F416040

General Info

Members Datasets Scaffolds Average Seq Length
344 212 688 267

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0021993|Ga0373935_0021993_661_1566
Length 301
Sequence LWYKKGLGTARLCASQHVRCGSVQEKWVTDLNPQAKQMADESMVRNLAAQARAIWPQEAPLFGRYALPAEPRILDAGCGTGEAASRLAELFSRAQVLGIDIIDAHLDLARARYRHLAARLSFEHQSVYALAAPDRSFDLTVCRHVIHAIPHPEQVVAELVRVTRPGGYLHLIPEDYGMLHFQRGALDPQDFWHVVPTRFGAATGTDLFVGRNVCQILAALELEAITMDYVVVDTIRVPRETFASILEAWRDGYAEPIGELTPITRETALAYFDQMIADIRNPQRYAVWMVPVASARVPGGA

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.45
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 11.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0021993 3300035692 Bacteria 3905
2 MBSR1b_contig_13482272 2162886012 Unclassified 1152
3 rootH2_10141928 3300003320 Bacteria 3166
4 rootH1_10244176 3300003323 Bacteria 2171
5 Ga0065715_10016577 3300005293 Bacteria 1829
6 Ga0065707_10087313 3300005295 Bacteria 5079
7 Ga0070676_10115219 3300005328 Bacteria 1679
8 Ga0070683_100120080 3300005329 Bacteria 2482
9 Ga0070690_100001815 3300005330 Bacteria 11312
10 Ga0068869_100141900 3300005334 Bacteria 1855
11 Ga0068869_100282745 3300005334 Bacteria 1334
12 Ga0068869_100330370 3300005334 Bacteria 1239
13 Ga0070666_10058766 3300005335 Bacteria 2600
14 Ga0070666_10099909 3300005335 Bacteria 1998
15 Ga0070680_100227591 3300005336 Bacteria 1574
16 Ga0068868_100273977 3300005338 Bacteria 1426
17 Ga0068868_100358486 3300005338 Bacteria 1250
18 Ga0070689_100004554 3300005340 Bacteria 9385
19 Ga0070689_100111796 3300005340 Bacteria 2173
20 Ga0070689_100445643 3300005340 Unclassified 1101
21 Ga0070661_100216920 3300005344 Bacteria 1466
22 Ga0070674_100024540 3300005356 Bacteria 3915
23 Ga0070673_100043415 3300005364 Bacteria 3474
24 Ga0070673_100349893 3300005364 Bacteria 1311
25 Ga0070688_100003175 3300005365 Bacteria 8418
26 Ga0070688_100154284 3300005365 Unclassified 1572
27 Ga0070659_100041833 3300005366 Bacteria 3583
28 Ga0070667_100098756 3300005367 Bacteria 2519
29 Ga0070709_10088230 3300005434 Bacteria 2040
30 Ga0070714_100287461 3300005435 Bacteria 1529
31 Ga0070713_100032122 3300005436 Bacteria 4189
32 Ga0070713_100282748 3300005436 Bacteria 1522
33 Ga0070713_100443209 3300005436 Bacteria 1218
34 Ga0070701_10023330 3300005438 Bacteria 2979
35 Ga0070711_100066250 3300005439 Bacteria 2529
36 Ga0070711_100431302 3300005439 Bacteria 1076
37 Ga0070694_100055246 3300005444 Bacteria 2693
38 Ga0070694_100134098 3300005444 Bacteria 1792
39 Ga0070708_100106586 3300005445 Bacteria 2572
40 Ga0070708_100233431 3300005445 Bacteria 1726
41 Ga0070662_100054060 3300005457 Bacteria 2909
42 Ga0068867_100145033 3300005459 Bacteria 1859
43 Ga0070685_10005178 3300005466 Bacteria 6613
44 Ga0070706_100053360 3300005467 Bacteria 3731
45 Ga0070706_100123600 3300005467 Bacteria 2413
46 Ga0070706_100358767 3300005467 Bacteria 1358
47 Ga0070707_100131725 3300005468 Bacteria 2431
48 Ga0070707_100328205 3300005468 Bacteria 1487
49 Ga0070698_100115606 3300005471 Unclassified 2647
50 Ga0070698_100195578 3300005471 Unclassified 1959
51 Ga0070699_100411840 3300005518 Bacteria 1223
52 Ga0070679_100178492 3300005530 Bacteria 2096
53 Ga0070684_100125115 3300005535 Bacteria 2315
54 Ga0070695_100000753 3300005545 Bacteria 17386
55 Ga0070695_100225611 3300005545 Unclassified 1352
56 Ga0070696_100076154 3300005546 Bacteria 2368
57 Ga0070696_100195975 3300005546 Unclassified 1506
58 Ga0070693_100003655 3300005547 Bacteria 7186
59 Ga0070665_100036016 3300005548 Bacteria 4979
60 Ga0070704_100030566 3300005549 Unclassified 3610
61 Ga0070704_100041018 3300005549 Bacteria 3191
