.943 9 158 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-B2I8Y4-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9426 8 161 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A3R7G1Y5-F1-model_v4 deleted 0.9413 9 158
AF-A0A1F8I053-F1-model_v4 deleted 0.9413 9 152

Map