62 Ga0068854_100136299 3300005578 Bacteria 1879
63 Ga0068856_100019224 3300005614 Bacteria 6632
64 Ga0068856_100139328 3300005614 Bacteria 2433
65 Ga0068856_100197215 3300005614 Bacteria 2027
66 Ga0070702_100011939 3300005615 Bacteria 4335
67 Ga0068852_100189491 3300005616 Bacteria 1939
68 Ga0068859_100133531 3300005617 Bacteria 2554
69 Ga0068859_100213952 3300005617 Bacteria 2014
70 Ga0068859_100221211 3300005617 Bacteria 1981
71 Ga0068864_100162084 3300005618 Bacteria 2033
72 Ga0068866_10035408 3300005718 Bacteria 2438
73 Ga0068863_100078599 3300005841 Bacteria 3124
74 Ga0068858_100324047 3300005842 Unclassified 1473
75 Ga0068860_100414488 3300005843 Bacteria 1334
76 Ga0068860_100492107 3300005843 Bacteria 1223
77 Ga0068862_100569623 3300005844 Unclassified 1084
78 Ga0070717_10139912 3300006028 Bacteria 2087
79 Ga0070716_100108341 3300006173 Bacteria 1716
80 Ga0070712_100060850 3300006175 Bacteria 2665
81 Ga0070712_100374690 3300006175 Unclassified 1170
82 Ga0097621_100404682 3300006237 Bacteria 1222
83 Ga0068871_100012106 3300006358 Bacteria 6349
84 Ga0068871_100052777 3300006358 Bacteria 3294
85 Ga0075428_100458131 3300006844 Bacteria 1366
86 Ga0075430_100124911 3300006846 Bacteria 2145
87 Ga0075431_100196935 3300006847 Bacteria 2062
88 Ga0075431_100206099 3300006847 Unclassified 2010
89 Ga0075433_10118548 3300006852 Bacteria 2349
90 Ga0075433_10493686 3300006852 Bacteria 1078
91 Ga0075434_100040455 3300006871 Bacteria 4616
92 Ga0075434_100058488 3300006871 Unclassified 3831
93 Ga0075434_100266645 3300006871 Bacteria 1732
94 Ga0075434_100720285 3300006871 Bacteria 1015
95 Ga0075429_100094507 3300006880 Unclassified 2607
96 Ga0068865_100288218 3300006881 Bacteria 1310
97 Ga0075436_100041112 3300006914 Bacteria 3190
98 Ga0075436_100252150 3300006914 Bacteria 1257
99 Ga0097620_100133528 3300006931 Bacteria 2554
100 Ga0097620_100213932 3300006931 Bacteria 2014
101 Ga0097620_100221219 3300006931 Bacteria 1981
102 Ga0111539_10010812 3300009094 Bacteria 11490
103 Ga0111539_10019603 3300009094 Bacteria 8345
104 Ga0111539_10380253 3300009094 Bacteria 1644
105 Ga0105245_10009498 3300009098 Bacteria 8484
106 Ga0105245_10077269 3300009098 Bacteria 3035
107 Ga0105245_10214229 3300009098 Bacteria 1855
108 Ga0105247_10044989 3300009101 Bacteria 2708
109 Ga0114129_10146072 3300009147 Bacteria 3240
110 Ga0114129_10195136 3300009147 Bacteria 2746
111 Ga0105243_10393724 3300009148 Bacteria 1285
112 Ga0105241_10025662 3300009174 Bacteria 4380
113 Ga0105242_10075832 3300009176 Bacteria 2801
114 Ga0105242_10157762 3300009176 Bacteria 1983
115 Ga0105242_10385206 3300009176 Bacteria 1304
116 Ga0105248_10082490 3300009177 Bacteria 3616
117 Ga0105248_10345671 3300009177 Bacteria 1675
118 Ga0105248_10526203 3300009177 Bacteria 1333
119 Ga0105238_10073502 3300009551 Bacteria 3414
120 Ga0105238_10076515 3300009551 Bacteria 3338
121 Ga0105238_10544717 3300009551 Bacteria 1164
122 Ga0105246_10054492 3300011119 Bacteria 2756
123 Ga0157373_10358647 3300013100 Bacteria 1040
124 Ga0157370_10148122 3300013104 Bacteria 2185
125 Ga0157378_10194376 3300013297 Bacteria 1916
126 Ga0163162_10012357 3300013306 Bacteria 8337
127 Ga0163162_10121275 3300013306 Bacteria 2719
128 Ga0157372_10600177 3300013307 Bacteria 1283
129 Ga0163163_10142007 3300014325 Bacteria 2444
130 Ga0157379_10024408 3300014968 Bacteria 5368
131 Ga0157376_10260162 3300014969 Bacteria 1625
132 Ga0157376_10294489 3300014969 Bacteria 1534
133 Ga0213873_10000467 3300021358 Bacteria 6489
134 Ga0213874_10001051 3300021377 Bacteria 5663
135 Ga0213876_10007942 3300021384 Bacteria 5756
136 Ga0213875_10129452 3300021388 Bacteria 1180
137 Ga0207642_10019620 3300025899 Bacteria 2621
138 Ga0207710_10032662 3300025900 Bacteria 2280
139 Ga0207680_10003434 3300025903 Bacteria 7471
140 Ga0207699_10162461 3300025906 Bacteria 1488
141 Ga0207684_10034493 3300025910 Bacteria 4299
142 Ga0207684_10309602 3300025910 Bacteria 1361
143 Ga0207654_10055218 3300025911 Bacteria 2299
144 Ga0207654_10094391 3300025911 Bacteria 1831
145 Ga0207707_10204867 3300025912 Bacteria 1719
146 Ga0207693_10001261 3300025915 Bacteria 22552
147 Ga0207693_10045883 3300025915 Bacteria 3433
148 Ga0207663_10011798 3300025916 Bacteria 4704
149 Ga0207657_10001662 3300025919 Bacteria 23985
150 Ga0207646_10030430 3300025922 Bacteria 4894
151 Ga0207687_10001027 3300025927 Bacteria 18959
152 Ga0207687_10095630 3300025927 Bacteria 2176
153 Ga0207700_10016959 3300025928 Bacteria 4851
154 Ga0207690_10254788 3300025932 Bacteria 1357
155 Ga0207706_10025333 3300025933 Bacteria 5316
156 Ga0207686_10000089 3300025934 Bacteria 74250
157 Ga0207686_10342019 3300025934 Bacteria 1124
158 Ga0207670_10077552 3300025936 Bacteria 2315
159 Ga0207669_10021122 3300025937 Bacteria 3429
160 Ga0207704_10031284 3300025938 Bacteria 2996
161 Ga0207665_10034648 3300025939 Bacteria 3349
162 Ga0207665_10044932 3300025939 Bacteria 2956
163 Ga0207665_10098227 3300025939 Bacteria 2040
164 Ga0207691_10024330 3300025940 Bacteria 5695
165 Ga0207711_10001159 3300025941 Bacteria 25076
166 Ga0207689_10038386 3300025942 Bacteria 3967
167 Ga0207689_10126164 3300025942 Bacteria 2105
168 Ga0207689_10296199 3300025942 Bacteria 1340
169 Ga0207651_10037318 3300025960 Bacteria 3182
170 Ga0207640_10062367 3300025981 Bacteria 2473
171 Ga0207677_10000112 3300026023 Bacteria 66499
172 Ga0207678_10103833 3300026067 Bacteria 2425
173 Ga0207702_10129295 3300026078 Bacteria 2271
174 Ga0207702_10161306 3300026078 Bacteria 2048
175 Ga0207641_10319549 3300026088 Bacteria 1472
176 Ga0207648_10060078 3300026089 Bacteria 3315
177 Ga0207676_10000308 3300026095 Bacteria 41777
178 Ga0207683_10002304 3300026121 Bacteria 16738
179 Ga0207698_10131968 3300026142 Bacteria 2136
180 Ga0268266_10175795 3300028379 Unclassified 1946
181 Ga0268265_10516908 3300028380 Unclassified 1128
182 Ga0268264_10328053 3300028381 Bacteria 1449
183 Ga0265338_10028316 3300028800 Bacteria 5590
184 Ga0265760_10005575 3300031090 Bacteria 3603
185 Ga0265760_10047513 3300031090 Unclassified 1289
186 Ga0265325_10006489 3300031241 Bacteria 7091
187 Ga0265340_10009166 3300031247 Bacteria 5321
188 Ga0265313_10020639 3300031595 Bacteria 3629
189 Ga0307416_100261452 3300032002 Bacteria 1692
190 Ga0307510_10017180 3300033180 Bacteria 8536
191 Ga0373926_0083118 3300035083 Unclassified 1185
192 Ga0373934_0002036 3300035086 Bacteria 7426
193 Ga0373934_0011570 3300035086 Bacteria 3319
194 Ga0373944_0041312 3300035089 Bacteria 1426
195 Ga0373936_0030502 3300035113 Bacteria 2126
196 Ga0373945_0013454 3300035116 Bacteria 2731
197 Ga0373953_0013168 3300035117 Bacteria 2948
198 Ga0373954_0019549 3300035118 Bacteria 3056
199 Ga0373954_0038688 3300035118 Unclassified 2219
200 Ga0373954_0058803 3300035118 Unclassified 1811
201 Ga0373954_0108104 3300035118 Bacteria 1344
202 Ga0373956_0010177 3300035119 Bacteria 3844
203 Ga0373956_0022956 3300035119 Bacteria 2673
204 Ga0373956_0030413 3300035119 Bacteria 2360
205 Ga0373956_0048380 3300035119 Bacteria 1904
206 Ga0373956_0103570 3300035119 Unclassified 1322
207 Ga0373957_0005952 3300035120 Bacteria 3814
208 Ga0373943_0016271 3300035170 Bacteria 3389
209 Ga0373946_0002746 3300035171 Bacteria 6223
210 Ga0373946_0024493 3300035171 Bacteria 2365
211 Ga0373955_0009367 3300035172 Bacteria 4583
212 Ga0373924_0039193 3300035410 Bacteria 1935
213 Ga0373924_0090818 3300035410 Unclassified 1306
214 Ga0373935_0014896 3300035692 Bacteria 4696
215 Ga0373935_0019937 3300035692 Bacteria 4092
216 Ga0373935_0108392 3300035692 Bacteria 1840
217 Ga0373927_0030008 3300035695 Bacteria 3548
218 Ga0373927_0119415 3300035695 Unclassified 1720
219 Ga0373927_0152653 3300035695 Bacteria 1512
220 Ga0373927_0299406 3300035695 Unclassified 1058
221 Ga0373933_0004507 3300035724 Bacteria 7637
222 Ga0373933_0062922 3300035724 Bacteria 2242
223 Ga0373933_0106935 3300035724 Bacteria 1741
224 Ga0373947_0024941 3300035725 Bacteria 3487
225 Ga0373947_0095899 3300035725 Bacteria 1856
226 Ga0373947_0271173 3300035725 Bacteria 1126
227 Ga0373947_0371307 3300035725 Unclassified 962
228 Ga0373937_0000015 3300036401 Bacteria 148228
229 Ga0373937_0000130 3300036401 Bacteria 72827
230 Ga0373937_0010548 3300036401 Bacteria 8070
231 Ga0373937_0012352 3300036401 Bacteria 7510
232 Ga0373937_0257141 3300036401 Bacteria 1646
233 Ga0373937_0516902 3300036401 Bacteria 1134
234 Ga0373925_0015504 3300037068 Bacteria 5511
235 Ga0373925_0019745 3300037068 Bacteria 4904
236 Ga0436364_0061824 3300037853 Unclassified 1269
237 Ga0436364_0426182 3300037853 Unclassified 2225
238 Ga0436365_0370511 3300039437 Bacteria 26229
239 Ga0436361_0265963 3300039447 Bacteria 1209
240 Ga0436363_0699073 3300039450 Bacteria 23998
241 Ga0436362_0785337 3300039453 Bacteria 5672
242 Ga0451576_0005185 3300045051 Bacteria 16477
243 Ga0451576_0075873 3300045051 Bacteria 3498
244 Ga0451576_0652129 3300045051 Bacteria 1106
245 Ga0451576_0850958 3300045051 Bacteria 957
246 Ga0495592_0011712 3300046454 Bacteria 6643
247 Ga0495592_0116396 3300046454 Bacteria 1886
248 Ga0495592_0219859 3300046454 Bacteria 1271
249 Ga0495603_0129179 3300046455 Bacteria 1472
250 Ga0495629_0089946 3300046459 Bacteria 2141
251 Ga0495651_0006705 3300046462 Bacteria 8801
252 Ga0495651_0066994 3300046462 Bacteria 2739
253 Ga0495651_0110985 3300046462 Bacteria 2027
254 Ga0495651_0148279 3300046462 Bacteria 1694
255 Ga0495653_0043846 3300046463 Bacteria 3475
256 Ga0495653_0070407 3300046463 Bacteria 2618
257 Ga0495580_0034943 3300046472 Bacteria 3616
258 Ga0495580_0061445 3300046472 Bacteria 2638
259 Ga0495580_0077848 3300046472 Bacteria 2313
260 Ga0495582_0047041 3300046473 Bacteria 2375
261 Ga0495582_0057773 3300046473 Bacteria 2139
262 Ga0495639_0008800 3300046475 Bacteria 4330
263 Ga0495664_0057958 3300046477 Bacteria 2304
264 Ga0495664_0084806 3300046477 Unclassified 1902
265 Ga0495608_0012621 3300046511 Bacteria 5862
266 Ga0495608_0055591 3300046511 Bacteria 2616
267 Ga0495608_0220238 3300046511 Bacteria 1191
268 Ga0495628_0015906 3300046516 Bacteria 6278
269 Ga0495628_0030057 3300046516 Bacteria 4401
270 Ga0495628_0193493 3300046516 Bacteria 1535
271 Ga0495666_0027222 3300046526 Bacteria 2815
272 Ga0495666_0090639 3300046526 Bacteria 1443
273 Ga0495652_0034158 3300046529 Bacteria 4434
274 Ga0495652_0073822 3300046529 Bacteria 2839
275 Ga0495665_0004206 3300046531 Bacteria 7768
276 Ga0495665_0041038 3300046531 Bacteria 2463
277 Ga0495586_0041016 3300046535 Bacteria 2492
278 Ga0495587_0000081 3300046536 Bacteria 74942
279 Ga0495587_0120872 3300046536 Unclassified 1500
280 Ga0495621_0037300 3300046539 Bacteria 1690
281 Ga0495645_0021446 3300046543 Bacteria 4669
282 Ga0495645_0042985 3300046543 Bacteria 3296
283 Ga0495667_0046550 3300046559 Bacteria 2868
284 Ga0495667_0117079 3300046559 Bacteria 1721
285 Ga0495625_0273225 3300046660 Bacteria 1090
286 Ga0495635_0018688 3300046663 Bacteria 4834
287 Ga0495635_0078919 3300046663 Bacteria 2253
288 Ga0495588_0175187 3300046674 Bacteria 1134
289 Ga0495657_0064846 3300046675 Bacteria 2404
290 Ga0495599_0070272 3300046678 Bacteria 2185
291 Ga0495599_0095156 3300046678 Bacteria 1858
292 Ga0495623_0007132 3300046679 Bacteria 7257
293 Ga0495646_0012192 3300046680 Bacteria 5465
294 Ga0495646_0129108 3300046680 Unclassified 1424
295 Ga0495647_0029608 3300046681 Bacteria 2025
296 Ga0495613_0032527 3300046689 Bacteria 3875
297 Ga0495613_0032914 3300046689 Bacteria 3852
298 Ga0495624_0049580 3300046690 Bacteria 2662
299 Ga0495600_0053203 3300046809 Bacteria 2644
300 Ga0495581_0009521 3300047315 Bacteria 5623
301 Ga0495581_0210411 3300047315 Unclassified 1137
302 Ga0495604_0022691 3300047317 Bacteria 5011
303 Ga0495604_0205205 3300047317 Unclassified 1364
304 Ga0495674_0224812 3300047319 Bacteria 1550
305 Ga0495680_0058029 3300047322 Bacteria 2992
306 Ga0495680_0180035 3300047322 Bacteria 1526
307 Ga0495675_0001405 3300047444 Bacteria 14584
308 Ga0495675_0013950 3300047444 Bacteria 5081
309 Ga0495675_0036122 3300047444 Bacteria 3153
310 Ga0495684_0011077 3300047471 Bacteria 6971
311 Ga0495593_0084526 3300047673 Bacteria 1638
312 Ga0495602_0000101 3300048088 Bacteria 81181
313 Ga0495602_0084112 3300048088 Bacteria 2662
314 Ga0495602_0199443 3300048088 Bacteria 1528
315 Ga0495614_0023132 3300048089 Bacteria 2680
316 Ga0495614_0058603 3300048089 Unclassified 1653
317 Ga0496101_0171882 3300048904 Unclassified 1666
318 Ga0496106_0123719 3300048909 Bacteria 2024
319 Ga0496107_0210331 3300048910 Bacteria 1446
320 Ga0496109_0264181 3300048912 Bacteria 1621
321 Ga0496112_0120348 3300048915 Bacteria 2595
322 Ga0496119_0013317 3300048922 Bacteria 6570
323 Ga0496120_0026213 3300048923 Bacteria 3603
324 Ga0496121_0138817 3300048924 Bacteria 1806
325 nmdc:mga05p37_174388_c1 3300050507 Bacteria 2620
326 nmdc:mga05p37_653057_c1 3300050507 Unclassified 1177
327 nmdc:mga09592_177756_c1 3300050508 Bacteria 1841
328 nmdc:mga09592_29240_c1 3300050508 Bacteria 4582
329 nmdc:mga0qj67_256802_c1 3300050509 Bacteria 1418
330 nmdc:mga06r32_196516_c1 3300050510 Unclassified 2004
331 nmdc:mga06r32_294602_c1 3300050510 Bacteria 1609
332 nmdc:mga08y16_39323_c1 3300050511 Bacteria 4964
333 nmdc:mga08y16_827109_c1 3300050511 Bacteria 917
334 nmdc:mga08y16_92229_c1 3300050511 Bacteria 3156
335 nmdc:mga0n895_38808_c1 3300050512 Bacteria 4616
336 nmdc:mga0n895_60245_c1 3300050512 Bacteria 3745
337 nmdc:mga08x19_288033_c1 3300050514 Unclassified 1139
338 nmdc:mga08x19_361846_c1 3300050514 Unclassified 1014
339 nmdc:mga08x19_47166_c1 3300050514 Unclassified 2757
340 nmdc:mga0a205_162931_c1 3300050515 Unclassified 2126
341 nmdc:mga0a205_192470_c1 3300050515 Bacteria 1931
342 Ga0495612_0010888 3300053078 Bacteria 3673
343 Ga0495612_0012384 3300053078 Bacteria 3438
344 Ga0495619_0010540 3300053085 Bacteria 5815
345 Ga0373935_0021993
346 MBSR1b_contig_13482272
347 rootH2_10141928
348 rootH1_10244176
349 Ga0065715_10016577
350 Ga0065707_10087313
351 Ga0070676_10115219
352 Ga0070683_100120080
353 Ga0070690_100001815
354 Ga0068869_100141900
355 Ga0068869_100282745
356 Ga0068869_100330370
357 Ga0070666_10058766
358 Ga0070666_10099909
359 Ga0070680_100227591
360 Ga0068868_100273977
361 Ga0068868_100358486
362 Ga0070689_100004554
363 Ga0070689_100111796
364 Ga0070689_100445643
365 Ga0070661_100216920
366 Ga0070674_100024540
367 Ga0070673_100043415
368 Ga0070673_100349893
369 Ga0070688_100003175
370 Ga0070688_100154284
371 Ga0070659_100041833
372 Ga0070667_100098756
373 Ga0070709_10088230
374 Ga0070714_100287461
375 Ga0070713_100032122
376 Ga0070713_100282748
377 Ga0070713_100443209
378 Ga0070701_10023330
379 Ga0070711_100066250
380 Ga0070711_100431302
381 Ga0070694_100055246
382 Ga0070694_100134098
383 Ga0070708_100106586
384 Ga0070708_100233431
385 Ga0070662_100054060
386 Ga0068867_100145033
387 Ga0070685_10005178
388 Ga0070706_100053360
389 Ga0070706_100123600
390 Ga0070706_100358767
391 Ga0070707_100131725
392 Ga0070707_100328205
393 Ga0070698_100115606
394 Ga0070698_100195578
395 Ga0070699_100411840
396 Ga0070679_100178492
397 Ga0070684_100125115
398 Ga0070695_100000753
399 Ga0070695_100225611
400 Ga0070696_100076154
401 Ga0070696_100195975
402 Ga0070693_100003655
403 Ga0070665_100036016
404 Ga0070704_100030566
405 Ga0070704_100041018
406 Ga0068854_100136299
407 Ga0068856_100019224
408 Ga0068856_100139328
409 Ga0068856_100197215
410 Ga0070702_100011939
411 Ga0068852_100189491
412 Ga0068859_100133531
413 Ga0068859_100213952
414 Ga0068859_100221211
415 Ga0068864_100162084
416 Ga0068866_10035408
417 Ga0068863_100078599
418 Ga0068858_100324047
419 Ga0068860_100414488
420 Ga0068860_100492107
421 Ga0068862_100569623
422 Ga0070717_10139912
423 Ga0070716_100108341
424 Ga0070712_100060850
425 Ga0070712_100374690
426 Ga0097621_100404682
427 Ga0068871_100012106
428 Ga0068871_100052777
429 Ga0075428_100458131
430 Ga0075430_100124911
431 Ga0075431_100196935
432 Ga0075431_100206099
433 Ga0075433_10118548
434 Ga0075433_10493686
435 Ga0075434_100040455
436 Ga0075434_100058488
437 Ga0075434_100266645
438 Ga0075434_100720285
439 Ga0075429_100094507
440 Ga0068865_100288218
441 Ga0075436_100041112
442 Ga0075436_100252150
443 Ga0097620_100133528
444 Ga0097620_100213932
445 Ga0097620_100221219
446 Ga0111539_10010812
447 Ga0111539_10019603
448 Ga0111539_10380253
449 Ga0105245_10009498
450 Ga0105245_10077269
451 Ga0105245_10214229
452 Ga0105247_10044989
453 Ga0114129_10146072
454 Ga0114129_10195136
455 Ga0105243_10393724
456 Ga0105241_10025662
457 Ga0105242_10075832
458 Ga0105242_10157762
459 Ga0105242_10385206
460 Ga0105248_10082490
461 Ga0105248_10345671
462 Ga0105248_10526203
463 Ga0105238_10073502
464 Ga0105238_10076515
465 Ga0105238_10544717
466 Ga0105246_10054492
467 Ga0157373_10358647
468 Ga0157370_10148122
469 Ga0157378_10194376
470 Ga0163162_10012357
471 Ga0163162_10121275
472 Ga0157372_10600177
473 Ga0163163_10142007
474 Ga0157379_10024408
475 Ga0157376_10260162
476 Ga0157376_10294489
477 Ga0213873_10000467
478 Ga0213874_10001051
479 Ga0213876_10007942
480 Ga0213875_10129452
481 Ga0207642_10019620
482 Ga0207710_10032662
483 Ga0207680_10003434
484 Ga0207699_10162461
485 Ga0207684_10034493
486 Ga0207684_10309602
487 Ga0207654_10055218
488 Ga0207654_10094391
489 Ga0207707_10204867
490 Ga0207693_10001261
491 Ga0207693_10045883
492 Ga0207663_10011798
493 Ga0207657_10001662
494 Ga0207646_10030430
495 Ga0207687_10001027
496 Ga0207687_10095630
497 Ga0207700_10016959
498 Ga0207690_10254788
499 Ga0207706_10025333
500 Ga0207686_10000089
501 Ga0207686_10342019
502 Ga0207670_10077552
503 Ga0207669_10021122
504 Ga0207704_10031284
505 Ga0207665_10034648
506 Ga0207665_10044932
507 Ga0207665_10098227
508 Ga0207691_10024330
509 Ga0207711_10001159
510 Ga0207689_10038386
511 Ga0207689_10126164
512 Ga0207689_10296199
513 Ga0207651_10037318
514 Ga0207640_10062367
515 Ga0207677_10000112
516 Ga0207678_10103833
517 Ga0207702_10129295
518 Ga0207702_10161306
519 Ga0207641_10319549
520 Ga0207648_10060078
521 Ga0207676_10000308
522 Ga0207683_10002304
523 Ga0207698_10131968
524 Ga0268266_10175795
525 Ga0268265_10516908
526 Ga0268264_10328053
527 Ga0265338_10028316
528 Ga0265760_10005575
529 Ga0265760_10047513
530 Ga0265325_10006489
531 Ga0265340_10009166
532 Ga0265313_10020639
533 Ga0307416_100261452
534 Ga0307510_10017180
535 Ga0373926_0083118
536 Ga0373934_0002036
537 Ga0373934_0011570
538 Ga0373944_0041312
539 Ga0373936_0030502
540 Ga0373945_0013454
541 Ga0373953_0013168
542 Ga0373954_0019549
543 Ga0373954_0038688
544 Ga0373954_0058803
545 Ga0373954_0108104
546 Ga0373956_0010177
547 Ga0373956_0022956
548 Ga0373956_0030413
549 Ga0373956_0048380
550 Ga0373956_0103570
551 Ga0373957_0005952
552 Ga0373943_0016271
553 Ga0373946_0002746
554 Ga0373946_0024493
555 Ga0373955_0009367
556 Ga0373924_0039193
557 Ga0373924_0090818
558 Ga0373935_0014896
559 Ga0373935_0019937
560 Ga0373935_0108392
561 Ga0373927_0030008
562 Ga0373927_0119415
563 Ga0373927_0152653
564 Ga0373927_0299406
565 Ga0373933_0004507
566 Ga0373933_0062922
567 Ga0373933_0106935
568 Ga0373947_0024941
569 Ga0373947_0095899
570 Ga0373947_0271173
571 Ga0373947_0371307
572 Ga0373937_0000015
573 Ga0373937_0000130
574 Ga0373937_0010548
575 Ga0373937_0012352
576 Ga0373937_0257141
577 Ga0373937_0516902
578 Ga0373925_0015504
579 Ga0373925_0019745
580 Ga0436364_0061824
581 Ga0436364_0426182
582 Ga0436365_0370511
583 Ga0436361_0265963
584 Ga0436363_0699073
585 Ga0436362_0785337
586 Ga0451576_0005185
587 Ga0451576_0075873
588 Ga0451576_0652129
589 Ga0451576_0850958
590 Ga0495592_0011712
591 Ga0495592_0116396
592 Ga0495592_0219859
593 Ga0495603_0129179
594 Ga0495629_0089946
595 Ga0495651_0006705
596 Ga0495651_0066994
597 Ga0495651_0110985
598 Ga0495651_0148279
599 Ga0495653_0043846
600 Ga0495653_0070407
601 Ga0495580_0034943
602 Ga0495580_0061445
603 Ga0495580_0077848
604 Ga0495582_0047041
605 Ga0495582_0057773
606 Ga0495639_0008800
607 Ga0495664_0057958
608 Ga0495664_0084806
609 Ga0495608_0012621
610 Ga0495608_0055591
611 Ga0495608_0220238
612 Ga0495628_0015906
613 Ga0495628_0030057
614 Ga0495628_0193493
615 Ga0495666_0027222
616 Ga0495666_0090639
617 Ga0495652_0034158
618 Ga0495652_0073822
619 Ga0495665_0004206
620 Ga0495665_0041038
621 Ga0495586_0041016
622 Ga0495587_0000081
623 Ga0495587_0120872
624 Ga0495621_0037300
625 Ga0495645_0021446
626 Ga0495645_0042985
627 Ga0495667_0046550
628 Ga0495667_0117079
629 Ga0495625_0273225
630 Ga0495635_0018688
631 Ga0495635_0078919
632 Ga0495588_0175187
633 Ga0495657_0064846
634 Ga0495599_0070272
635 Ga0495599_0095156
636 Ga0495623_0007132
637 Ga0495646_0012192
638 Ga0495646_0129108
639 Ga0495647_0029608
640 Ga0495613_0032527
641 Ga0495613_0032914
642 Ga0495624_0049580
643 Ga0495600_0053203
644 Ga0495581_0009521
645 Ga0495581_0210411
646 Ga0495604_0022691
647 Ga0495604_0205205
648 Ga0495674_0224812
649 Ga0495680_0058029
650 Ga0495680_0180035
651 Ga0495675_0001405
652 Ga0495675_0013950
653 Ga0495675_0036122
654 Ga0495684_0011077
655 Ga0495593_0084526
656 Ga0495602_0000101
657 Ga0495602_0084112
658 Ga0495602_0199443
659 Ga0495614_0023132
660 Ga0495614_0058603
661 Ga0496101_0171882
662 Ga0496106_0123719
663 Ga0496107_0210331
664 Ga0496109_0264181
665 Ga0496112_0120348
666 Ga0496119_0013317
667 Ga0496120_0026213
668 Ga0496121_0138817
669 nmdc:mga05p37_174388_c1
670 nmdc:mga05p37_653057_c1
671 nmdc:mga09592_177756_c1
672 nmdc:mga09592_29240_c1
673 nmdc:mga0qj67_256802_c1
674 nmdc:mga06r32_196516_c1
675 nmdc:mga06r32_294602_c1
676 nmdc:mga08y16_39323_c1
677 nmdc:mga08y16_827109_c1
678 nmdc:mga08y16_92229_c1
679 nmdc:mga0n895_38808_c1
680 nmdc:mga0n895_60245_c1
681 nmdc:mga08x19_288033_c1
682 nmdc:mga08x19_361846_c1
683 nmdc:mga08x19_47166_c1
684 nmdc:mga0a205_162931_c1
685 nmdc:mga0a205_192470_c1
686 Ga0495612_0010888
687 Ga0495612_0012384
688 Ga0495619_0010540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

74

171

0.98

PF13649

Methyltransf_25

Methyltransferase domain

73

167

0.96

PF13847

Methyltransf_31

Methyltransferase domain

69

178

0.95

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

37

197

0.9

PF08242

Methyltransf_12

Methyltransferase domain

74

169

0.86

PF13489

Methyltransf_23

Methyltransferase domain

47

227

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8659 40 270
5eeg-assembly1.cif.gz_B crystal structure of carminomycin-4-o-methyltransferase dnrk in complex with tetrazole-sah 0.8636 36 148
3m70-assembly1.cif.gz_A crystal structure of tehb from haemophilus influenzae 0.8176 32 148
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8142 40 270
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8097 32 149
ID Description Score Start End Superfamily
af_A0A1D6QMW6_179_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9406 47 144 3.40.50.150
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9067 33 142 3.40.50.150
2o57A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8998 32 144 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8966 29 142 3.40.50.150
af_Q9TYP1_15_268_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.893 29 144 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V8DKA1-F1-model_v4 SAM-dependent methyltransferase 0.954 171 269 GO:0008168
GO:0032259
AF-A0A1L5PFC7-F1-model_v4 Ubiquinone/menaquinone biosynthesis methyltransferase protein 0.9231 2 269 GO:0008757
GO:0032259
AF-A0A534NTK9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9212 19 250 GO:0008168
GO:0032259
AF-A0A1L5PFC7-F1-model_v4 Ubiquinone/menaquinone biosynthesis methyltransferase protein 0.9133 2 269 GO:0008757
GO:0032259
AF-W7QPI8-F1-model_v4 Type 11 methyltransferase 0.904 32 144 GO:0008757
GO:0032259

Map